Homeobox protein SIX1

Overview
NameHomeobox protein SIX1
Smed IDSMED30005620
Length (bp)1626
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox protein SIX1 (SMED30005620) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox protein SIX1 (SMED30005620) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox protein SIX1 (SMED30005620) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox protein SIX1 (SMED30005620) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005620

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005620SMESG000005975.1 SmedASXL_009728SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridial progenitor cellSMED30005620SMESG000005975.1 SMED30005620smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X2 cellSMED30005620SMESG000005975.1 SmedASXL_009728SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30005620SMESG000005975.1 dd_Smed_v4_9774_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005620SMESG000005975.1 dd_Smed_v6_9774_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005620SMESG000017115.1 SMESG000005975.1 OX_Smed_1.0.08673ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox protein SIX1 vs. Ensembl Human
Match: SIX1 (SIX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:10887])

HSP 1 Score: 343.199 bits (879), Expect = 7.896e-115
Identity = 155/185 (83.78%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Human
Match: SIX2 (SIX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:10888])

HSP 1 Score: 340.502 bits (872), Expect = 9.567e-114
Identity = 153/184 (83.15%), Postives = 172/184 (93.48%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            +++ + GFTQEQVACVCEVLQQGG+I+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E K
Sbjct:    2 SMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of Homeobox protein SIX1 vs. Ensembl Human
Match: SIX4 (SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890])

HSP 1 Score: 275.018 bits (702), Expect = 1.523e-85
Identity = 121/174 (69.54%), Postives = 142/174 (81.61%), Query Frame = 3
Query:  390 CGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDR 911
              F+ + VACVCE LQQGG++DRLARFLWSLP  + L+ NES+LKA+A+VAFH+G + ELY ILESH+F   NH  LQ LW KA Y E+E+ RGRPLGAV KYR+R+KFPLPRTIWDG+ET YCFKEKSRN L+E Y QN YP+P EKR LA+ TGL+ TQVSNWFKNRRQRDR
Sbjct:   98 LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 271          
BLAST of Homeobox protein SIX1 vs. Ensembl Human
Match: SIX4 (SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890])

HSP 1 Score: 278.485 bits (711), Expect = 6.048e-84
Identity = 121/174 (69.54%), Postives = 142/174 (81.61%), Query Frame = 3
Query:  390 CGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDR 911
              F+ + VACVCE LQQGG++DRLARFLWSLP  + L+ NES+LKA+A+VAFH+G + ELY ILESH+F   NH  LQ LW KA Y E+E+ RGRPLGAV KYR+R+KFPLPRTIWDG+ET YCFKEKSRN L+E Y QN YP+P EKR LA+ TGL+ TQVSNWFKNRRQRDR
Sbjct:  106 LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 279          
BLAST of Homeobox protein SIX1 vs. Ensembl Human
Match: SIX6 (SIX homeobox 6 [Source:HGNC Symbol;Acc:HGNC:10892])

HSP 1 Score: 255.758 bits (652), Expect = 2.116e-81
Identity = 113/170 (66.47%), Postives = 142/170 (83.53%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLP----NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKN 893
            F+ +QVA VCE L++ G ++RL RFLWSLP     CE L KNESVL+A+A+VAFH GN++ELY ILE+H F+ ++H KLQ LWL+AHY E+EK+RGRPLG V KYRVRKKFPLPRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA+ATGLT TQV NWFKN
Sbjct:    9 FSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKN 178          
BLAST of Homeobox protein SIX1 vs. Ensembl Celegans
Match: ceh-33 (Homeobox protein ceh-33 [Source:UniProtKB/Swiss-Prot;Acc:Q94166])

HSP 1 Score: 246.514 bits (628), Expect = 4.449e-78
Identity = 109/173 (63.01%), Postives = 143/173 (82.66%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRA 914
            +++EQVAC+CE L       +L++F+W++   + ++ N+ +LKA+A +AFH  NFKELYRI+ESH+F+ ++H  LQ+ WL AHY E+EKIRGR LGAVGKYR+R+K+PLPRTIWDG+ETSYCF++KSR +LR+WY +N YP+PREKRELAE T LT TQVSNWFKNRRQRDRA
Sbjct:   20 YSEEQVACICEALSNDAR--KLSQFVWTVLERDEMRNNQYILKAQAFLAFHSNNFKELYRIIESHHFASEHHLPLQEWWLNAHYHEAEKIRGRQLGAVGKYRIRRKYPLPRTIWDGEETSYCFRDKSRVLLRDWYCRNSYPSPREKRELAEKTHLTVTQVSNWFKNRRQRDRA 190          
BLAST of Homeobox protein SIX1 vs. Ensembl Celegans
Match: ceh-34 (Homeobox protein ceh-34 [Source:UniProtKB/Swiss-Prot;Acc:Q94165])

HSP 1 Score: 200.29 bits (508), Expect = 2.820e-60
Identity = 99/195 (50.77%), Postives = 135/195 (69.23%), Query Frame = 3
Query:  345 ESSNNPASQGNIVQSCGFTQEQVACVCEVL----QQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRAS 917
            + S NP  Q ++  +  ++++++ C+CE L     Q G  ++LA F+++LP C   Q  ESVLKA+A+V F   N+K LY++LE   FS  NH  LQ+LWL AHY E+ K + R LGAV KYR+RKK P P TIWDG+ET+YCFK KSRNVLR+ Y +  YP+  +KR LA+ T L+  QVSNWFKN+RQR+RA+
Sbjct:    2 QQSYNP--QNSLTATTSYSEQEIVCICESLFNEGLQTGRTEQLANFIYNLPQC--YQVMESVLKAQALVYFTTQNWKMLYKLLECSKFSPHNHTVLQNLWLDAHYKEAAKTKDRELGAVCKYRIRKKNPFPNTIWDGEETNYCFKSKSRNVLRDAYKKCQYPSVEDKRRLAQQTELSIIQVSNWFKNKRQRERAA 192          
BLAST of Homeobox protein SIX1 vs. Ensembl Celegans
Match: ceh-32 (Homeobox protein ceh-32 [Source:UniProtKB/Swiss-Prot;Acc:Q23175])

HSP 1 Score: 202.216 bits (513), Expect = 6.587e-59
Identity = 90/169 (53.25%), Postives = 126/169 (74.56%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLP--NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNR 896
             T +Q+   CE L+  G +D L RF+ ++P    + +  NE+ L+A+A+V FH  +F+ELY ILE++ FS + H KLQ++W +AHY E EK RG+ L AV KYRVRKK+P+PRTIWDG++ ++CFKE++R++LREWY ++PYP P +K+ELA ATGLT  QV NWFKNR
Sbjct:   68 LTADQIVKTCEQLETDGDVDGLFRFMCTIPPQKTQEVAGNEAFLRARALVCFHASHFRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMPRTIWDGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNR 236          
BLAST of Homeobox protein SIX1 vs. Ensembl Celegans
Match: unc-39 (Homeobox protein unc-39 [Source:UniProtKB/Swiss-Prot;Acc:O17894])

