Dynamin-1-like protein

Overview
NameDynamin-1-like protein
Smed IDSMED30005617
Length (bp)2205
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-1-like protein (SMED30005617) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-1-like protein (SMED30005617) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-1-like protein (SMED30005617) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-1-like protein (SMED30005617) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005617

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30005617SMESG000059031.1 SMESG000059029.1 SMESG000059025.1 SMESG000059016.1 dd_Smed_v4_1074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30005617SMESG000059031.1 SMESG000059029.1 SMESG000059025.1 SMESG000059016.1 dd_Smed_v6_1074_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005617SMESG000059031.1 SMESG000059029.1 SMESG000059025.1 SMESG000059016.1 dd_Smed_v6_1074_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005617SMESG000059031.1 SMESG000059029.1 SMESG000059025.1 SMESG000059016.1 dd_Smed_v4_1074_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005617SMESG000059031.1 SMESG000059029.1 SMESG000059025.1 SMESG000059016.1 SMED30005617smed_20140614PMID:24950970
Talbot et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 244.202 bits (622), Expect = 4.790e-70
Identity = 210/685 (30.66%), Postives = 341/685 (49.78%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ--------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN------HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +                F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N      ++        +++   A+         Q        GN + +      +E   E             +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVH-VSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKVASGGGGVGDGVQE----PTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 656          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 244.202 bits (622), Expect = 6.879e-70
Identity = 215/690 (31.16%), Postives = 352/690 (51.01%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ--------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVP---NWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +                F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N       SA + D L+    ++        G +      P   NW+    ++   + + +E +S+   I+  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVH-VSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGM-LKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 667          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 239.195 bits (609), Expect = 4.851e-68
Identity = 208/694 (29.97%), Postives = 339/694 (48.85%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ---------------------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN--HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +                             F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N   ++       +  + +   +                GN + +      +E   E             +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVH-VSQEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 669          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 239.195 bits (609), Expect = 5.010e-68
Identity = 210/705 (29.79%), Postives = 351/705 (49.79%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ--------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN---HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKA----------------LASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +                F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N    ++     E  +  +      +P  +    +      + +A                  +  NW+    ++   + + +E +S+   I+  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVH-VSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKVASGGGGVGDGVQEPTTGNWRGM-LKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 682          
BLAST of Dynamin-1-like protein vs. Ensembl Human
Match: DNM1L (dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973])

HSP 1 Score: 238.424 bits (607), Expect = 1.218e-67
Identity = 213/716 (29.75%), Postives = 352/716 (49.16%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ--------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN------HKQGENFEETI--NKSANAADILMPP---------------YIKQFLRNVHLCGNIKAL-------ASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +                F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N      ++        +  +KS+     L P                 I+   R      +            +  NW+    ++   + + +E +S+   I+  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVH-VSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGM-LKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 693          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 227.254 bits (578), Expect = 4.206e-64
Identity = 194/684 (28.36%), Postives = 344/684 (50.29%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGK--EAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQL----INDAS---------LEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI------YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHP--NSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNN-NEVIE--------DWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME+LI ++NKLQ      G+  + I  P+IVV+GSQS+GKSS+LE ++  D LP+     T  P+I+QL    ++D S         L D  A F  + SK++     +R+++++ T+++    +G++  PI L++  + + +L+L+DLPG+ K     Q  +I+ +I++++  ++ +P +IILA++ AN D A S+ I++AR+ D  G RTL V+TKLDLMDQGTD  D+L    +   LG I +VNRSQ+ I +   +V A + E ++++K YP +++++G   L   L   L   I+N LP +   +         ++       E+ N T   +I  F   Y + I G     +   L  GA+I  I ++ + + LES+   +  TQ +I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +++  G         +P L + I   +  ++++R   T  +V+ L+  E   +   HP         L KE     +    + N+ A+  +           R V   G  + L  VP     +  +VL +        R ++       N   ++      KQ  N   EV E          ++R+V ++  ++++YF +V+KN   + PK I   L+         EL++++YK
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVE----LVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGE-----------RAVSAHGE-QQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFLPEVPETQLGRKLTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYK 668          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 227.254 bits (578), Expect = 4.206e-64
Identity = 194/684 (28.36%), Postives = 344/684 (50.29%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGK--EAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQL----INDAS---------LEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI------YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHP--NSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNN-NEVIE--------DWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME+LI ++NKLQ      G+  + I  P+IVV+GSQS+GKSS+LE ++  D LP+     T  P+I+QL    ++D S         L D  A F  + SK++     +R+++++ T+++    +G++  PI L++  + + +L+L+DLPG+ K     Q  +I+ +I++++  ++ +P +IILA++ AN D A S+ I++AR+ D  G RTL V+TKLDLMDQGTD  D+L    +   LG I +VNRSQ+ I +   +V A + E ++++K YP +++++G   L   L   L   I+N LP +   +         ++       E+ N T   +I  F   Y + I G     +   L  GA+I  I ++ + + LES+   +  TQ +I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +++  G         +P L + I   +  ++++R   T  +V+ L+  E   +   HP         L KE     +    + N+ A+  +           R V   G  + L  VP     +  +VL +        R ++       N   ++      KQ  N   EV E          ++R+V ++  ++++YF +V+KN   + PK I   L+         EL++++YK
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVE----LVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGE-----------RAVSAHGE-QQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFLPEVPETQLGRKLTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYK 668          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 227.254 bits (578), Expect = 4.206e-64
Identity = 194/684 (28.36%), Postives = 344/684 (50.29%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGK--EAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQL----INDAS---------LEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI------YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHP--NSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNN-NEVIE--------DWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME+LI ++NKLQ      G+  + I  P+IVV+GSQS+GKSS+LE ++  D LP+     T  P+I+QL    ++D S         L D  A F  + SK++     +R+++++ T+++    +G++  PI L++  + + +L+L+DLPG+ K     Q  +I+ +I++++  ++ +P +IILA++ AN D A S+ I++AR+ D  G RTL V+TKLDLMDQGTD  D+L    +   LG I +VNRSQ+ I +   +V A + E ++++K YP +++++G   L   L   L   I+N LP +   +         ++       E+ N T   +I  F   Y + I G     +   L  GA+I  I ++ + + LES+   +  TQ +I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +++  G         +P L + I   +  ++++R   T  +V+ L+  E   +   HP         L KE     +    + N+ A+  +           R V   G  + L  VP     +  +VL +        R ++       N   ++      KQ  N   EV E          ++R+V ++  ++++YF +V+KN   + PK I   L+         EL++++YK
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVE----LVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGE-----------RAVSAHGE-QQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFLPEVPETQLGRKLTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYK 668          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 226.483 bits (576), Expect = 7.258e-64
Identity = 192/683 (28.11%), Postives = 341/683 (49.93%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGK--EAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQL----INDAS---------LEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI------YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKA-LASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNN-NEVIE--------DWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME+LI ++NKLQ      G+  + I  P+IVV+GSQS+GKSS+LE ++  D LP+     T  P+I+QL    ++D S         L D  A F  + SK++     +R+++++ T+++    +G++  PI L++  + + +L+L+DLPG+ K     Q  +I+ +I++++  ++ +P +IILA++ AN D A S+ I++AR+ D  G RTL V+TKLDLMDQGTD  D+L    +   LG I +VNRSQ+ I +   +V A + E ++++K YP +++++G   L   L   L   I+N LP +   +         ++       E+ N T   +I  F   Y + I G     +   L  GA+I  I ++ + + LES+   +  TQ +I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +++  G         +P L + I   +  ++++R   T  +V+ L+  E   +   HP         + N       E  ++     +            RN H     +A L  VP     +  +VL +        R ++       N   ++      KQ  N   EV E          ++R+V ++  ++++YF +V+KN   + PK I   L+         EL++++YK
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVE----LVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHP------EFTEANLVTLLKEELLLDDRHGRS------------RNRHASTGERAQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFLPEVPETQLGRKLTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYK 661          
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 226.483 bits (576), Expect = 7.258e-64
Identity = 192/683 (28.11%), Postives = 341/683 (49.93%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGK--EAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQL----INDAS---------LEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI------YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKA-LASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNN-NEVIE--------DWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME+LI ++NKLQ      G+  + I  P+IVV+GSQS+GKSS+LE ++  D LP+     T  P+I+QL    ++D S         L D  A F  + SK++     +R+++++ T+++    +G++  PI L++  + + +L+L+DLPG+ K     Q  +I+ +I++++  ++ +P +IILA++ AN D A S+ I++AR+ D  G RTL V+TKLDLMDQGTD  D+L    +   LG I +VNRSQ+ I +   +V A + E ++++K YP +++++G   L   L   L   I+N LP +   +         ++       E+ N T   +I  F   Y + I G     +   L  GA+I  I ++ + + LES+   +  TQ +I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +++  G         +P L + I   +  ++++R   T  +V+ L+  E   +   HP         + N       E  ++     +            RN H     +A L  VP     +  +VL +        R ++       N   ++      KQ  N   EV E          ++R+V ++  ++++YF +V+KN   + PK I   L+         EL++++YK
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVE----LVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHP------EFTEANLVTLLKEELLLDDRHGRS------------RNRHASTGERAQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFLPEVPETQLGRKLTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYK 661          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: Drp1 (gene:FBgn0026479 transcript:FBtr0077744)