HSP 1 Score: 151.369 bits (381), Expect = 4.851e-41
Identity = 72/179 (40.22%), Postives = 110/179 (61.45%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSL-----PNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQ-NPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRA 914
            ++ EQ+  +   L Q    DRL  F   L     PN     ++E+++ A     +H   F+ L+ +L + +F  ++++ LQD+W  A Y ES+  RG+ L  V KYR+R+KFP P+TIWDG+E  Y FK+ SR  L++++   + YPT  +KRE++ ATGL   Q+SNWFKNRRQRD++
Sbjct:   97 YSMEQMEAISTSLFQARDGDRLVAFFKQLESLYGPNAVDHLRSEAIIVAYTYALYHSNEFETLFHLLSNRHFQQRHYNDLQDIWHHARYKESQLKRGKELNPVEKYRLRRKFPAPKTIWDGEEIVYSFKDSSRKFLKQFFRNVSEYPTQEQKREISRATGLKIVQISNWFKNRRQRDKS 275          
BLAST of Homeobox protein SIX1 vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 56.9954 bits (136), Expect = 2.068e-8
Identity = 35/97 (36.08%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  681 GAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQN---PYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRA----SENKEGNEGSVN 950
            G +GK R R  FP                +++ N LR+W  QN   PYP+  +K++LA+ TGLT  QV+NWF N R+R         N+ G  G +N
Sbjct:  347 GRIGKSRGRGIFP----------------KQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMIDQNNRAGRSGQMN 427          
BLAST of Homeobox protein SIX1 vs. Ensembl Fly
Match: so (gene:FBgn0003460 transcript:FBtr0088970)

HSP 1 Score: 342.428 bits (877), Expect = 5.770e-113
Identity = 160/208 (76.92%), Postives = 180/208 (86.54%), Query Frame = 3
Query:  387 SCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSDIKDDNSM 1010
            S GFTQEQVACVCEVLQQ G+I+RL RFLWSLP C+ LQ NESVLKAKAVVAFHRG +KELYR+LE H+FS QNH KLQ LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR+VLR+WYS NPYP+PREKR+LAEATGLTTTQVSNWFKNRRQRDRA+E+K+G+        DK    S SD + + SM
Sbjct:  100 SFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGS-------TDKQHLDSSSDSEMEGSM 300          
BLAST of Homeobox protein SIX1 vs. Ensembl Fly
Match: Six4 (gene:FBgn0027364 transcript:FBtr0078274)

HSP 1 Score: 251.136 bits (640), Expect = 6.030e-78
Identity = 111/177 (62.71%), Postives = 141/177 (79.66%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            F+ +Q+ C+CE LQQ G I++L  FL SLP  E+ + NESVL+A+A+VA++ G F ELY +LE+H FS++ H  LQ+LW KAHY E+EK+RGRPLGAV KYR+RKK+PLP+TIWDG+ET YCFKEKSRN L++ Y  N YPTP EK+ LA+ TGLT TQVSNWFKNRRQRDR  + +
Sbjct:  181 FSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQR 357          
BLAST of Homeobox protein SIX1 vs. Ensembl Fly
Match: Six4 (gene:FBgn0027364 transcript:FBtr0078275)

HSP 1 Score: 251.136 bits (640), Expect = 6.030e-78
Identity = 111/177 (62.71%), Postives = 141/177 (79.66%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            F+ +Q+ C+CE LQQ G I++L  FL SLP  E+ + NESVL+A+A+VA++ G F ELY +LE+H FS++ H  LQ+LW KAHY E+EK+RGRPLGAV KYR+RKK+PLP+TIWDG+ET YCFKEKSRN L++ Y  N YPTP EK+ LA+ TGLT TQVSNWFKNRRQRDR  + +
Sbjct:  181 FSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQR 357          
BLAST of Homeobox protein SIX1 vs. Ensembl Fly
Match: Optix (gene:FBgn0025360 transcript:FBtr0088865)

HSP 1 Score: 234.958 bits (598), Expect = 1.294e-70
Identity = 115/195 (58.97%), Postives = 149/195 (76.41%), Query Frame = 3
Query:  381 VQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLP----NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNS 953
            V +  F+  QV  VC+ L+  G I+RLARFLWSLP    N   +   E+VL+A+AVVA+H GNF+ELY I+E+H F+  ++ KLQ +WL+AHY+E+EK+RGR LG V KYRVRKKFPLP TIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA+ATGL  TQV NWFKNRRQRDRA+  K   + S NS
Sbjct:   32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNS 226          
BLAST of Homeobox protein SIX1 vs. Ensembl Fly
Match: Optix (gene:FBgn0025360 transcript:FBtr0329885)

HSP 1 Score: 234.572 bits (597), Expect = 1.884e-70
Identity = 115/195 (58.97%), Postives = 149/195 (76.41%), Query Frame = 3
Query:  381 VQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLP----NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNS 953
            V +  F+  QV  VC+ L+  G I+RLARFLWSLP    N   +   E+VL+A+AVVA+H GNF+ELY I+E+H F+  ++ KLQ +WL+AHY+E+EK+RGR LG V KYRVRKKFPLP TIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA+ATGL  TQV NWFKNRRQRDRA+  K   + S NS
Sbjct:   32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNS 226          
BLAST of Homeobox protein SIX1 vs. Ensembl Zebrafish
Match: six1a (SIX homeobox 1a [Source:NCBI gene;Acc:494168])

HSP 1 Score: 346.665 bits (888), Expect = 1.703e-116
Identity = 160/205 (78.05%), Postives = 180/205 (87.80%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSD 989
            +I+ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILES+ FS  NH K+Q LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE   G  N +  K    SP D
Sbjct:    2 SILPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESYQFSTHNHPKMQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENGENNGVGGKQSQRSPLD 206          
BLAST of Homeobox protein SIX1 vs. Ensembl Zebrafish
Match: six2a (SIX homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-010412-1])

HSP 1 Score: 344.354 bits (882), Expect = 2.149e-115
Identity = 154/185 (83.24%), Postives = 173/185 (93.51%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ + GFTQEQVACVCEVLQQGG+I+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Zebrafish
Match: six2a (SIX homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-010412-1])

HSP 1 Score: 344.354 bits (882), Expect = 2.149e-115
Identity = 154/185 (83.24%), Postives = 173/185 (93.51%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ + GFTQEQVACVCEVLQQGG+I+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Zebrafish
Match: six1b (SIX homeobox 1b [Source:NCBI gene;Acc:404627])

HSP 1 Score: 343.584 bits (880), Expect = 3.363e-115
Identity = 154/185 (83.24%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Zebrafish
Match: six2b (SIX homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080723-23])

HSP 1 Score: 342.813 bits (878), Expect = 7.275e-115
Identity = 156/185 (84.32%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  393 GFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE-GNEGS 944
            GFTQEQVACVCEVLQQGGSI+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY++LESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR VL+EWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE  NEG+
Sbjct:    8 GFTQEQVACVCEVLQQGGSIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKVLESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRCVLKEWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENEGA 192          
BLAST of Homeobox protein SIX1 vs. Ensembl Xenopus
Match: six1 (SIX homeobox 1 [Source:NCBI gene;Acc:100101702])

HSP 1 Score: 342.428 bits (877), Expect = 1.512e-114
Identity = 155/185 (83.78%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Xenopus
Match: six2 (SIX homeobox 2 [Source:NCBI gene;Acc:100101784])

HSP 1 Score: 340.887 bits (873), Expect = 6.289e-114
Identity = 152/184 (82.61%), Postives = 171/184 (92.93%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            +++ + GFTQEQVACVCEVLQQGG+I+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY+ILE H FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E K
Sbjct:    2 SMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILEGHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of Homeobox protein SIX1 vs. Ensembl Xenopus
Match: tmem136 (transmembrane protein 136 [Source:Xenbase;Acc:XB-GENE-966251])

HSP 1 Score: 258.07 bits (658), Expect = 1.211e-81
Identity = 117/190 (61.58%), Postives = 150/190 (78.95%), Query Frame = 3
Query:  348 SSNNPASQGNI----VQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLP----NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKN 893
            SS  P +Q  +    + S  F+ EQVA VCE L++ G I+RL RFLWSLP     CE + K+ES+L+A+AVVAFH GNF++LY ILE+H F+ ++H KLQ +WL+AHY E+EK+RGRPLG V KYRVRKKFPLPRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA+ATGLT TQV NWFKN
Sbjct:   29 SSGGPRAQEELSMFQLPSLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKN 218          
BLAST of Homeobox protein SIX1 vs. Ensembl Xenopus
Match: SIX4 (SIX homeobox 4 [Source:NCBI gene;Acc:100498150])