HSP 1 Score: 216.468 bits (550), Expect = 4.455e-60
Identity = 196/705 (27.80%), Postives = 344/705 (48.79%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSK--------IYIGEC-----EIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF-----VILEFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI------YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETIN---KSANAADILMPPYI-------------------------KQFLRNVHLCGN-IKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G ++I  P+IVV+GSQSSGKSS++E ++    LP+     T  P+++QLI  + L+D +   +++ +         ++  +C     EIR++++  T +     +G+   PI L++   ++  LTL+DLPG+ K     Q   I+ +I++LV  ++E+P +IILA++AAN D+A S+A+++A+  DP G RTL V+TKLDLMD GTD  D+L    +   LG I ++NRSQK I ++  +    + E  +L++ YP ++ ++G   L   L   L   I++ LP +   + I   +F +L    + S GE+ +        +I +F   Y   I G     +   L  GA++  I +E + + L+S+      ++ +I+  I+NATG R   +  E +F LLVK++I +L++PS   ++    L+++ +  +++  G ++      +P L   I   +  ++ +R   T  +V+ ++  E   +   HP+      L     K   +    IN   + AN     M P I                          Q     H+  N   ++AS   W          +  + E  +  T + N     VK  N L  +    N+N   + D ++++  V+  ++K YF +V+K+   + PK I  FL+         EL+  +YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVLQLIY-SPLDDRENRSAENGTSNAEEWGRFLHTKKCFTDFDEIRKEIENETERAAGSNKGICPEPINLKIFSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLGIIGVMNRSQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLKTRVNIMATQFQSL----LNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGGARMGYIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVE----LIHEEMQRIVQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTNVMVENIVAIELAYINTKHPDFHKDAALVPSLLKTDSDPYSQINLGQRRANTPRNHMSPQISSHSAGSQQPQQQQPPQPNSSQQQYSQVHEQNHVAENSTPSMAST--WLSNILPPAPTRPDSIENSTNNTPVHNNIVSPVKPVNLLPDVPA--NHNPRRLTDKEQKDCDVIEHLIKSYFYIVRKSIQDSVPKAIMHFLVNYVKDNLQSELVTHLYKS 692          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: Drp1 (gene:FBgn0026479 transcript:FBtr0335173)

HSP 1 Score: 216.468 bits (550), Expect = 4.455e-60
Identity = 196/705 (27.80%), Postives = 344/705 (48.79%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSK--------IYIGEC-----EIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF-----VILEFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI------YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETIN---KSANAADILMPPYI-------------------------KQFLRNVHLCGN-IKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G ++I  P+IVV+GSQSSGKSS++E ++    LP+     T  P+++QLI  + L+D +   +++ +         ++  +C     EIR++++  T +     +G+   PI L++   ++  LTL+DLPG+ K     Q   I+ +I++LV  ++E+P +IILA++AAN D+A S+A+++A+  DP G RTL V+TKLDLMD GTD  D+L    +   LG I ++NRSQK I ++  +    + E  +L++ YP ++ ++G   L   L   L   I++ LP +   + I   +F +L    + S GE+ +        +I +F   Y   I G     +   L  GA++  I +E + + L+S+      ++ +I+  I+NATG R   +  E +F LLVK++I +L++PS   ++    L+++ +  +++  G ++      +P L   I   +  ++ +R   T  +V+ ++  E   +   HP+      L     K   +    IN   + AN     M P I                          Q     H+  N   ++AS   W          +  + E  +  T + N     VK  N L  +    N+N   + D ++++  V+  ++K YF +V+K+   + PK I  FL+         EL+  +YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVLQLIY-SPLDDRENRSAENGTSNAEEWGRFLHTKKCFTDFDEIRKEIENETERAAGSNKGICPEPINLKIFSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIILAVTAANTDMATSEALKLAKDVDPDGRRTLAVVTKLDLMDAGTDAIDILCGRVIPVKLGIIGVMNRSQKDIMDQKHIDDQMKDEAAFLQRKYPTLATRNGTPYLAKTLNRLLMHHIRDCLPDLKTRVNIMATQFQSL----LNSYGEDVSDKSQTLLQIITKFSSAYCCTIEGTARNIETTELCGGARMGYIFHETFGRTLDSIHPLAGLSKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSLRCVE----LIHEEMQRIVQHCGNEVQQEMLRFPKLHEKIVDVVTQLLRRRLPHTNVMVENIVAIELAYINTKHPDFHKDAALVPSLLKTDSDPYSQINLGQRRANTPRNHMSPQISSHSAGSQQPQQQQPPQPNSSQQQYSQVHEQNHVAENSTPSMAST--WLSNILPPAPTRPDSIENSTNNTPVHNNIVSPVKPVNLLPDVPA--NHNPRRLTDKEQKDCDVIEHLIKSYFYIVRKSIQDSVPKAIMHFLVNYVKDNLQSELVTHLYKS 692          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074122)

HSP 1 Score: 200.675 bits (509), Expect = 4.155e-54
Identity = 176/569 (30.93%), Postives = 284/569 (49.91%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEA-IHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSI-QKIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXX--XXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTL-----EMNHMVSSGENTNATFVILEFIKNYKNHI------YGNNVFDPNVLIRGAKISKILYEDYLKELESLVTD-KFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI--YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLC----GNIKALASVPNWKEFNFESV 1716
            M+ LI I+NKLQ      G    +  P+I V+G QS+GKSS+LE  +  D LP+ +   T  P+I+QLIN  +       F   + K +    EIR+++++ T+++    +G++  PI L++   ++  LTLIDLPG+ K     Q   I Q+I+Q++  F+     +ILA++ AN DLANSDA+++A++ DP+G RT+ VITKLDLMD+GTD RD+L +  +    G I +VNRSQK I+ +  +  A   E         Y  ++++ G   L   L  +L   I++ LP +  ++  +K+ LTL     E  H    G+ +  T  +L+ I+  ++         G+ + + N L  GAKI++I +E    E+  +  D K  +  I   I+N  G R   ++ +  F  +VK++I  L++P    +   V L+ Q +S V+     K+  YP L    E  + T + +R +  K  +  LI     D    + N+         NH+    F    NKS NA          Q +R  H+     G +K   S P W     ES+
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTE---YGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKL--QKQMLTLEKEVEEFKHF-QPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEP----VIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLI-----DFELAYMNT---------NHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKG-GSRPYWFVLTSESI 544          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074121)

HSP 1 Score: 200.675 bits (509), Expect = 4.155e-54
Identity = 176/569 (30.93%), Postives = 284/569 (49.91%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEA-IHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSI-QKIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXX--XXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTL-----EMNHMVSSGENTNATFVILEFIKNYKNHI------YGNNVFDPNVLIRGAKISKILYEDYLKELESLVTD-KFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI--YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLC----GNIKALASVPNWKEFNFESV 1716
            M+ LI I+NKLQ      G    +  P+I V+G QS+GKSS+LE  +  D LP+ +   T  P+I+QLIN  +       F   + K +    EIR+++++ T+++    +G++  PI L++   ++  LTLIDLPG+ K     Q   I Q+I+Q++  F+     +ILA++ AN DLANSDA+++A++ DP+G RT+ VITKLDLMD+GTD RD+L +  +    G I +VNRSQK I+ +  +  A   E         Y  ++++ G   L   L  +L   I++ LP +  ++  +K+ LTL     E  H    G+ +  T  +L+ I+  ++         G+ + + N L  GAKI++I +E    E+  +  D K  +  I   I+N  G R   ++ +  F  +VK++I  L++P    +   V L+ Q +S V+     K+  YP L    E  + T + +R +  K  +  LI     D    + N+         NH+    F    NKS NA          Q +R  H+     G +K   S P W     ES+
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTE---YGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKL--QKQMLTLEKEVEEFKHF-QPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEP----VIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLI-----DFELAYMNT---------NHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKG-GSRPYWFVLTSESI 544          
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074119)

HSP 1 Score: 200.675 bits (509), Expect = 4.155e-54
Identity = 176/569 (30.93%), Postives = 284/569 (49.91%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEA-IHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSI-QKIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXX--XXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTL-----EMNHMVSSGENTNATFVILEFIKNYKNHI------YGNNVFDPNVLIRGAKISKILYEDYLKELESLVTD-KFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI--YPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLC----GNIKALASVPNWKEFNFESV 1716
            M+ LI I+NKLQ      G    +  P+I V+G QS+GKSS+LE  +  D LP+ +   T  P+I+QLIN  +       F   + K +    EIR+++++ T+++    +G++  PI L++   ++  LTLIDLPG+ K     Q   I Q+I+Q++  F+     +ILA++ AN DLANSDA+++A++ DP+G RT+ VITKLDLMD+GTD RD+L +  +    G I +VNRSQK I+ +  +  A   E         Y  ++++ G   L   L  +L   I++ LP +  ++  +K+ LTL     E  H    G+ +  T  +L+ I+  ++         G+ + + N L  GAKI++I +E    E+  +  D K  +  I   I+N  G R   ++ +  F  +VK++I  L++P    +   V L+ Q +S V+     K+  YP L    E  + T + +R +  K  +  LI     D    + N+         NH+    F    NKS NA          Q +R  H+     G +K   S P W     ES+
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTE---YGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKL--QKQMLTLEKEVEEFKHF-QPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEP----VIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLI-----DFELAYMNT---------NHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKG-GSRPYWFVLTSESI 544          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:393896])

HSP 1 Score: 242.276 bits (617), Expect = 1.413e-69
Identity = 207/694 (29.83%), Postives = 347/694 (50.00%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI-------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSG----ENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKA--LASVPNWKEFNFESVLGKN-----MNSEVES--RKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+             N    E+   F   +++KIY    EIRQ+++  T ++    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E+ +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L+ +   ++SS     E+ +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N    +  S         P  K       + G  +A        W+    +   G+      + S + +  +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK  +  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLH-TKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPTSV--------PRDK-------MAGGAQAEQEGGTGTWRGMLKKGDEGQGEEKTKLQSSIPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLT 656          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:393896])

HSP 1 Score: 240.736 bits (613), Expect = 7.848e-69
Identity = 207/703 (29.45%), Postives = 348/703 (49.50%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI-------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSG----ENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAADILMPPYIKQFLR---------NVHLCGNIKA--LASVPNWKEFNFESVLGKN-----MNSEVES--RKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+             N    E+   F   +++KIY    EIRQ+++  T ++    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E+ +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L+ +   ++SS     E+ +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N    +  S      L  P  +                + G  +A        W+    +   G+      + S + +  +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK  +  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLH-TKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPTSVPRDKSLKGPGGQSMSPTDQPSAEGDGPKMAGGAQAEQEGGTGTWRGMLKKGDEGQGEEKTKLQSSIPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLT 680          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: si:dkey-32e23.4 (si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-41])

HSP 1 Score: 218.779 bits (556), Expect = 4.022e-61
Identity = 196/688 (28.49%), Postives = 333/688 (48.40%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ------------------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLE----MNHMVSSGENTNATF--VILEFIKNYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPS-------EDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETIN-KSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME LI IIN+LQ      G E I  P+IVV+GSQSSGKSS+LE ++  D LP+ +   T  P+++QL+N   LE+ +                          F   +++I+    EIR++++E T++  +  +G+++ PI L++   N+ +LTL+DLPG+ K     Q   I+ ++Q+++ +++ +P ++IL +S AN DLA SDA+++AR+ D  G RTL V++KLDLMD GTD  ++L    +   LG I +VNRSQ  +  + SL  +   E  +L+++YP ++++ G + L   L   L   I++ LP    E+  R   LT +    +N      E+ +AT   ++ +F  +Y + I G       + L  GA++  I +E + + L+S+      T+ +I+  I+NATG R   +  E +F LLVKK+I++L++PS        + LQ ++    Q  S    Q  ++ +P L + I   +  ++ KR   T  +V  L+  E   +   HP           +         ++N + A A D                 G  +       WK     S     M       K   IN  D  V  +   + ++ +E  + EVI+            ++K YF +V+K+   + PK +  FL+         EL+ ++YK
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKQDNGNGSKQNSQNNYPGIKAEEWGTFLHCKNQIFTDFNEIRKEIEEETDRSTNN-KGISKEPIYLKIYSPNVLSLTLVDLPGITKVPVGDQPEDIEIQVQEMILSYISNPNSLILCVSPANSDLATSDALKLAREVDADGRRTLLVVSKLDLMDAGTDALEVLLGRVIPVRLGIIGVVNRSQHDLNTQKSLSDSCRDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLP----ELKTRVTVLTAQYQSRLNSYGQPVEDHSATLLQIVTKFATDYCSTIEGTARHIQTSELCGGARMCYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKKQIKRLEEPSLRCVELVHEELQRII----QHCSSYSTQELLR-FPKLHDSIVEVVTGLLRKRLPITNEMVHNLVAIELAYINTKHP-----------DFTDAAQVSASVNSQQAEAGD-----------------GGKR-------WKNEKMPSEEKGPMPGFGSPSKA--INLLDTAVPVS---RKLSSREQRDCEVIQ-----------RLIKCYFLIVRKSIQDSVPKTVMHFLVNFVKEHLQSELVGQLYK 627          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: si:dkey-32e23.4 (si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-41])

HSP 1 Score: 218.779 bits (556), Expect = 4.022e-61
Identity = 196/688 (28.49%), Postives = 333/688 (48.40%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ------------------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLE----MNHMVSSGENTNATF--VILEFIKNYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPS-------EDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETIN-KSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME LI IIN+LQ      G E I  P+IVV+GSQSSGKSS+LE ++  D LP+ +   T  P+++QL+N   LE+ +                          F   +++I+    EIR++++E T++  +  +G+++ PI L++   N+ +LTL+DLPG+ K     Q   I+ ++Q+++ +++ +P ++IL +S AN DLA SDA+++AR+ D  G RTL V++KLDLMD GTD  ++L    +   LG I +VNRSQ  +  + SL  +   E  +L+++YP ++++ G + L   L   L   I++ LP    E+  R   LT +    +N      E+ +AT   ++ +F  +Y + I G       + L  GA++  I +E + + L+S+      T+ +I+  I+NATG R   +  E +F LLVKK+I++L++PS        + LQ ++    Q  S    Q  ++ +P L + I   +  ++ KR   T  +V  L+  E   +   HP           +         ++N + A A D                 G  +       WK     S     M       K   IN  D  V  +   + ++ +E  + EVI+            ++K YF +V+K+   + PK +  FL+         EL+ ++YK
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKQDNGNGSKQNSQNNYPGIKAEEWGTFLHCKNQIFTDFNEIRKEIEEETDRSTNN-KGISKEPIYLKIYSPNVLSLTLVDLPGITKVPVGDQPEDIEIQVQEMILSYISNPNSLILCVSPANSDLATSDALKLAREVDADGRRTLLVVSKLDLMDAGTDALEVLLGRVIPVRLGIIGVVNRSQHDLNTQKSLSDSCRDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLP----ELKTRVTVLTAQYQSRLNSYGQPVEDHSATLLQIVTKFATDYCSTIEGTARHIQTSELCGGARMCYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKKQIKRLEEPSLRCVELVHEELQRII----QHCSSYSTQELLR-FPKLHDSIVEVVTGLLRKRLPITNEMVHNLVAIELAYINTKHP-----------DFTDAAQVSASVNSQQAEAGD-----------------GGKR-------WKNEKMPSEEKGPMPGFGSPSKA--INLLDTAVPVS---RKLSSREQRDCEVIQ-----------RLIKCYFLIVRKSIQDSVPKTVMHFLVNFVKEHLQSELVGQLYK 627          
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Match: dnm2a (dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84])

HSP 1 Score: 212.231 bits (539), Expect = 2.581e-58
Identity = 161/506 (31.82%), Postives = 275/506 (54.35%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEA-IHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXX--XXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMN----HMVSSGENTNATFVILEFIK----NYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESLVTD-KFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG-IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN 1548
            ME+LI +INKLQ   +  G+   +  P+I V+G QS+GKSS+LE  +  D LP+ +   T  P+I+QL+N+ +     A F   + + ++   E+RQ+++  T++I    +G++  PI L++   N+  LTLIDLPG+ K     Q   I+ +I+ ++  F+     +ILA++ AN+DLANSDA+++A++ DP+G RT+ VITKLDLMD+GTD RD+L +  +    G I +VNRSQK I  +  + +A   E         Y  ++ + G   L  AL  +L   I++ LP +  ++  + + L+LE            + T  T  +L+ ++    +++  I G+ +  D   L  GA+I++I +E +  EL  +V D K  +  I   IKN  G R   ++ +  F  +VKK+I KL++P    L+ + +++ + ++   + T  +  YP L    E  + T + +R  KTK  V  LI  E + +   H +   F + ++ N
Sbjct:    6 MEELIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNNKAE---YAEFLHCKGRKFVDFDEVRQEIEAETDRITGSNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMIMQFITRESCLILAVTPANMDLANSDALKVAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDIRAALAAERKFFLSHPSYRHMAERMGTPHLQKALNQQLTNHIRDTLPGLRSKL--QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKCIEGSGDQVDTAELSGGARINRIFHERFPFELVKIVFDEKELRREISHAIKNVHGVRTGLFTPDLAFEAIVKKQIIKLKEP---CLKCIDLVIQELINTFRQCTNKLSSYPRLREETERIVTTYVREREGKTKDQVLLLIDTELSYINTNHEDFIGFANAQQRN 503          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 251.521 bits (641), Expect = 1.095e-72
Identity = 215/704 (30.54%), Postives = 353/704 (50.14%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI--------------NDASLEDLQAFFS------------DSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVL---GKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+              ND +   +   FS             +++KIY    EIRQ+++  T +I    +G++  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+      T  +I+  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L         N EE   +    A  L PP  K         GN      +P+    N+  +L   G+ + +E ++R    +  +       N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+++  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENDPNAWKIPKHFSKGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGL------MNNNIEE--QRRNRIARELPPPREK-----AAPAGNTG--DGLPDAGTGNWRGMLKPKGEELPAEEKNRAPPALPASPLRGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLT 673          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 251.521 bits (641), Expect = 1.137e-72
Identity = 209/695 (30.07%), Postives = 351/695 (50.50%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI--------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVK--KLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEE-TINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVL---GKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+              N    E+   F   +++KIY    EIRQ+++  T +I    +G++  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+      T  +I+  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V+   L +C    +         FY  R    +    +   +   + N   + MP  I Q    +           +P+    N+  +L   G+ + +E ++R    +  +       N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+++  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGVETEEWGKFLH-TKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVRDEALALCPLRLLPRCPFADLTFYDTRLLACRYITWWPSNSPTSTPNTRTLPMPIIICQLALPLQAAPAGNTGDGLPDAGTGNWRGMLKPKGEELPAEEKNRAPPALPASPLRGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLT 678          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 251.521 bits (641), Expect = 1.204e-72
Identity = 213/696 (30.60%), Postives = 354/696 (50.86%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI--------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSA--NAADILMPPYIKQFLRN--VHLCGNIKALASVPNWKEFNFESVL---GKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+              N    E+   F   +++KIY    EIRQ+++  T +I    +G++  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+      T  +I+  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L   N+ +   F  +   S    AA +   P       +  V   GN      +P+    N+  +L   G+ + +E ++R    +  +       N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+++  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGVETEEWGKFLH-TKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMN-NNIEVSAFRVSYPTSGPLPAASLEPSPASSSAETDGKVSPAGNTG--DGLPDAGTGNWRGMLKPKGEELPAEEKNRAPPALPASPLRGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLT 676          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 249.98 bits (637), Expect = 1.701e-72
Identity = 208/674 (30.86%), Postives = 339/674 (50.30%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLE------DLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++ +S +      D     S   S IY    EIRQ+++  T +I    +G++  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+      T  +I+  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP                 +F +    + N  D L  P            GN + +   P  +E   E              +   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+++  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGNVSARGSPIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHP-----------------DFADAA-PAGNTGDGL--PDAG--------TGNWRGMLK-PKGEELPAEEKNRAPPALPASPLRGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLT 626          
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Match: dnm1l (dynamin 1-like [Source:NCBI gene;Acc:100494576])