HSP 1 Score: 272.707 bits (696), Expect = 1.217e-81
Identity = 118/175 (67.43%), Postives = 141/175 (80.57%), Query Frame = 3
Query:  387 SCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDR 911
            +  F+ E VACVCE LQQGG +DRL+RFL SLP+ E L+ NES+LKA+A+V FH+G + EL+ +LESHNF   NH  LQ+LW KA Y+E+EK RGRPLGAV KYR+R+KFPLPRTIWDG+ET YCFKEKSRN L+E Y  N YP+P  KR LA+ TGL+ TQVSNWFKNRRQRDR
Sbjct:  147 TLAFSPEHVACVCEALQQGGDLDRLSRFLCSLPHSELLRGNESILKARALVTFHQGRYSELFLLLESHNFHPSNHAALQELWYKARYIEAEKARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKHNRYPSPAAKRNLAKVTGLSLTQVSNWFKNRRQRDR 321          
BLAST of Homeobox protein SIX1 vs. Ensembl Xenopus
Match: six6 (SIX homeobox 6 [Source:NCBI gene;Acc:100101705])

HSP 1 Score: 254.988 bits (650), Expect = 3.276e-81
Identity = 115/170 (67.65%), Postives = 141/170 (82.94%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLP----NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKN 893
            F+ +QVA VCE L++ G I+RL RFLWSLP     CE L KNESVL+A+A+VAFH GNF+ELY ILE+H F+  +H KLQ LWL+AHY E+EK+RGRPLG V KYRVRKKFPLPRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA+ATGLT TQV NWFKN
Sbjct:    9 FSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNFRELYHILENHKFTKDSHTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKN 178          
BLAST of Homeobox protein SIX1 vs. Ensembl Mouse
Match: Six1 (sine oculis-related homeobox 1 [Source:MGI Symbol;Acc:MGI:102780])

HSP 1 Score: 343.584 bits (880), Expect = 3.832e-115
Identity = 155/185 (83.78%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Mouse
Match: Six2 (sine oculis-related homeobox 2 [Source:MGI Symbol;Acc:MGI:102778])

HSP 1 Score: 341.273 bits (874), Expect = 4.734e-114
Identity = 153/184 (83.15%), Postives = 172/184 (93.48%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            +++ + GFTQEQVACVCEVLQQGG+I+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E K
Sbjct:    2 SMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of Homeobox protein SIX1 vs. Ensembl Mouse
Match: Six2 (sine oculis-related homeobox 2 [Source:MGI Symbol;Acc:MGI:102778])

HSP 1 Score: 341.273 bits (874), Expect = 4.734e-114
Identity = 153/184 (83.15%), Postives = 172/184 (93.48%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            +++ + GFTQEQVACVCEVLQQGG+I+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E K
Sbjct:    2 SMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of Homeobox protein SIX1 vs. Ensembl Mouse
Match: Six4 (sine oculis-related homeobox 4 [Source:MGI Symbol;Acc:MGI:106034])

HSP 1 Score: 273.478 bits (698), Expect = 7.757e-85
Identity = 121/172 (70.35%), Postives = 142/172 (82.56%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDR 911
            F+ + VACVCE LQQGG++DRLARFLWSLP  + L+ NES+LKA+A+VAFH+G + ELY ILESH+F   NH  LQ LW KA Y E+E+ RGRPLGAV KYR+R+KFPLPRTIWDG+ET YCFKEKSRN L+E Y QN YP+P EKR LA+ TGL+ TQVSNWFKNRRQRDR
Sbjct:   93 FSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 264          
BLAST of Homeobox protein SIX1 vs. Ensembl Mouse
Match: Six4 (sine oculis-related homeobox 4 [Source:MGI Symbol;Acc:MGI:106034])

HSP 1 Score: 277.33 bits (708), Expect = 8.703e-84
Identity = 121/174 (69.54%), Postives = 142/174 (81.61%), Query Frame = 3
Query:  390 CGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDR 911
              F+ + VACVCE LQQGG++DRLARFLWSLP  + L+ NES+LKA+A+VAFH+G + ELY ILESH+F   NH  LQ LW KA Y E+E+ RGRPLGAV KYR+R+KFPLPRTIWDG+ET YCFKEKSRN L+E Y QN YP+P EKR LA+ TGL+ TQVSNWFKNRRQRDR
Sbjct:   99 LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 272          
BLAST of Homeobox protein SIX1 vs. UniProt/SwissProt
Match: sp|Q6DHF9|SIX1A_DANRE (Homeobox protein six1a OS=Danio rerio OX=7955 GN=six1a PE=2 SV=2)

HSP 1 Score: 346.665 bits (888), Expect = 1.285e-115
Identity = 160/205 (78.05%), Postives = 180/205 (87.80%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSD 989
            +I+ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILES+ FS  NH K+Q LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE   G  N +  K    SP D
Sbjct:    2 SILPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESYQFSTHNHPKMQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENGENNGVGGKQSQRSPLD 206          
BLAST of Homeobox protein SIX1 vs. UniProt/SwissProt
Match: sp|Q6NZ04|SIX1B_DANRE (Homeobox protein six1b OS=Danio rerio OX=7955 GN=six1b PE=1 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 2.539e-114
Identity = 154/185 (83.24%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. UniProt/SwissProt
Match: sp|Q62231|SIX1_MOUSE (Homeobox protein SIX1 OS=Mus musculus OX=10090 GN=Six1 PE=1 SV=2)