HSP 1 Score: 248.44 bits (633), Expect = 1.720e-71
Identity = 212/701 (30.24%), Postives = 356/701 (50.78%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAF-------------------FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSA--NAADILMPPYIKQFLRN--VHLCGNIKALASVPNWKEFNFESVL---GKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++ +S +  +                     F  +++KIY    EIRQ+++  T +I    +G++  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+      T  +I+  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L   N+ +   F  +   S    AA +   P       +  V   GN      +P+    N+  +L   G+ + +E ++R    +  +       N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+++  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGSDVIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSSDDRRKTSGDENGNVSARGVETEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISSEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIEIQIRELILRYISNPNSIILAVTAANTDMATSEALKIARESDPDGRRTLAVITKLDLMDAGTDAMDVLLGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGL-MNNNIEVSAFRVSYPTSGPLPAASLEPSPASSSAETDGKVSPAGNTG--DGLPDAGTGNWRGMLKPKGEELPAEEKNRAPPALPASPLRGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSMLLEDLLT 682          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 245.743 bits (626), Expect = 1.206e-70
Identity = 213/681 (31.28%), Postives = 341/681 (50.07%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ--------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAAD-ILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +                F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N       SA + D +                GN + +      +E   E             +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSPEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKVPSAGGGIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 656          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 244.202 bits (622), Expect = 5.531e-70
Identity = 217/697 (31.13%), Postives = 356/697 (51.08%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLED-----------LQAF---------FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKAL----ASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED            Q++         F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N       SA + D L+    ++  +NV   G          +  NW+    ++   + + +E +S+   I+  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKLIQDNRRE-TKNVPSAGGGIGDGGQEPTTGNWRGM-LKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 673          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm1l (dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256])

HSP 1 Score: 240.736 bits (613), Expect = 9.539e-69
Identity = 213/694 (30.69%), Postives = 341/694 (49.14%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ---------------------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAAD-ILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +                             F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N       SA + D +                GN + +      +E   E             +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSPEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKVPSAGGGIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 669          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm2 (dynamin 2 [Source:MGI Symbol;Acc:MGI:109547])

HSP 1 Score: 211.846 bits (538), Expect = 1.362e-57
Identity = 160/492 (32.52%), Postives = 268/492 (54.47%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEA-IHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXX--XXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMN----HMVSSGENTNATFVILEFIK----NYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESLVTD-KFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIH 1509
            ME+LI ++NKLQ   +  G+   +  P+I V+G QS+GKSS+LE  +  D LP+ +   T  P+I+QLI   +     A F   +SK +    E+RQ+++  T+++    +G++  PI L++   ++  LTLIDLPG+ K     Q   I+ +I+ ++  F+    ++ILA++ AN+DLANSDA+++A++ DP+G RT+ VITKLDLMD+GTD RD+L +  +    G I +VNRSQK I+ K  + +A   E         Y  ++++ G   L   L  +L   I+ +LPT+  ++  + + L+LE            + T  T  +L+ ++    +++  I G+ +  D   L  GA+I++I +E +  EL  +  D K  +  I   IKN  G R   ++ +  F  +VKK++ KL++PS   +  VV  L   + +  E+  +  YP L    E  + T I +R  +TK  +  LI  EQ+ +   H
Sbjct:    6 MEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTE---YAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKL--QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQLVKLKEPSLKCVDLVVSELATVIKKCAEK--LSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNH 490          
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Match: Dnm2 (dynamin 2 [Source:MGI Symbol;Acc:MGI:109547])

HSP 1 Score: 211.846 bits (538), Expect = 1.370e-57
Identity = 160/493 (32.45%), Postives = 271/493 (54.97%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEA-IHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXX--XXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMN----HMVSSGENTNATFVILEFIK----NYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESLVTD-KFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG-IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIH 1509
            ME+LI ++NKLQ   +  G+   +  P+I V+G QS+GKSS+LE  +  D LP+ +   T  P+I+QLI   +     A F   +SK +    E+RQ+++  T+++    +G++  PI L++   ++  LTLIDLPG+ K     Q   I+ +I+ ++  F+    ++ILA++ AN+DLANSDA+++A++ DP+G RT+ VITKLDLMD+GTD RD+L +  +    G I +VNRSQK I+ K  + +A   E         Y  ++++ G   L   L  +L   I+ +LPT+  ++  + + L+LE            + T  T  +L+ ++    +++  I G+ +  D   L  GA+I++I +E +  EL  +  D K  +  I   IKN  G R   ++ +  F  +VKK++ KL++P    L+ V +++ + +S V + T  +  YP L    E  + T I +R  +TK  +  LI  EQ+ +   H
Sbjct:    6 MEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTE---YAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKL--QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLKEP---CLKCVDLVIQELISTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNH 490          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q7SXN5|DNM1L_DANRE (Dynamin-1-like protein OS=Danio rerio OX=7955 GN=dnm1l PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.066e-68
Identity = 207/694 (29.83%), Postives = 347/694 (50.00%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI-------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSG----ENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKA--LASVPNWKEFNFESVLGKN-----MNSEVES--RKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+             N    E+   F   +++KIY    EIRQ+++  T ++    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E+ +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L+ +   ++SS     E+ +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N    +  S         P  K       + G  +A        W+    +   G+      + S + +  +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK  +  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSEENGVDGEEWGKFLH-TKNKIYTDFDEIRQEIENETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIELQIRELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKSVADSIRDEHGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLSAQYQSLLSSYGEPVEDMSATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPTSV--------PRDK-------MAGGAQAEQEGGTGTWRGMLKKGDEGQGEEKTKLQSSIPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKPALLDDLLT 656          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q8K1M6|DNM1L_MOUSE (Dynamin-1-like protein OS=Mus musculus OX=10090 GN=Dnm1l PE=1 SV=2)