HSP 1 Score: 343.584 bits (880), Expect = 2.680e-114
Identity = 155/185 (83.78%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. UniProt/SwissProt
Match: sp|Q15475|SIX1_HUMAN (Homeobox protein SIX1 OS=Homo sapiens OX=9606 GN=SIX1 PE=1 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 3.792e-114
Identity = 155/185 (83.78%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. UniProt/SwissProt
Match: sp|A1YER0|SIX1_GORGO (Homeobox protein SIX1 OS=Gorilla gorilla gorilla OX=9595 GN=SIX1 PE=3 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 3.792e-114
Identity = 155/185 (83.78%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. TrEMBL
Match: A0A444THQ1 (Homeobox protein six1b OS=Armadillidium vulgare OX=13347 GN=Avbf_00399 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 1.119e-116
Identity = 163/208 (78.37%), Postives = 186/208 (89.42%), Query Frame = 3
Query:  309 VANNISVECFGTESSNNPASQGNIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEG 932
            +A +++      ++S++P +   ++ S GFTQEQVACVCEVLQQ G+I+RL RFLWSLP CE+L KNESVLKAKA+VAFHR NFKELYRILESHNFSVQNH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSRNVLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KEG
Sbjct:    8 IATHLAPPVLFPQASSSPPAP--MLPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEHLHKNESVLKAKALVAFHRANFKELYRILESHNFSVQNHSKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRNVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEQKEG 213          
BLAST of Homeobox protein SIX1 vs. TrEMBL
Match: A0A5N5TFD2 (Homeobox protein six1b OS=Armadillidium nasatum OX=96803 GN=six1b PE=4 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 1.527e-116
Identity = 164/217 (75.58%), Postives = 189/217 (87.10%), Query Frame = 3
Query:  309 VANNISVECFGTESSNNPASQGNIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIV 959
            +A +++      ++S++P +   ++ S GFTQEQVACVCEVLQQ G+I+RL RFLWSLP CE+L KNESVLKAKA+VAFHR NFKELYRILESHNFSVQNH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSRNVLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KEG    V+  +
Sbjct:    8 IATHLAPPVLFPQASSSPPAP--MLPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEHLHKNESVLKAKALVAFHRANFKELYRILESHNFSVQNHSKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRNVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEQKEGVVVEVSDFI 222          
BLAST of Homeobox protein SIX1 vs. TrEMBL
Match: A0A2P6L5N3 (Six1b OS=Nephila clavipes OX=2585209 GN=NCL1_16312 PE=4 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 8.188e-116
Identity = 166/224 (74.11%), Postives = 192/224 (85.71%), Query Frame = 3
Query:  348 SSNNPASQGNIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSDIKDDNSMTKS 1019
            +S NPAS   ++ S GFTQEQVACVCEVLQQ G+I+RL RFLWSLP CE+LQKNESVLKAK++VAFHRGNFKELYRILESHNFS  +H KLQ LWLKAHY+E+E++RGRPLGAVGKYR+R+KFPLPRTIWDG+ETSYCFKEKSRN+LREWY+ NPYP+PREKRELAE TGLTTTQVSNWFKNRRQRDRA+E KE N   V S +   +  + S++   NSM+ S
Sbjct:   85 TSVNPASPSTMLPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEHLQKNESVLKAKSLVAFHRGNFKELYRILESHNFSPASHSKLQALWLKAHYIEAERLRGRPLGAVGKYRIRRKFPLPRTIWDGEETSYCFKEKSRNILREWYAHNPYPSPREKRELAEGTGLTTTQVSNWFKNRRQRDRAAEAKERN---VISRIFPTLAQAVSELVTQNSMSNS 305          
BLAST of Homeobox protein SIX1 vs. TrEMBL
Match: A0A5B7FQZ3 (Homeobox protein SIX1 OS=Portunus trituberculatus OX=210409 GN=Six1_0 PE=4 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 2.578e-115
Identity = 158/186 (84.95%), Postives = 175/186 (94.09%), Query Frame = 3
Query:  378 IVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGN 935
            ++ S GFTQEQVACVCEVLQQ G+I+RL RFLWSLP CE+L KNESVLKAKA+VAFHRGNFK+LYRILESHNFS+QNH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSRNVLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E K+G 
Sbjct:   35 MLPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEHLHKNESVLKAKALVAFHRGNFKDLYRILESHNFSIQNHSKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRNVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKDGR 220          
BLAST of Homeobox protein SIX1 vs. TrEMBL
Match: A0A0P4VXC6 (Homeobox domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 2.799e-115
Identity = 158/185 (85.41%), Postives = 175/185 (94.59%), Query Frame = 3
Query:  378 IVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEG 932
            ++ S GFTQEQVACVCEVLQQ G+I+RL RFLWSLP CE+L KNESVLKAKA+VAFHRGNFK+LYRILESHNFS+QNH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSRNVLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E K+G
Sbjct:   35 MLPSFGFTQEQVACVCEVLQQSGNIERLGRFLWSLPACEHLHKNESVLKAKALVAFHRGNFKDLYRILESHNFSIQNHSKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRNVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKDG 219          
BLAST of Homeobox protein SIX1 vs. Ensembl Cavefish
Match: six1b (homeobox protein six1b [Source:NCBI gene;Acc:103034839])

HSP 1 Score: 343.584 bits (880), Expect = 2.729e-115
Identity = 154/185 (83.24%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Cavefish
Match: six2a (SIX homeobox 2 [Source:NCBI gene;Acc:103025828])

HSP 1 Score: 343.199 bits (879), Expect = 4.938e-115
Identity = 154/185 (83.24%), Postives = 173/185 (93.51%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +++ + GFTQEQVACVCEVLQQGG+I+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Cavefish
Match: ENSAMXT00000021946.2 (homeobox protein six1b [Source:NCBI gene;Acc:103045548])

HSP 1 Score: 335.88 bits (860), Expect = 1.980e-112
Identity = 149/185 (80.54%), Postives = 170/185 (91.89%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +I  S GFTQEQVACVCEVLQQGG+++RL RFLWSLP CE+L KNESVLKAKA+VAFHRGNF+ELY+ILE H FS  NH KLQ LWL+AHY E+E++RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR+VLR+WY+ NPYP+PREKRELA+ATGL+TTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SISSSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACEHLHKNESVLKAKAMVAFHRGNFRELYKILEGHQFSTHNHGKLQQLWLRAHYAEAERLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAQATGLSTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Cavefish
Match: six2b (SIX homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080723-23])

HSP 1 Score: 333.569 bits (854), Expect = 3.990e-111
Identity = 153/194 (78.87%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  387 SCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKF 968
            S GFTQEQVACVCEVLQQGGSI+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY++LESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VL+EWYS NPYP+PREKRELAEATGLTTTQVSNWFKNRRQ  R  EN+   +   N ++ + 
Sbjct:    6 SFGFTQEQVACVCEVLQQGGSIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKVLESHQFSPHNHPKLQQLWLKAHYMEAEKVRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRCVLKEWYSHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQ--RGPENEGAGQNGHNPLMSQM 197          
BLAST of Homeobox protein SIX1 vs. Ensembl Cavefish
Match: six9 (homeobox protein SIX2-like [Source:NCBI gene;Acc:111191018])

HSP 1 Score: 271.552 bits (693), Expect = 1.276e-87
Identity = 127/190 (66.84%), Postives = 149/190 (78.42%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEY----------LQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGN 935
            F+++QV CVCEVL Q G +DRLA FL SLP+             LQ  ESVLKA+A VAFH+G F ELY ++E H FS  +H  LQ LWL+AHY+E+E  RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY + PYP+PREKR+LA ATGLT TQVSNWFKNRRQRDRA++ ++G 
Sbjct:    5 FSEDQVGCVCEVLLQSGCMDRLASFLRSLPSSSSSSSSSSSYPGLQGMESVLKARAAVAFHQGRFTELYALIEGHAFSPLSHALLQQLWLRAHYLEAELQRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRCVLREWYCRKPYPSPREKRDLAAATGLTATQVSNWFKNRRQRDRAAQGRKGQ 194          
BLAST of Homeobox protein SIX1 vs. Ensembl Sea Lamprey
Match: six1a (SIX homeobox 1a [Source:NCBI gene;Acc:494168])

HSP 1 Score: 265.388 bits (677), Expect = 2.035e-87
Identity = 117/150 (78.00%), Postives = 137/150 (91.33%), Query Frame = 3
Query:  450 IDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRR 899
            ++RL RFLWSLP CE +Q++ES+L AKAVVAFH+GNF+ELY +LES  FS +NH KLQ LWLKAHY E+E++RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKE+SR VLR+WY+ NPYP+PREKRELA+ATGLTTTQVSNWFKNRR
Sbjct:    1 MERLGRFLWSLPACEQIQRSESILMAKAVVAFHQGNFRELYAVLESQPFSARNHPKLQQLWLKAHYTEAERLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKERSRGVLRDWYAHNPYPSPREKRELAQATGLTTTQVSNWFKNRR 150          
BLAST of Homeobox protein SIX1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002854.1 (pep scaffold:Pmarinus_7.0:GL480305:17375:18769:1 gene:ENSPMAG00000002608.1 transcript:ENSPMAT00000002854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.662 bits (618), Expect = 1.253e-77
Identity = 108/173 (62.43%), Postives = 139/173 (80.35%), Query Frame = 3
Query:  387 SCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNC----EYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKN 893
            +  F+ +QVA VCE L++ G I+RL RFLWSLP      E L + E+VL+A+AVVAFH  N+++LY ILE H FS  +H KLQ +WL+AHY+E+E++RGRPLG V KYRVRKKFPLPRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA+ATGLT TQV NWFKN
Sbjct:   38 TLSFSPQQVASVCETLEESGDIERLGRFLWSLPVAPGAWEALNRQEAVLRARAVVAFHASNYRDLYAILEGHKFSKASHAKLQAMWLEAHYLEAERLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELAQATGLTPTQVGNWFKN 210          
BLAST of Homeobox protein SIX1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011157.1 (pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 gene:ENSPMAG00000010130.1 transcript:ENSPMAT00000011157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 1.228e-29
Identity = 46/63 (73.02%), Postives = 57/63 (90.48%), Query Frame = 3
Query:  711 KFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRR 899
            KFPLP+TIWDG++ ++CFKE++RN+LREWY Q+PYP P +KRELA+ATGLT TQV NWFKNRR
Sbjct:    1 KFPLPKTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR 63          
BLAST of Homeobox protein SIX1 vs. Ensembl Sea Lamprey
Match: Six4 (pep scaffold:Pmarinus_7.0:GL478660:19078:19268:1 gene:ENSPMAG00000010180.1 transcript:ENSPMAT00000011207.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Six4)

HSP 1 Score: 102.064 bits (253), Expect = 7.229e-27
Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 3
Query:  711 KFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRR 899
            KFPLPRTIWDG+ET YCFKEKSRN L++ Y +  YP P EKR LA+ TGL+  QVSNWFKNRR
Sbjct:    1 KFPLPRTIWDGEETVYCFKEKSRNFLKDCYRRTRYPAPDEKRRLAKLTGLSVVQVSNWFKNRR 63          
BLAST of Homeobox protein SIX1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001924.1 (pep scaffold:Pmarinus_7.0:GL488033:11:347:-1 gene:ENSPMAG00000001748.1 transcript:ENSPMAT00000001924.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 5.672e-24
Identity = 42/76 (55.26%), Postives = 55/76 (72.37%), Query Frame = 3
Query:  408 QVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWL 635
            QVACVCE LQQGG + RLARFLW+LP      ++E+VL+A+A VAFH G+++ELY +LE H F  ++H  L  L L
Sbjct:    1 QVACVCEALQQGGDVARLARFLWALPGPAAASRDEAVLRARAHVAFHSGSYRELYDVLEGHAFEARHHAALLALSL 76          
BLAST of Homeobox protein SIX1 vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 52.7582 bits (125), Expect = 4.583e-8
Identity = 26/54 (48.15%), Postives = 33/54 (61.11%), Query Frame = 3
Query:  783 VLREWYSQ---NPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGN 935
            +L +W  +   NPYPT +EKREL   TGLT  Q+SNWF N R+R   S   + N
Sbjct:  208 ILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRKIFSGQNDAN 261          
BLAST of Homeobox protein SIX1 vs. Ensembl Yeast
Match: CUP9 (Homeodomain-containing transcriptional repressor; regulates expression of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription; CUP9 has a paralog, TOS8, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006098])

HSP 1 Score: 49.6766 bits (117), Expect = 4.407e-7
Identity = 24/44 (54.55%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  783 VLREW---YSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQR 905
            +L  W   +  NPYPT +EKREL   TGLT  Q+SNWF N R+R
Sbjct:  176 ILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 219          
BLAST of Homeobox protein SIX1 vs. Ensembl Nematostella
Match: EDO34334 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN4])

HSP 1 Score: 320.087 bits (819), Expect = 4.888e-108
Identity = 147/183 (80.33%), Postives = 165/183 (90.16%), Query Frame = 3
Query:  378 IVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            ++ S  FT EQVACVCEVLQQ G I+RL RFLWSLP CE +QKNESVLKAKA+V+FH+ NF+ELYRILE++NFS   H KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSRN+LREWYS NPYP+PREKRELAE TGLTTTQVSNWFKNRRQRDRA+E K
Sbjct:    1 MLPSFSFTPEQVACVCEVLQQSGDIERLGRFLWSLPECETIQKNESVLKAKAIVSFHQQNFQELYRILENNNFSPNAHPKLQSLWLKAHYMEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRNILREWYSHNPYPSPREKRELAEGTGLTTTQVSNWFKNRRQRDRAAEAK 183          
BLAST of Homeobox protein SIX1 vs. Ensembl Nematostella
Match: EDO42933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S005])

HSP 1 Score: 255.373 bits (651), Expect = 7.463e-83
Identity = 119/176 (67.61%), Postives = 142/176 (80.68%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLP-NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASE 920
            F+ EQ+  VCE LQ  G+I+RLARFLWSLP + E +   E++L AKAVVAFH+ NFKELY ILES  F    H KLQ LW  AHY+E+E++RGRPLGAVGKYRVR+KFPLPRTIWDG+ET+YCFKEKSR++L + Y  +PYPTPREK ELA+ T LT TQVSNWFKN+RQR RA+E
Sbjct:    3 FSMEQIISVCECLQNSGNIERLARFLWSLPKDSEEIHACETILVAKAVVAFHQNNFKELYSILESRKFQRSEHEKLQCLWRTAHYIEAERVRGRPLGAVGKYRVRRKFPLPRTIWDGEETTYCFKEKSRSILNKAYVDSPYPTPREKHELAKMTDLTVTQVSNWFKNKRQRVRAAE 178          
BLAST of Homeobox protein SIX1 vs. Ensembl Nematostella
Match: EDO33059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST96])

HSP 1 Score: 248.44 bits (633), Expect = 4.769e-80
Identity = 109/173 (63.01%), Postives = 142/173 (82.08%), Query Frame = 3
Query:  387 SCGFTQEQVACVCEVLQQGGSIDRLARFLWSLP----NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKN 893
            +  F+  Q+A VCE L++ G ++RLARFLWSLP      E L K+ESVL+A+A+VAFH GNF++LY ILE+H F+ ++H KLQ +WL+AHY E+E++RGRPLG V KYRVRKKFPLPRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA+ATGLT TQV NWFKN
Sbjct:    7 ALSFSAHQIAQVCETLEESGDVERLARFLWSLPVAPGTLEALGKHESVLRARAIVAFHMGNFRDLYHILETHRFTRESHAKLQAMWLEAHYQEAERLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKN 179          
BLAST of Homeobox protein SIX1 vs. Ensembl Nematostella
Match: EDO31034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ27])

HSP 1 Score: 245.358 bits (625), Expect = 5.047e-79
Identity = 112/174 (64.37%), Postives = 139/174 (79.89%), Query Frame = 3
Query:  405 EQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            +QVACVC+ L+Q G I+RL+RFLWSLP  + L  +ESVLKA+A+V+FHRG ++E+Y ILE++ F   +H  LQ LW KAHY E+EK+RGR LGAV KYR+R+KFPLPRTIWDG+ET YCFKEK+R  L++ Y QN YPTP+EKR +A+ T LT  QVSNWFKNRRQRDR   NK
Sbjct:    1 DQVACVCDALRQAGDIERLSRFLWSLPPDDLLNGSESVLKARAIVSFHRGRYREVYNILETNEFDPSSHELLQCLWYKAHYSEAEKLRGRSLGAVDKYRIRRKFPLPRTIWDGEETVYCFKEKARAALKDCYEQNKYPTPQEKRLIAKQTNLTLKQVSNWFKNRRQRDRIPSNK 174          
BLAST of Homeobox protein SIX1 vs. Ensembl Nematostella
Match: EDO33407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS98])