HSP 1 Score: 243.047 bits (619), Expect = 1.680e-68
Identity = 219/722 (30.33%), Postives = 357/722 (49.45%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLED-----------LQAF---------FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN--SECFY-----------HLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLC-GNIKALASVP----------------NWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED            Q++         F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+    C              L +E    G   + +   SA A     PP       +  L   N +   +VP                NW+    ++   + + +E +S+   I+  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKSSKVPSALAPASQEPPPAASAEADGKLIQDNRRETKNVPSAGGGIGDGGQEPTTGNWRGM-LKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 699          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|O00429|DNM1L_HUMAN (Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 5.848e-67
Identity = 213/716 (29.75%), Postives = 352/716 (49.16%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ--------------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN------HKQGENFEETI--NKSANAADILMPP---------------YIKQFLRNVHLCGNIKAL-------ASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +                F  +++K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N      ++        +  +KS+     L P                 I+   R      +            +  NW+    ++   + + +E +S+   I+  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVH-VSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGM-LKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 693          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|Q2KIA5|DNM1L_BOVIN (Dynamin-1-like protein OS=Bos taurus OX=9913 GN=DNM1L PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 4.801e-66
Identity = 215/728 (29.53%), Postives = 355/728 (48.76%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDA--------SLEDLQAFFSDSR------------------SKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN------HKQGENFEETI--NKSANAADILMPP---------------YIKQFLRNVH-------LCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++ A          E+  A + +SR                  +K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+      L   N      ++        +  +KS+     L P                 I++  R            G+     +  NW+    ++   + + +E +S+   I+  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVAPEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQESRRETKNAASGGGGVGDAVQEPTTGNWRGM-LKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKS 706          
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Match: sp|O35303|DNM1L_RAT (Dynamin-1-like protein OS=Rattus norvegicus OX=10116 GN=Dnm1l PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 7.747e-65
Identity = 181/524 (34.54%), Postives = 285/524 (54.39%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ---------AFFSDSR------------------SKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN 1515
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +         A + +SR                  +K+Y    EIRQ+++  T +I    +GV+  PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++I+R+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   +++S GE   + +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ KR   T  +V  L+  E   +   HP+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSPEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPD 513          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: Q5F469 (Uncharacterized protein OS=Gallus gallus OX=9031 GN=RCJMB04_2k14 PE=2 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 4.343e-72
Identity = 213/691 (30.82%), Postives = 358/691 (51.81%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSD--------------SRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +    D              +++KIY    EIRQ+++  T +I    +G++  PI L++  +N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ +R   T  +V  L+  E   +   HP+      L   N +     E+  N+ A      +P ++ +  +     G++   +   NW+    +S   + +++E +S+    +  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+L+  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSPEDGRKTAGDENEIDAEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISPEPIHLKIFSSNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILQFISNPNSIILAVTAANTDMATSEALKIAREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIE-----EQRRNRLARE----LPSFVPRD-KAAAGAGDVTQESGTGNWRGM-LKSSKAEEVSAEEKSKPAAALPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSLLLDDLLT 661          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A3Q3ACH0 (Uncharacterized protein OS=Gallus gallus OX=9031 GN=DNM1L PE=3 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 8.155e-72
Identity = 216/705 (30.64%), Postives = 360/705 (51.06%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSD---------------------------SRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETIN-KSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +    D                           +++KIY    EIRQ+++  T +I    +G++  PI L++  +N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ +R   T  +V  L+  E   +   HP+      L   N +  E FEET + +  N     +P  + +  +     G++   +   NW+    +S   + +++E +S+    +  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+L+  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSPEDGRKTAGDENDPATWKNPRHLSKEIDAEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISPEPIHLKIFSSNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILQFISNPNSIILAVTAANTDMATSEALKIAREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEDIEYFEETEHEQRRNRLARELPSSVPRD-KAAAGAGDVTQESGTGNWRGM-LKSSKAEEVSAEEKSKPAAALPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSLLLDDLLT 684          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: F1NPT0 (Uncharacterized protein OS=Gallus gallus OX=9031 GN=DNM1L PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 2.182e-71
Identity = 213/691 (30.82%), Postives = 357/691 (51.66%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSD--------------SRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNAL-------KYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +    D              +++KIY    EIRQ+++  T +I    +G++  PI L++  +N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ +R   T  +V  L+  E   +   HP+      L   N +     E+  N+ A      +P  + +  +     G++   +   NW+    +S   + +++E +S+    +  + +     N L       + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+L+  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSPEDGRKTAGDENEIDAEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISPEPIHLKIFSSNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILQFISNPNSIILAVTAANTDMATSEALKIAREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIE-----EQRRNRLARE----LPSSVPRD-KAAAGAGDVTQESGTGNWRGM-LKSSKAEEVSAEEKSKPAAALPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSLLLDDLLT 661          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A3P8YHR2 (Dynamin 1 like OS=Esox lucius OX=8010 GN=DNM1L PE=3 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 2.776e-71
Identity = 212/692 (30.64%), Postives = 348/692 (50.29%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSG----ENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN--SECFY---HLRKENHKQGENFEETI--NKSANAADILMPPYIKQFLRNVHLCGNIKALASVP--------NWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+            ++    D    F  +++KIY    EIRQ+++  T +I    +G+++ PI L++   N+  LTL+DLPG+ K     Q   I+ +I++L+   + +P +IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  A   E+ +L+K YP ++N++G K L   L   L   I+  LP    E+  R   L  +   ++SS     E+ +AT   +I +F   Y + I G   + +   L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVKK++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+    C     ++ +    +      T+  +KS     +  P    + L +V   G +KA  +VP        NW+    +   G   +      K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGKDMLPRGTGVVTRRPLILQLVHVDPGDGRKMKDDNGVQADEWGKFLHTKNKIYTDFNEIRQEIENETERISGTNKGISDEPIHLKIFSPNVVNLTLVDLPGITKVPVGDQPKDIEVQIRELILKHISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKSVADAIRDEHAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRECLP----ELKTRINVLAAQYQSLLSSYGQPVEDQSATLLQLITKFAAEYCHTIEGTAKYIETAELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPSLFVPEVSFELLVKKQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPITNEMVHNLVAIELAYINTKHPDFADACGVMNNNIEESRRNRMRELPATVPRDKSVVKGPVGQPSIPTEPLGSVDTEG-VKAPGAVPQGDQDGTGNWRGMLKKGDEGAPGSGPASPHKGHAVNLLDVPVPVA---RKLSSREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKS 667          
BLAST of Dynamin-1-like protein vs. TrEMBL
Match: A0A091VV78 (Dynamin-1-like OS=Nipponia nippon OX=128390 GN=Y956_04939 PE=3 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 3.216e-71
Identity = 213/693 (30.74%), Postives = 347/693 (50.07%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSD--------------SRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESLVTDKFTQEN---IVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN------HKQGENFEETINK---SANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+IVV+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++  S ED +    D              +++KIY    EIRQ+++  T +I    +G++  PI L++  +N+  LTL+DLPG+ K     Q   I+ +I++L+  F+ +P +IILA++AAN D+A S+A++IAR+ DP G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  +   E  +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N      E+ +AT   +I +F   Y N I G   + + + L  GA+I  I +E + + LES+  D     N   I+  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + I   +  ++ +R   T  +V  L+  E   +   HP+      L   N      ++        + +   +  A D+   P            GN + L      +E + E             +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+L+  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVH-VSAEDGRKTAGDENEIDAEEWGKFLHTKNKIYTDFDEIRQEIENETERISGNNKGISPEPIHLKIFSSNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILQFISNPNSIILAVTAANTDMATSEALKIAREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVADSIRDEYGFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGEPVEDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESV--DPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVPRDKAAPGAGDVSQEPG----------TGNWRGLLKPSKAEEVSAEEKSKPAAALPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSLLLDDLLT 661          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 246.514 bits (628), Expect = 6.319e-71
Identity = 210/702 (29.91%), Postives = 345/702 (49.15%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI-------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKAL----------ASVPNWK-------EFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+             N    E+   F   +++KIY    EIRQ+++  T ++    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P  IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  A   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   ++SS GE   + +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N    +  +      L  P  +    +     +  AL          A   NW+       E   E    +        +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+ +  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENGVDGEEWGKFLH-TKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPSAVPRDKSLKGPGGQSLSPSDQPQADGDALKAVGAQGDQEAGTGNWRGMLKKGEEGQPEDKFKQQGPLPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLT 679          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 243.047 bits (619), Expect = 9.379e-70
Identity = 208/702 (29.63%), Postives = 342/702 (48.72%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLIN--------DASLEDLQAF----------------FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWK-------EFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++         +   D  A+                F  +++KIY    EIRQ+++  T ++    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P  IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  A   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   ++SS GE   + +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L         N EE            +P       R+  +       A   NW+       E   E    +        +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+ +  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENDPNAWKNGRLYKGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGL------MNNNIEEQRRNRMRELPSAVP-------RDKAVGAQGDQEAGTGNWRGMLKKGEEGQPEDKFKQQGPLPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLT 667          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 241.506 bits (615), Expect = 5.112e-69
Identity = 210/713 (29.45%), Postives = 347/713 (48.67%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLIN--------DASLEDLQAF----------------FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKAL----------ASVPNWK-------EFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++         +   D  A+                F  +++KIY    EIRQ+++  T ++    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P  IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  A   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   ++SS GE   + +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N    +  +      L  P  +    +     +  AL          A   NW+       E   E    +        +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+ +  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENDPNAWKNGRLYKGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPSAVPRDKSLKGPGGQSLSPSDQPQADGDALKAVGAQGDQEAGTGNWRGMLKKGEEGQPEDKFKQQGPLPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLT 691          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: dnm1l (dynamin 1 like [Source:NCBI gene;Acc:103030788])

HSP 1 Score: 241.506 bits (615), Expect = 8.227e-69
Identity = 210/713 (29.45%), Postives = 347/713 (48.67%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLIN--------DASLEDLQAF----------------FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKEN-HKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKAL----------ASVPNWK-------EFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL++         +   D  A+                F  +++KIY    EIRQ+++  T ++    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P  IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K S+  A   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   ++SS GE   + +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK+++++L++PS   ++    L+++ +  +I+         +  +P L + I   + +++ KR   T  +V  L+  E   +   HP+      L   N  +Q  N    +  +      L  P  +    +     +  AL          A   NW+       E   E    +        +K   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+ +  D  T
Sbjct:    1 MEALIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVDPEDRRKTSDENDPNAWKNGRLYKGVDGEEWGKFLHTKNKIYTDFDEIRQEIEAETERVSGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPKDIEIQIRELILKYISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINTKKSVADAIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLSSYGEPVDDKSATLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDVLTAIRNATGPRPALFVPEVSFELLVKRQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRMRELPSAVPRDKSLKGPGGQSLSPSDQPQADGDALKAVGAQGDQEAGTGNWRGMLKKGEEGQPEDKFKQQGPLPASPQKGHAVNLLDVPVPVA---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSALLDDLLT 691          
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Match: si:dkey-32e23.4 (dynamin-1-like protein [Source:NCBI gene;Acc:103036512])