HSP 1 Score: 193.741 bits (491), Expect = 2.578e-59
Identity = 93/165 (56.36%), Postives = 119/165 (72.12%), Query Frame = 3
Query:  405 EQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRR 899
            +QVAC+C+ L Q G I RL++FL S+P  +   K+ES+LKA+A+VAFHRG ++E+Y ILE++ F   +H  LQ LW KAHY E EK+RGR L AV K+R+RKK PLP TI DG++T Y FKEK R VL+E Y    YPT +EKR +A  T LT  QV NWF+NRR
Sbjct:    1 DQVACICDALFQEGDIKRLSQFLLSIPQEDLQNKSESLLKARAMVAFHRGCYQEVYNILENNKFDTSSHEFLQCLWYKAHYSEGEKLRGRSLSAVDKFRIRKKSPLPNTISDGEKTIYFFKEKVRTVLKECYEHKKYPTLKEKRVIATQTNLTLRQVRNWFRNRR 165          
BLAST of Homeobox protein SIX1 vs. Ensembl Medaka
Match: six1b (SIX homeobox 1 [Source:NCBI gene;Acc:101175523])

HSP 1 Score: 344.739 bits (883), Expect = 1.056e-115
Identity = 156/185 (84.32%), Postives = 172/185 (92.97%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 929
            +I+ S GFTQEQVACVCEVLQQGG+++RL RFLWSLP C++L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHYVE+EK+RGRPLGAVGKYRVR+KFPLPRTIWDG+ETSYCFKEKSR VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E KE
Sbjct:    2 SILPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKE 186          
BLAST of Homeobox protein SIX1 vs. Ensembl Medaka
Match: six2a (SIX homeobox 2 [Source:NCBI gene;Acc:101161260])

HSP 1 Score: 342.428 bits (877), Expect = 1.063e-114
Identity = 153/184 (83.15%), Postives = 172/184 (93.48%), Query Frame = 3
Query:  375 NIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            +++ + GFTQEQVACVCEVLQQGG+I+RL RFLWSLP CE+L KNESVLKAKAVVAFHRGNF+ELY+ILESH FS  NH KLQ LWLKAHY+E+EK+RGRPLGAVGKYRVR+KFPLPR+IWDG+ETSYCFKEKSR+VLREWY+ NPYP+PREKRELAEATGLTTTQVSNWFKNRRQRDRA+E K
Sbjct:    2 SMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of Homeobox protein SIX1 vs. Ensembl Medaka
Match: six4a (SIX homeobox 4 [Source:NCBI gene;Acc:101159478])

HSP 1 Score: 281.182 bits (718), Expect = 2.931e-86
Identity = 122/175 (69.71%), Postives = 147/175 (84.00%), Query Frame = 3
Query:  387 SCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDR 911
            S  F+ EQVACVCE LQQGG++DRLARFLWSLP  + L+ NES+LKA+A+VAFH+  ++ELY ILE+H+FS  NH  LQDLW KA Y E+EK RGRPLGAV KYR+R+K+PLPRTIWDG+ET YCFKE+SRN L++ Y+QN YP+P EKR LA+ TGL+ TQVSNWFKNRRQRDR
Sbjct:   62 SLAFSPEQVACVCEALQQGGNVDRLARFLWSLPQSDLLRGNESILKAQALVAFHQARYQELYSILENHSFSPSNHTFLQDLWYKARYTEAEKARGRPLGAVDKYRIRRKYPLPRTIWDGEETVYCFKERSRNALKDLYNQNRYPSPAEKRNLAKITGLSLTQVSNWFKNRRQRDR 236          
BLAST of Homeobox protein SIX1 vs. Ensembl Medaka
Match: six7 (homeobox protein SIX6-like [Source:NCBI gene;Acc:101175353])

HSP 1 Score: 260.381 bits (664), Expect = 2.788e-83
Identity = 117/183 (63.93%), Postives = 148/183 (80.87%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNC------EYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            FT +QVA VCE L++ G I+RL RFLWSLP        E L ++ESV++A+A+VAFH GNF+ LY+IL+SH F+ ++H KLQDLWL AHY E+E++RGRPLG V KYR+RKKFPLPRTIWDG++ ++CFKE++R++LREWY Q+PYP P  KR LA+ATGLT TQV NWFKNRRQRDRA+  K
Sbjct:    7 FTPDQVARVCENLEETGDIERLGRFLWSLPAAVPGSAGEALNRHESVMRARALVAFHVGNFEALYQILQSHRFTRESHAKLQDLWLDAHYREAERLRGRPLGPVEKYRIRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSRKRHLAQATGLTPTQVGNWFKNRRQRDRAASAK 189          
BLAST of Homeobox protein SIX1 vs. Ensembl Medaka
Match: six6a (SIX homeobox 6 [Source:NCBI gene;Acc:101154821])

HSP 1 Score: 255.758 bits (652), Expect = 1.051e-81
Identity = 128/199 (64.32%), Postives = 158/199 (79.40%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLP----NCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNE------GSVNSIVD 962
            F+ +QVA VCE L++ G ++RL RFLWSLP     CE L KNESVL+A+AVVAFH GNF+ELY ILE+H F+ ++H KLQ LWL+AHY E+EK+RGRPLG V KYRVRKKFPLPRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA+ATGLT TQV NWFKNRRQRDRA+  K   +      GSV S+ D
Sbjct:    9 FSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEVLNKNESVLRARAVVAFHTGNFRELYHILENHKFTKESHTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSGGSVRSLAD 207          
BLAST of Homeobox protein SIX1 vs. Planmine SMEST
Match: SMESG000005975.1 (SMESG000005975.1)

HSP 1 Score: 1000.35 bits (2585), Expect = 0.000e+0
Identity = 489/489 (100.00%), Postives = 489/489 (100.00%), Query Frame = 3
Query:   90 MLNHSNYTNSLSPCSFSQQTYNGLNYSSPDIRYSNNTQSYPCQGSNPVYNNVSSINQPVTQSGHITPQSSPLDVANNISVECFGTESSNNPASQGNIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSDIKDDNSMTKSCVKNNSNGEICSKSIEQMEADIKKEHTTIPGFYQESKRLGMXXXXXXXXXXYSTVFDYSQLEQDKFASFMINNKQREYQDSFQMLQSYYNPGLHAAPANASPLYRATAAAMMTPNVYFDPHNQFYPNTVSHHPYANSSLSGQSHGTLNHNPNLSSSPTLNLMAHNFSTGHSYLSNYTPC 1556
            MLNHSNYTNSLSPCSFSQQTYNGLNYSSPDIRYSNNTQSYPCQGSNPVYNNVSSINQPVTQSGHITPQSSPLDVANNISVECFGTESSNNPASQGNIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSDIKDDNSMTKSCVKNNSNGEICSKSIEQMEADIKKEHTTIPGFYQESKRLGMQFSSPSQFSPYSTVFDYSQLEQDKFASFMINNKQREYQDSFQMLQSYYNPGLHAAPANASPLYRATAAAMMTPNVYFDPHNQFYPNTVSHHPYANSSLSGQSHGTLNHNPNLSSSPTLNLMAHNFSTGHSYLSNYTPC
Sbjct:    1 MLNHSNYTNSLSPCSFSQQTYNGLNYSSPDIRYSNNTQSYPCQGSNPVYNNVSSINQPVTQSGHITPQSSPLDVANNISVECFGTESSNNPASQGNIVQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSDIKDDNSMTKSCVKNNSNGEICSKSIEQMEADIKKEHTTIPGFYQESKRLGMQFSSPSQFSPYSTVFDYSQLEQDKFASFMINNKQREYQDSFQMLQSYYNPGLHAAPANASPLYRATAAAMMTPNVYFDPHNQFYPNTVSHHPYANSSLSGQSHGTLNHNPNLSSSPTLNLMAHNFSTGHSYLSNYTPC 489          
BLAST of Homeobox protein SIX1 vs. Planmine SMEST
Match: SMESG000001687.1 (SMESG000001687.1)