HSP 1 Score: 229.18 bits (583), Expect = 4.723e-65
Identity = 193/675 (28.59%), Postives = 336/675 (49.78%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQ-----------AFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSG----ENTNATF--VILEFIKNYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPS-------EDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVE-SRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME LI IIN+LQ      G E I  P+IVV+GSQSSGKSS+LE ++  D LP+ +   T  P+++QL+N   LE+ +             F   +++I+    EIR +++  T+++ +  +G++  PI L++   N+  LTL+DLPG+ K     Q   I+ ++Q+++ +F+ +P ++IL +S AN DLA SDA+++AR+ DP G R+L V++KLDLMD GTD  ++L    +   LG I +VNRSQ  +  + ++  A   E  +L+++YP ++++ G + L   L   L   I++ LP    E+  R   L+ +    +SS     E+ +AT   ++ +F  +Y N I G       + L  GA+I  I +E + + L+S+      T+ +I+  I+NATG R   +  E +F LLVK++I++L++PS        + LQ ++    Q  S    Q  ++ +P L + I   + T++ KR   T  +V  L+  E   +   HP                 +F +    SA+                     N +   S+   +++  E +  ++          +  +N  D  V  +   + ++ +E  + EVI+            ++K YF +V+KN   + PK +  FL+         EL+ ++YK
Sbjct:    1 METLIPIINRLQEVFLTVGAEIIQLPQIVVVGSQSSGKSSVLESLVGRDFLPRGSGIVTRRPLVLQLVNVPPLEERRKHEHGIKAEEWGTFLHCKNQIFTDFSEIRSEIEAETDRVTNN-KGISPEPIHLKIFSPNVLNLTLVDLPGITKVPVGDQPEDIETQVQEMILSFISNPNSLILCVSPANSDLATSDALKLAREVDPDGRRSLLVVSKLDLMDAGTDALEVLLGRVIPVRLGIIGVVNRSQHDLNTQKTVEDAARDEQAFLQRHYPSLASRCGSRYLARTLSRLLMHHIRDCLP----ELKTRVTVLSAQYQTRLSSYGQPVEDHSATLLQIVTKFASDYCNTIEGTARHIQTSELCGGARICYIFHETFGRTLQSIDPLGGLTELDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEELQRII----QHCSSYSTQELLR-FPKLHDSIVEVVTTLLRKRLPITNDMVHNLVQIELAYINTKHP-----------------DFTDAAQVSASV--------------------NSQQTESLDGGRKWKNEKIPSEDKGPVPGFGSPSKAVNLLDTAVPIS---RKLSTREQRDCEVIQ-----------RLIKCYFLIVRKNIQDSVPKTVMHFLVNFVKERLQSELVGQLYK 614          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.172 bits (570), Expect = 2.698e-63
Identity = 157/445 (35.28%), Postives = 247/445 (55.51%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAF--------------------------FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSI-QKIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENT----NATF--VILEFIKNYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPS 1305
            ME LI +INKLQ   N  G E+I  P+IVV+G+QSSGKSS+LE ++  D LP+     T  P+++QL++    E ++                            F  +++K+Y    EIRQ+++  T +I    +G++   I L++   ++  LTL+DLPG+ K     Q   I Q+I++L+  F+ +P +IILA++AAN DLA S+A++IAR+ D  G RTL VITKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K +++ A + E ++++K YP ++N++G K L   L   L   I++ LP    E+  R   +  +   ++    N     NAT   ++ +F   Y N I G     + + L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK++I++L++PS
Sbjct:    1 MEALIPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAMDILTGRVIPVKLGIIGVVNRSQLDINTKKTILDAMQDEQSFMQKKYPSLANRNGTKFLGKTLNRLLMHHIRDCLP----ELKTRVNVMAAQYQSLLGGYGNPVDDKNATLLQLVTKFAAEYCNTIEGTAKHIETSELCGGARICYIFHETFGRTLESVDPLGGLTTLDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPS 441          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.77 bits (408), Expect = 5.984e-43
Identity = 132/433 (30.48%), Postives = 226/433 (52.19%), Query Frame = 1
Query:  220 DILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXP---EISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMN----HMVSSGENTNATFVILEFIK----NYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESLVTD-KFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLI 1476
            D LP+ +   T  P+I+QL+     +   A F   + K +    E+R +++  T+++    +G++  PI L++   ++  LTLIDLPG+ K     Q   I+ +I++++  FV     +ILA+S AN DLANSDA++IA++ DP+G RT+ VITKLDLMD GTD RD+L +  +    G I +VNRSQK I  +   ++A           +P    ++++ G   L   L  +L   I++ LP +  ++  + + L++E            + T  T  +L+ ++    +++  I G+ +  D   L  GA+I++I +E +  EL  +  D K  +  I   I+N  G R   ++ +  F  +VKK+I+KL++P    +  VV  L   + +  E+ G   YP L +  +  + T I +R  +TK  V  LI
Sbjct:    2 DFLPRGSGIVTRRPLILQLM---FCKAEYAEFLHCKGKKFTDFEEVRAEIEAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKD-INAAMAAERKFFLSHPSYRHMADRMGTPYLQKTLNQQLTNHIRDTLPALRNKL--QGQMLSMEKEVEEYKNFRPDDPTRKTKALLQMVQQFAFDFEKRIEGSGDQIDTVELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIRNINGIRTGLFTPDLAFEAIVKKQIQKLKEPCLKCVDLVVGELTNVIRKCSEKLG--SYPRLRDDTDRIVTTYIREREGRTKDQVLLLI 426          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007915.1 (pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene:ENSPMAG00000007153.1 transcript:ENSPMAT00000007915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 2.901e-24
Identity = 95/313 (30.35%), Postives = 158/313 (50.48%), Query Frame = 1
Query:  622 IQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GE---NTNATF--VILEFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPS-------EDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN 1515
            ++  R  D  G RTL V++KLDLMD GTD  D+L    V   LG + +VNRSQ  I +  S+  +   E+ +L++ YP ++N+ G K L   L   L   I++ LP    E+  R   L  +   ++S  GE   + +AT   ++ +F   Y + I G +   + + L  GA+I  I +E + + LESL      T  +++  I+NATG R   +  E +F LLVK++I++L++P         + +Q +V    Q  S    Q  ++ +P L + I   + +++ KR   T  +V  L+  E   +   HP+
Sbjct:    1 VRACRPAD-AGRRTLAVVSKLDLMDAGTDATDVLLGRVVPVKLGIVGVVNRSQLDINKNKSVSDSLRDEDVFLQRKYPALANRSGTKNLAKTLNRLLMHHIRDCLP----ELKARVNMLVAQYQSLLSGYGEMVDDPSATLLSIVTKFASEYCHTIEGTSKHIETSELCGGARICYIFHETFGRTLESLHPLGGLTTMDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPGLRCVELVHEEMQRIV----QHCSNYSTQELLR-FPKLHDAIVEVVTSLLRKRLPFTNEMVHNLVAIELAYINTKHPD 303          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 100.908 bits (250), Expect = 2.139e-22
Identity = 126/509 (24.75%), Postives = 230/509 (45.19%), Query Frame = 1
Query:  142 IHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKI--------YIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQN-----SLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQH-GIK-----ALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGEN-TNATFVILEFIK----NYKNHIYGNNVFDPNV-LIRGAKISKILYEDYLKELESL--VTDKFTQE--NIVM-IIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEE 1575
            +  P + VIG QSSGKSS+LE +     LP+ +   T  P+ ++L         +  +      I         +G+  + Q   ELT    D   GV+++ I L++  +++P LTLIDLPG+ +     Q+  I+ +I+ L+   +   + I L +   NVD+A ++A+++A+  DP G RTL V+TK DLMD+GT+ R+ LR   +QN     S G + +  RSQ+ ++   +L  A         K +P   + H G K      L   L ++L   IK  LP + K++  +      E+    S GE+  +      +FI      Y + + G    +P+  L R   +  ++ E +   L+ L    D + +E  N++   I N +G     +     F  L +  +++L+KP+ + L      L+     + +    K  P  +  ++ ++   ++ +  K + ++  L   E      ++     + +  +E H+Q     E
Sbjct:   46 VGLPAVAVIGDQSSGKSSVLEALSGVQ-LPRGSGIVTRCPLALKLKRAPGPWHGRIKYRVQGRTINTKLDTPESVGDA-VLQAQSELTG---DDL-GVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTE-RNALR--ILQNQVFPLSKGYVLVKCRSQRDVEAHQTLAEA-SRVEAAFFKKHPVFCHVHNGGKLTTTTVLAAKLTEELVDNIKRTLPKLRKDLAEKLREACAELE---SQGESIPDDARAKQQFINARVMRYNDDVRGLARGEPSRNLPRNMMLYTLVREHFRTWLKDLKRAQDAWLEELDNLIREYIDNRSGRELPGFVSYHAFENLARVHVQRLEKPALNVLAVTCSKLSDVFMRLADDV-FKFLPEFNRLVKAKVGAQVQGQEQKARVLIVTLFRMES----MVYTQDMLYQNSLREEHQQDHEVTE 536          
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 81.6481 bits (200), Expect = 2.944e-16
Identity = 71/252 (28.17%), Postives = 123/252 (48.81%), Query Frame = 1
Query:   37 LHLDSSRILKYNLMEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPK-DAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGE----CEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSG----SIQKIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSL-GTIF 762
            +H    ++ + +L+E   E+++ L      Y  +    P +VV+G QSSGK+S+LE I    I P+   +  T SP+ + L   +      A F DS  +  + +      +R++++    +   +   V+   I L +KG  L  + L+DLPGVI     + SG    +   I  + + ++++P AIIL I   +VD   S    +    DP+G RT+ V+TK+DL +     ++L   N +Q  L G +F
Sbjct:  184 IHQRKVKMKQKSLIEMYSEVLDILSDYDANYNTQD-QLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTL---SEGPHHVAIFKDSSREFDLTKEDDLAALRKEIEIRMKKSVKEGHTVSAETISLSVKGPGLQRMVLVDLPGVIST---MTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVDLAE-----KNLASPNRIQQILDGKLF 423          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 192.586 bits (488), Expect = 1.374e-52
Identity = 163/542 (30.07%), Postives = 263/542 (48.52%), Query Frame = 1
Query:   79 EDLIEIINKLQACSNRYG---KEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLIN------------------------------------------DASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQK-IQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQH--GIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENT--NATFVILEFIKNYKNHIYGNNVFDPNV-------LIRGAKISKILYEDYLKELESLVTDKFTQ---ENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFV---SEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN 1515
            E LI  INKLQ      G   +  I  P+I V+GSQSSGKSS+LE I+  D LP+     T  P+++QLIN                                          + + E+   F      K Y  + EIR+++ + T+++     G++  PI L++   ++ TLTL+DLPG+ K     Q   I++ I+ ++  ++  P AIIL+++AAN DLANSD +++AR+ DP+G RT+ V+TK+DLMDQGTD  D+L    +    G I ++NR QK I+ K ++  A E E  + + +    S  H  G   L   L   L   I+  LP I  +I   +  L    N +++ G  T  +A+ V+L  I ++ N   G  + D          L  GA+IS + +E +   ++SL  D F Q    +I  I+ N++G+    +   + F +LVK++I + ++PS   L+ V ++ ++ V    ++I Q     YP L   I  +    ++     T   V  +I  EQ  +   HP+
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFD-EIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKI---EATLKKYQNELINLGPETMDSASSVVLSMITDFSNEYAG--ILDGEAKELSSQELSGGARISYVFHETFKNGVDSL--DPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPS---LRLVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPD 533          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 179.489 bits (454), Expect = 7.009e-48
Identity = 160/537 (29.80%), Postives = 263/537 (48.98%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLIN-----------DASLED------LQAFFSDSRSKIYIGE----------------------CEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQK-IQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXP---EISNQHGIKALINALIDKLRMEIKNNLPTI---LKEIIRRKEFLTLEMNHMVSSGENTNATFVIL------EFIKNYKNHIYGNNV-FDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG---IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN 1515
            +EDLI  +NKLQ      G + +  P + V+GSQSSGKSSILE ++  D LP+     T  P+++QL N           D S+        +  F + ++   Y G+                       +I+++++  T +I  K +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+K I+ L+  ++ +P  +ILA+S ANVDL NS+++++AR+ DP+G RT+ VITKLDLMD GT+  D+L        LG + +VNRSQ+ IQ   + V     +     + +P    IS + G + L   L   L   I++ LP I   L  +I + E    E+      G  TN +   L      +F  N+ + I G +   +   L  GA+I  I    +   L+S+  T   +  ++   I+N+TG R   +  E  F LLVK +I+ L +PS    Q  V L+ + + ++  + G   +  YP L + +   +  ++ +R   T+  V+ LI   +  +   HPN
Sbjct:    4 LEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKT-VEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTE---QELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPS----QRCVELVYEELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPN 532          
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 144.436 bits (363), Expect = 4.237e-36
Identity = 97/247 (39.27%), Postives = 144/247 (58.30%), Query Frame = 1
Query:   70 NLMEDLIEI---INKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEK 798
            NL + +IEI   +NK+ + S       +  P IVVIGSQSSGKSS+LE I+  + LPK +   T  PI + L+N  +  ++ A F   R        E+++ L EL N      + V+E PI L +K + +P L+L+DLPG I+ E   Q   ++ KI+ L E ++ +P  IILAISAA+VDLANS A++ ++  DPKG RT+ VITKLDL+D     R +L +     S+G + ++ ++   I  K
Sbjct:  186 NLTKQMIEIRTILNKVDSSSAH-----LTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRMLMEL-NMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKARSILNNKKYPLSMGYVGVITKTPSSINRK 424          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 225.328 bits (573), Expect = 9.091e-64
Identity = 193/692 (27.89%), Postives = 338/692 (48.84%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLIN----------------DASLEDLQA------FFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSI-QKIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSS-GENT--NATFV---ILEFIKNYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQT-GIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN----SECFYHLRKENHKQGENFEETIN-KSANAADILMPPYIKQFLR-------NVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKT 1995
            ME LI +INKLQ   N  G E+I  P+IVV+G+QSSGKSS+LE ++  D LP+ +   T  P+I+QL++                  + ED  A       F   + KI+     IR++++  T+++    +G++  PI L++    +  LTL+DLPGV K     Q   I Q+I+ L+  ++ +P +IILA++ AN+DLA S+A++IAR+ DP G RTL V TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  + S+ +A   E ++  + YP +++++G   L   L   L   I+N LP    E+  R   +T + +H++ S GE       ++   I  F   Y + I G  +  + + L  GA+I  I ++ + + L  +   +  +  +I+  I+NATG R   +  E +F LLVK++I +L++PS   ++ V   + + +    +Q   IK +P L   I   +  ++++R      +V+ L+  E   +   HP+    +     L         +    I+  +   + + MPP  +             +  G +  +  + + K  +    +G      V   +    N ++    + N  + + ++E  ++++I             ++K YF +V+K+   + PK I  FL+         EL++++YK+
Sbjct:    1 MEQLIPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAMDVLYGRVIPVKLGIIGVVNRSQLDINNRKSIENALRDEADFFARNYPTVASRNGTPYLAKTLNKLLMHHIRNCLP----ELKSRVNSMTSQYHHLLQSYGEPVMDKGPYLLQMITRFAATYCSIIEGTAHEIETSELCGGARICYIFHDIFGRTLTIMDAMEGLSTRDILTAIRNATGPRPALFVPEISFELLVKRQIRRLEEPSLRCIELVHEEMQRIIQHSFDQVMEIKRFPRLHESIVDVIINLLQRRLMPCNEMVENLVAIELAYINTNHPDFTDGASLVSSLVANQELVSASHPSPIHTATPEGSPVHMPPREENPAEKPPVPATGANTGGFMSWVPGIRSSKATDQTDDVGPKHMESVSELRCPYENVSELRCPYGN--RGLTEREQMDSDIIR-----------KLIKSYFVIVRKSIQDSVPKAIMAFLVNYVKERIQSELVEKLYKS 675          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 196.823 bits (499), Expect = 3.620e-55
Identity = 166/505 (32.87%), Postives = 272/505 (53.86%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEA-IHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXX--XXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNA------TFVILE----FIKNYKNHIYGN-NVFDPNVLIRGAKISKILYEDYLKELESLVTD-KFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKI--YPNLSNWIEIEMRTIIEK-RHNK--TKGIVKKLIICEQNDVFCIHPNSECF 1527
            MEDLI I+NK+Q      G  + I  P+I V+GSQS+GKSS+LE  +  D LP+ +   T  P+I+QL    S     A F   R+K +    E+++++   T+++    +G++  PI L++   ++ +LTL+DLPG+ K     Q   I+ +I+ ++  F+     +ILA+S AN DLANSDA++IAR+ DP+G RT+ VITKLDLMD+GTD RD+L +  +    G I +VNRSQ  I  +  + +A   E         Y  ++++ G + L   L  +L   IK+ LP +  ++  +   L LE    V   EN N       T  +++    F  +++  I G+ +  +   L  GAKI++I +E +  EL  +  D K  +  I+  IKN  G R   ++ +  F  +VK++I+KL+ P   A++ V +++ +  S VI++   ++  YP L + +E   R +I+  R N+  TK  V+  I  E   +   HP+   F
Sbjct:    6 MEDLIPIVNKIQDAFASIGYSSMIDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLQPSKSE---YAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEGTDARDILENRVLPLRRGYIGIVNRSQADIDGRKDIRAALAAERKFFLSNPSYRHMADKMGTQYLQKVLNQQLTNHIKDTLPALRSKL--QDNLLALEKE--VKGYENYNPRDLSVRTKALMQMMQTFSADFEKAIEGSGDSINTVELSGGAKINRIFHERFPYELVKMEFDEKQLRREIMFAIKNIHGIRVGLFTPDMAFEAIVKRQIDKLRSP---AIKCVDMVMTELTS-VIQKCATQMAKYPLLRDQVE---RIVIDHIRSNEVTTKEQVQTFIELELAYINTNHPDFVGF 496          
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 93.2041 bits (230), Expect = 1.133e-19
Identity = 63/193 (32.64%), Postives = 101/193 (52.33%), Query Frame = 1
Query:  145 HYPEIVVIGSQSSGKSSILERIIDCDILPK-DAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQI-RDKFQGVTETP--ILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQKIQQ----LVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQ 699
            H P +VV+G QS+GK+S+LE I    I P+   Q  T SP+++ L    +   +  F  +SR      E E++    E+  ++ R   QG T +P  I + +KG  L  + L+DLPG+I   G   +G  +  +     +   ++E+P AIIL I    +D   S+   +    DP+G RT+ V+TK+DL +Q
Sbjct:   28 HLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPN--HIAQFKGNSRQFDLTQEKELKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLPGII---GTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQ 215          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000013419.2 (dynamin-1-like protein [Source:NCBI gene;Acc:101168415])