HSP 1 Score: 319.701 bits (818), Expect = 2.453e-103
Identity = 147/206 (71.36%), Postives = 170/206 (82.52%), Query Frame = 3
Query:  387 SCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSDIKDDN 1004
            + GFTQEQVACVCEVL+ GG+IDRLA F+WSLP C+ LQ NESVL AKA VAFHR NFKELYRILES+ FS  NH+KLQ LWL+AHY+E EKI+GR LGAV KYR+R+K+PLPRTIWDG+ETSYCFKEKSR VLR+WY  NPYP+PREK++LAE T LTTTQVSNWFKNRRQRDRA+ENK+ ++    S  D     S  DIK+ N
Sbjct:   83 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASEADS---ESLKDIKETN 285          
BLAST of Homeobox protein SIX1 vs. Planmine SMEST
Match: SMESG000017729.1 (SMESG000017729.1)

HSP 1 Score: 263.848 bits (673), Expect = 9.409e-82
Identity = 122/214 (57.01%), Postives = 160/214 (74.77%), Query Frame = 3
Query:  306 DVANNISVECFGTESSNNPASQGNI---VQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKN----ESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            ++++N+        S+ NP+S  N    V    F  +Q+A VCE L++ G I+RL RFLWS+P    L K+    E++L+A+A+VAFH GNF+ELY ILE H+F   +H KLQ LWL+AHY E+EK+RGRPLG V KYRVRKKFP+PRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA ATGLT TQV NWFKNRRQRDRA+ +K
Sbjct:   14 NISHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK 227          
BLAST of Homeobox protein SIX1 vs. Planmine SMEST
Match: SMESG000017729.1 (SMESG000017729.1)

HSP 1 Score: 263.462 bits (672), Expect = 1.271e-81
Identity = 122/214 (57.01%), Postives = 160/214 (74.77%), Query Frame = 3
Query:  306 DVANNISVECFGTESSNNPASQGNI---VQSCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKN----ESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENK 926
            ++++N+        S+ NP+S  N    V    F  +Q+A VCE L++ G I+RL RFLWS+P    L K+    E++L+A+A+VAFH GNF+ELY ILE H+F   +H KLQ LWL+AHY E+EK+RGRPLG V KYRVRKKFP+PRTIWDG++ ++CFKE++R++LREWY Q+PYP P +KRELA ATGLT TQV NWFKNRRQRDRA+ +K
Sbjct:    7 NISHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASK 220          
BLAST of Homeobox protein SIX1 vs. Planmine SMEST
Match: SMESG000020326.1 (SMESG000020326.1)