HSP 1 Score: 246.899 bits (629), Expect = 2.216e-71
Identity = 211/690 (30.58%), Postives = 344/690 (49.86%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI---------NDASLEDLQAF--FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSG----ENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN--SECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKE---FNFESVLGKNMNSEVESRKTDI---INFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+         N+   +++Q +  F  ++SKI+    EIR ++++ T +I    +G++E PI L++    +  LTL+DLPG+ K     Q   I+ +I+ L+   + +P  IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K  +  A   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   ++SS     E+ +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +I+  I+NATG R   +  E +F LLVKK++++L++PS   ++    L+++ +  +I+         ++ +P L   I   + +++ KR   T  +V  L+  E   +   HP+    C             N EE            +P       R+       KA A+ P  ++    N+  +L K   +      T +   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+ +  D  T
Sbjct:    1 METLIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVDAGDARNNEDGGKEVQEWGKFLHTKSKIFTDFDEIRLEIEQETERISGNNKGISEEPIHLKIFSPFVVNLTLVDLPGITKVPVGDQPQDIEIQIRDLILKHISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKCVADAIRDEQAFLQKKYPSLANRNGTKYLAKTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLSSYGEPVEDASATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPSLFVPEISFELLVKKQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELQRFPKLHEAIVEVVTSLLRKRLPITNEMVHNLVAIELAYINTKHPDFADACGV--------MNNNIEEQRRNRMRELPAAVP-------RD-------KAPAAGPQGEQDGTGNWRGMLKKGEEAPASGPGTPLKGAVNLLDVPVPVA---RKLSSREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSGLLTDLLT 646          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: ENSORLT00000042041.1 (dynamin-1-like protein [Source:NCBI gene;Acc:101168415])

HSP 1 Score: 246.128 bits (627), Expect = 2.460e-70
Identity = 210/690 (30.43%), Postives = 342/690 (49.57%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI---------NDASLEDLQAF--FSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSG----ENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN--SECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKE---FNFESVLGKNMNSEVESRKTDI---INFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYKTLVAVDECT 2019
            ME LI +INKLQ   N  G + I  P+I V+G+QSSGKSS+LE ++  D+LP+     T  P+I+QL+         N+   +++Q +  F  ++SKI+    EIR ++++ T +I    +G++E PI L++    +  LTL+DLPG+ K     Q   I+ +I+ L+   + +P  IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I  K  +  A   E  +L+K YP ++N++G K L   L   L   I++ LP    E+  R   L  +   ++SS     E+ +AT   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +I+  I+NATG R   +  E +F LLVKK++++L++PS   ++    L+++ +  +I+         ++ +P L   I   + +++ KR   T  +V  L+  E   +   HP+    C             N EE            +P                KA A+ P  ++    N+  +L K   +      T +   +N  D  V      + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK+ +  D  T
Sbjct:    1 METLIPVINKLQDVFNTVGADIIQLPQIAVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVDAGDARNNEDGGKEVQEWGKFLHTKSKIFTDFDEIRLEIEQETERISGNNKGISEEPIHLKIFSPFVVNLTLVDLPGITKVPVGDQPQDIEIQIRDLILKHISNPNCIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGLIGVVNRSQLDINNKKCVADAIRDEQAFLQKKYPSLANRNGTKYLAKTLNRLLMHHIRDCLP----ELKTRINVLAAQYQSLLSSYGEPVEDASATLLQLITKFATEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTIDILTAIRNATGPRPSLFVPEISFELLVKKQVKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELQRFPKLHEAIVEVVTSLLRKRLPITNEMVHNLVAIELAYINTKHPDFADACGV--------MNNNIEEQRRNRMRELPAAVP--------------RDKAPAAGPQGEQDGTGNWRGMLKKGEEAPASGPGTPLKGAVNLLDVPVPVA---RKLSSREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDSLQSELVGQLYKSGLLTDLLT 646          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: DNM1L (dynamin-1-like protein [Source:NCBI gene;Acc:101160650])