HSP 1 Score: 228.794 bits (582), Expect = 2.961e-71
Identity = 104/178 (58.43%), Postives = 135/178 (75.84%), Query Frame = 3
Query:  396 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEY----LQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRAS 917
            F+  Q+  VCE L++ G I RLARFLW L +C+     L  +ES+L+A+++VAFH GN+ ELY ILE+H FS Q+H KLQ  W  AHY E+EK+RGR LG V KYRVRK+ PLP TIWDG + ++CF+E++R +L++ YS++PYP P +KRELA  TGLT TQV NWFKNRRQRDRA+
Sbjct:   23 FSLSQICQVCENLEESGDIKRLARFLWCLSSCQSIWNSLLHHESILRARSIVAFHSGNYAELYFILENHRFSSQSHMKLQSFWFDAHYSEAEKLRGRALGPVDKYRVRKRHPLPSTIWDGQQRTHCFQERTRCLLKDCYSKDPYPNPNKKRELAIRTGLTATQVGNWFKNRRQRDRAA 200          
The following BLAST results are available for this feature:
BLAST of Homeobox protein SIX1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIX17.896e-11583.78SIX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:10887][more]
SIX29.567e-11483.15SIX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:10888][more]
SIX41.523e-8569.54SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890][more]
SIX46.048e-8469.54SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890][more]
SIX62.116e-8166.47SIX homeobox 6 [Source:HGNC Symbol;Acc:HGNC:10892][more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-334.449e-7863.01Homeobox protein ceh-33 [Source:UniProtKB/Swiss-P... [more]
ceh-342.820e-6050.77Homeobox protein ceh-34 [Source:UniProtKB/Swiss-P... [more]
ceh-326.587e-5953.25Homeobox protein ceh-32 [Source:UniProtKB/Swiss-P... [more]
unc-394.851e-4140.22Homeobox protein unc-39 [Source:UniProtKB/Swiss-P... [more]
unc-622.068e-836.08Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
so5.770e-11376.92gene:FBgn0003460 transcript:FBtr0088970[more]
Six46.030e-7862.71gene:FBgn0027364 transcript:FBtr0078274[more]
Six46.030e-7862.71gene:FBgn0027364 transcript:FBtr0078275[more]
Optix1.294e-7058.97gene:FBgn0025360 transcript:FBtr0088865[more]
Optix1.884e-7058.97gene:FBgn0025360 transcript:FBtr0329885[more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six1a1.703e-11678.05SIX homeobox 1a [Source:NCBI gene;Acc:494168][more]
six2a2.149e-11583.24SIX homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-010412-1... [more]
six2a2.149e-11583.24SIX homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-010412-1... [more]
six1b3.363e-11583.24SIX homeobox 1b [Source:NCBI gene;Acc:404627][more]
six2b7.275e-11584.32SIX homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080723-2... [more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six11.512e-11483.78SIX homeobox 1 [Source:NCBI gene;Acc:100101702][more]
six26.289e-11482.61SIX homeobox 2 [Source:NCBI gene;Acc:100101784][more]
tmem1361.211e-8161.58transmembrane protein 136 [Source:Xenbase;Acc:XB-G... [more]
SIX41.217e-8167.43SIX homeobox 4 [Source:NCBI gene;Acc:100498150][more]
six63.276e-8167.65SIX homeobox 6 [Source:NCBI gene;Acc:100101705][more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Six13.832e-11583.78sine oculis-related homeobox 1 [Source:MGI Symbol;... [more]
Six24.734e-11483.15sine oculis-related homeobox 2 [Source:MGI Symbol;... [more]
Six24.734e-11483.15sine oculis-related homeobox 2 [Source:MGI Symbol;... [more]
Six47.757e-8570.35sine oculis-related homeobox 4 [Source:MGI Symbol;... [more]
Six48.703e-8469.54sine oculis-related homeobox 4 [Source:MGI Symbol;... [more]
back to top
BLAST of Homeobox protein SIX1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DHF9|SIX1A_DANRE1.285e-11578.05Homeobox protein six1a OS=Danio rerio OX=7955 GN=s... [more]
sp|Q6NZ04|SIX1B_DANRE2.539e-11483.24Homeobox protein six1b OS=Danio rerio OX=7955 GN=s... [more]
sp|Q62231|SIX1_MOUSE2.680e-11483.78Homeobox protein SIX1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q15475|SIX1_HUMAN3.792e-11483.78Homeobox protein SIX1 OS=Homo sapiens OX=9606 GN=S... [more]
sp|A1YER0|SIX1_GORGO3.792e-11483.78Homeobox protein SIX1 OS=Gorilla gorilla gorilla O... [more]
back to top
BLAST of Homeobox protein SIX1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A444THQ11.119e-11678.37Homeobox protein six1b OS=Armadillidium vulgare OX... [more]
A0A5N5TFD21.527e-11675.58Homeobox protein six1b OS=Armadillidium nasatum OX... [more]
A0A2P6L5N38.188e-11674.11Six1b OS=Nephila clavipes OX=2585209 GN=NCL1_16312... [more]
A0A5B7FQZ32.578e-11584.95Homeobox protein SIX1 OS=Portunus trituberculatus ... [more]
A0A0P4VXC62.799e-11585.41Homeobox domain-containing protein OS=Scylla oliva... [more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six1b2.729e-11583.24homeobox protein six1b [Source:NCBI gene;Acc:10303... [more]
six2a4.938e-11583.24SIX homeobox 2 [Source:NCBI gene;Acc:103025828][more]
ENSAMXT00000021946.21.980e-11280.54homeobox protein six1b [Source:NCBI gene;Acc:10304... [more]
six2b3.990e-11178.87SIX homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080723-2... [more]
six91.276e-8766.84homeobox protein SIX2-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six1a2.035e-8778.00SIX homeobox 1a [Source:NCBI gene;Acc:494168][more]
ENSPMAT00000002854.11.253e-7762.43pep scaffold:Pmarinus_7.0:GL480305:17375:18769:1 g... [more]
ENSPMAT00000011157.11.228e-2973.02pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 ge... [more]
Six47.229e-2771.43pep scaffold:Pmarinus_7.0:GL478660:19078:19268:1 g... [more]
ENSPMAT00000001924.15.672e-2455.26pep scaffold:Pmarinus_7.0:GL488033:11:347:-1 gene:... [more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TOS84.583e-848.15Homeodomain-containing protein and putative transc... [more]
CUP94.407e-754.55Homeodomain-containing transcriptional repressor; ... [more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343344.888e-10880.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429337.463e-8367.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330594.769e-8063.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310345.047e-7964.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334072.578e-5956.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox protein SIX1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six1b1.056e-11584.32SIX homeobox 1 [Source:NCBI gene;Acc:101175523][more]
six2a1.063e-11483.15SIX homeobox 2 [Source:NCBI gene;Acc:101161260][more]
six4a2.931e-8669.71SIX homeobox 4 [Source:NCBI gene;Acc:101159478][more]
six72.788e-8363.93homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
six6a1.051e-8164.32SIX homeobox 6 [Source:NCBI gene;Acc:101154821][more]
back to top
BLAST of Homeobox protein SIX1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005975.10.000e+0100.00SMESG000005975.1[more]
SMESG000001687.12.453e-10371.36SMESG000001687.1[more]
SMESG000017729.19.409e-8257.01SMESG000017729.1[more]
SMESG000017729.11.271e-8157.01SMESG000017729.1[more]
SMESG000020326.12.961e-7158.43SMESG000020326.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005620 ID=SMED30005620|Name=Homeobox protein SIX1|organism=Schmidtea mediterranea sexual|type=transcript|length=1626bp
TAATTGCACTATCTGTCGTGTGCTCAGATATTATTATTCATACCACTCAA
AAATCCTTATAGTTAGAATTTTGATTTATTTCAAAGTAGATGTTAAATCA
CAGTAATTATACTAACAGTCTTTCACCATGTTCTTTTAGTCAACAAACTT
ACAATGGTTTGAATTATTCAAGTCCAGATATTAGGTATTCAAATAATACA
CAATCATATCCTTGTCAGGGATCTAATCCAGTGTACAATAATGTTTCGTC
AATTAATCAACCCGTTACTCAATCTGGCCACATTACGCCTCAAAGTTCTC
CATTAGATGTAGCTAATAATATTTCGGTTGAATGTTTTGGAACCGAATCA
TCAAACAATCCAGCCAGTCAAGGTAATATTGTGCAGTCTTGTGGTTTTAC
ACAGGAACAAGTAGCTTGTGTTTGTGAGGTACTTCAGCAAGGTGGAAGTA
TAGATCGTTTAGCCCGGTTTTTGTGGTCATTGCCAAACTGCGAATATCTG
CAAAAAAATGAAAGTGTTCTCAAAGCAAAAGCAGTCGTAGCTTTCCATCG
AGGAAATTTTAAAGAGTTATATAGAATTTTAGAAAGCCATAATTTTTCCG
TTCAAAACCATCATAAATTGCAAGATTTATGGTTGAAAGCTCATTACGTT
GAATCAGAAAAAATTCGTGGTCGACCACTGGGTGCTGTGGGTAAATATAG
AGTGCGTAAAAAGTTTCCTTTACCAAGAACGATTTGGGATGGAGATGAAA
CGAGTTATTGTTTCAAAGAAAAATCGAGAAACGTTCTAAGAGAGTGGTAT
AGTCAAAATCCTTATCCAACTCCGAGGGAGAAAAGAGAATTAGCTGAAGC
TACCGGCCTAACGACTACACAAGTTTCAAATTGGTTTAAAAATCGTAGAC
AGCGAGATCGTGCCTCAGAGAATAAAGAAGGCAATGAAGGTTCGGTTAAT
TCGATTGTGGACAAATTTATACCTCACAGTCCAAGTGATATCAAAGACGA
TAATTCAATGACGAAGTCTTGTGTTAAAAATAACAGCAATGGAGAAATTT
GCTCCAAATCCATCGAACAAATGGAGGCTGATATCAAAAAAGAGCACACC
ACAATTCCTGGCTTTTACCAGGAATCCAAGAGATTAGGAATGCAATTTTC
CAGTCCGAGTCAATTTTCCCCGTATTCAACTGTGTTTGATTATTCTCAAC
TCGAGCAAGACAAATTTGCTTCGTTTATGATAAACAATAAACAACGTGAA
TATCAAGATAGTTTTCAAATGTTGCAGTCGTATTATAATCCAGGTCTACA
CGCTGCCCCTGCTAACGCTTCACCACTCTATCGTGCTACAGCTGCCGCAA
TGATGACACCAAATGTTTATTTTGATCCACACAACCAATTCTATCCAAAC
ACGGTTTCCCATCATCCTTATGCAAACTCCAGTTTATCCGGACAGTCACA
TGGAACTCTAAATCACAATCCCAACTTATCATCCTCACCAACATTGAACT
TAATGGCCCATAATTTTTCTACTGGTCATTCATATCTCTCCAACTACACT
CCATGCTAACGACAGAATATTACCAGAGCAGCAAAAAGGGGGAAATTAAA
TCCATCTTAATATGTATATTCCAAAT
back to top

protein sequence of SMED30005620-orf-1

>SMED30005620-orf-1 ID=SMED30005620-orf-1|Name=SMED30005620-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MLNHSNYTNSLSPCSFSQQTYNGLNYSSPDIRYSNNTQSYPCQGSNPVYN
NVSSINQPVTQSGHITPQSSPLDVANNISVECFGTESSNNPASQGNIVQS
CGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVV
AFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAV
GKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRE
LAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGSVNSIVDKFIPHSPSD
IKDDNSMTKSCVKNNSNGEICSKSIEQMEADIKKEHTTIPGFYQESKRLG
MQFSSPSQFSPYSTVFDYSQLEQDKFASFMINNKQREYQDSFQMLQSYYN
PGLHAAPANASPLYRATAAAMMTPNVYFDPHNQFYPNTVSHHPYANSSLS
GQSHGTLNHNPNLSSSPTLNLMAHNFSTGHSYLSNYTPC*
back to top
Aliases
The feature 'Homeobox protein SIX1' has the following synonyms
Synonym
six1/2-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000011protonephridial progenitor cell
PLANA:0000020protonephridia
PLANA:0000418head
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR031701SIX1_SD
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006915apoptotic process
GO:0007275multicellular organism development
GO:0008283cell proliferation
GO:0048513animal organ development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 219..280
e-value: 2.4E-17
score: 73.6
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 224..274
e-value: 4.7E-14
score: 52.0
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 225..276
score: 15.548
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 223..277
e-value: 1.66762E-17
score: 74.202
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 222..286
e-value: 2.0E-20
score: 74.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 262..309
NoneNo IPR availablePANTHERPTHR10390:SF61SIX HOMEOBOX 2coord: 96..357
NoneNo IPR availablePANTHERPTHR10390HOMEOBOX PROTEIN SIXcoord: 96..357
IPR031701Homeobox protein SIX1, N-terminal SD domainPFAMPF16878SIX1_SDcoord: 103..213
e-value: 2.6E-48
score: 163.1
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 251..274
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 216..280