HSP 1 Score: 236.884 bits (603), Expect = 1.952e-67
Identity = 203/697 (29.12%), Postives = 352/697 (50.50%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI-------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPN------------SECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALA------SVPNWKEFNFESVLGKN-----MNSEV--ESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME LI +INKLQ   N  G + +  P+IVV+G+QSSGKSS+LE ++  DILP+     T  P+I+QL+             N    E+   F   +++KIY    EIR +++  T +I    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I +K  +V +   E+ +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N   +  ++ N+T   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + +   + +++ KR   T  +V  L+  E   +   HP+             E   H  KE        +   + S  +     PP ++  +      G+  A A         +W+        G +     +++++    +++  +N  D  V  T   + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK
Sbjct:    1 MEALIPVINKLQDVFNTVGADIMQLPQIVVVGTQSSGKSSVLESLVGRDILPRGTGVVTRRPLILQLVHIDPEDRRKTNEENGIDGEEWGKFLH-TKNKIYTDFEEIRAEIEAETERISGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPRDIEIQIKELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINQKKLVVDSIRDEHAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGNPVDDKNSTLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTMDVLTAIRNATGPRPALFVPEISFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLIDAVVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACSLINNNLDEQRRHRLKEMPAGVPRDKSLKSPSGQSFSYTDPPALEGEVLKAPAGGSQSAPAGEQTEGGTGSWRGMLRRGDEGSSGDRVALHTQIPPSPQRSHAVNLLDVPVPVT---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDCLQSELVGQLYK 677          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: DNM1L (dynamin-1-like protein [Source:NCBI gene;Acc:101160650])

HSP 1 Score: 234.187 bits (596), Expect = 1.333e-66
Identity = 200/678 (29.50%), Postives = 344/678 (50.74%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLI-------------NDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHL------RKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME LI +INKLQ   N  G + +  P+IVV+G+QSSGKSS+LE ++  DILP+     T  P+I+QL+             N    E+   F   +++KIY    EIR +++  T +I    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I +K  +V +   E+ +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N   +  ++ N+T   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + +   + +++ KR   T  +V  L+  E   +   HP+      L       +  H+  E         A A      P  +Q        G+ + +  +    E +    +  +       +++  +N  D  V  T   + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK
Sbjct:    1 MEALIPVINKLQDVFNTVGADIMQLPQIVVVGTQSSGKSSVLESLVGRDILPRGTGVVTRRPLILQLVHIDPEDRRKTNEENGIDGEEWGKFLH-TKNKIYTDFEEIRAEIEAETERISGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPRDIEIQIKELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINQKKLVVDSIRDEHAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGNPVDDKNSTLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTMDVLTAIRNATGPRPALFVPEISFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLIDAVVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACSLINNNLDEQRRHRLKEMPAGVPRDKAPAGGSQSAPAGEQTEGGT---GSWRGM--LRRGDEGSSGDRVALHTQIPPSPQRSHAVNLLDVPVPVT---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDCLQSELVGQLYK 653          
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Match: DNM1L (dynamin-1-like protein [Source:NCBI gene;Acc:101160650])

HSP 1 Score: 229.565 bits (584), Expect = 5.820e-65
Identity = 198/671 (29.51%), Postives = 342/671 (50.97%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSK------IYIGECEIRQKLQELTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ-KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEI-IRRKEFLTLEMNHMVSSGENTNATF--VILEFIKNYKNHIYGNNVF-DPNVLIRGAKISKILYEDYLKELESL-VTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTG------IKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHL------RKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLI--------KELIKEMYK 1992
            ME LI +INKLQ   N  G + +  P+IVV+G+QSSGKSS+LE ++  DILP+     T  P+I+QL++    ED +    ++ +       IY    EIR +++  T +I    +G+++ PI L++   ++  LTL+DLPG+ K     Q   I+ +I++L+  ++ +P +IILA++AAN D+A S+A+++AR+ DP G RTL V+TKLDLMD GTD  D+L    +   LG I +VNRSQ  I +K  +V +   E+ +L+K YP ++N++G K L   L   L   I++ LP +   I +   ++ +L +N   +  ++ N+T   +I +F   Y N I G   + +   L  GA+I  I +E + + LES+      T  +++  I+NATG R   +  E +F LLVK++I++L++PS   ++    L+++ +  +I+         +  +P L + +   + +++ KR   T  +V  L+  E   +   HP+      L       +  H+  E         A A      P  +Q        G+ + +       E +    +  +       +++  +N  D  V  T   + ++ +E  + EVIE            ++K YF +V+KN   + PK +  FL+         EL+ ++YK
Sbjct:    1 MEALIPVINKLQDVFNTVGADIMQLPQIVVVGTQSSGKSSVLESLVGRDILPRGTGVVTRRPLILQLVH-IDPEDRRKTNEENGNVPFPLLFIYTDFEEIRAEIEAETERISGNNKGISDEPIHLKIFSPHVVNLTLVDLPGITKVPVGDQPRDIEIQIKELILKYISNPNSIILAVTAANTDMATSEALKVAREVDPDGRRTLAVVTKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINQKKLVVDSIRDEHAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSL-LNSYGNPVDDKNSTLLQLITKFAAEYCNTIEGTAKYIETAELCGGARICYIFHETFGRTLESVDPLGGLTTMDVLTAIRNATGPRPALFVPEISFELLVKRQIKRLEEPSLRCVE----LVHEEMQRIIQHCSNYSTQELLRFPKLIDAVVEVVTSLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACSLINNNLDEQRRHRLKEMPAGVPRDKAPAGGSQSAPAGEQTEGGT---GSWRGMLR--RGDEGSSGDRVALHTQIPPSPQRSHAVNLLDVPVPVT---RKLSAREQRDCEVIE-----------RLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDCLQSELVGQLYK 646          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000059031.1 (SMESG000059031.1)

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 482/496 (97.18%), Postives = 485/496 (97.78%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVT-------ETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQKIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRK 1542
            MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQ +        +TPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQKIQQLVE FVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYENNYLKKYYPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVS GENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVK+EIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRK
Sbjct:    1 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQVIININYNNEKTPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQKIQQLVETFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYENNYLKKYYPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSPGENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKREIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRK 496          

HSP 2 Score: 372.859 bits (956), Expect = 9.475e-117
Identity = 196/201 (97.51%), Postives = 199/201 (99.00%), Query Frame = 1
Query: 1534 LRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLIKELIKEMYKTLVAVDECTXXXXXXXXXXXXXXVTSTKDELRDLEEIERSLQSYFCSN 2136
            ++KENHKQGENFEETINKSANAADILMPPYIKQFLRNVH CGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQE NNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLIKELIKE+YKTLVAVDECTKEKLLKLDEKLSDKVTSTKDELRDLEEIERSLQSYFCSN
Sbjct:  692 VQKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHSCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQE-NNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLIKELIKEIYKTLVAVDECTKEKLLKLDEKLSDKVTSTKDELRDLEEIERSLQSYFCSN 891          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000059031.1 (SMESG000059031.1)

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 482/496 (97.18%), Postives = 485/496 (97.78%), Query Frame = 1
Query:   76 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQGVT-------ETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQKIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRK 1542
            MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQ +        +TPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQKIQQLVE FVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYENNYLKKYYPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVS GENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVK+EIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRK
Sbjct:    1 MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDILPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQELTNQIRDKFQVIININYNNEKTPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQKIQQLVETFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYENNYLKKYYPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSPGENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKREIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRK 496          

HSP 2 Score: 372.859 bits (956), Expect = 5.543e-117
Identity = 196/201 (97.51%), Postives = 199/201 (99.00%), Query Frame = 1
Query: 1534 LRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLIKELIKEMYKTLVAVDECTXXXXXXXXXXXXXXVTSTKDELRDLEEIERSLQSYFCSN 2136
            ++KENHKQGENFEETINKSANAADILMPPYIKQFLRNVH CGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQE NNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLIKELIKE+YKTLVAVDECTKEKLLKLDEKLSDKVTSTKDELRDLEEIERSLQSYFCSN
Sbjct:  663 VQKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHSCGNIKALASVPNWKEFNFESVLGKNMNSEVESRKTDIINFADKNVKFTNALKYMAKQE-NNNEVIEDWKEREVMVLCDMVKDYFDMVQKNTIYNFPKWIQTFLIKELIKEIYKTLVAVDECTKEKLLKLDEKLSDKVTSTKDELRDLEEIERSLQSYFCSN 862          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000059025.1 (SMESG000059025.1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 346/418 (82.78%), Postives = 369/418 (88.28%), Query Frame = 1
Query:  472 DLPGVIKNEGELQSGSIQKIQQLVEAFVESPQAIILAISAANV-DLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLG 1722
            D+P VI  + +  SG    +        ++P +  + +S  ++ DL++ +    +   D   FRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYE NYLKKYYPEISNQHGI+ALIN LIDKLR+EIKNNLPTILKEIIRRKEFLTLEMN MVS GENTNATFVILEFIKNYKNHIY    FDPNVLI GAKISKILYEDYLKE+ESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVK+EIEKLQKPSEDALQDVVILLNQFVSEVIEQT IKIYPNL NWI+IEMR IIEKRHNKTKG+VKKL+ICEQNDVFCIHPNSECFY+LRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVH CGNIKALASVPNWKEFNFESVLG
Sbjct:  120 DVPDVIITDDDPVSGEDINVPD------DAPISGDVPVSGEDMEDLSSKEDDDFSESGD--KFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYEKNYLKKYYPEISNQHGIQALINVLIDKLRIEIKNNLPTILKEIIRRKEFLTLEMNRMVSPGENTNATFVILEFIKNYKNHIYAKKAFDPNVLIGGAKISKILYEDYLKEVESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKREIEKLQKPSEDALQDVVILLNQFVSEVIEQTSIKIYPNLYNWIKIEMRKIIEKRHNKTKGLVKKLLICEQNDVFCIHPNSECFYYLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHSCGNIKALASVPNWKEFNFESVLG 529          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000059025.1 (SMESG000059025.1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 346/418 (82.78%), Postives = 369/418 (88.28%), Query Frame = 1
Query:  472 DLPGVIKNEGELQSGSIQKIQQLVEAFVESPQAIILAISAANV-DLANSDAIQIARKYDPKGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLG 1722
            D+P VI  + +  SG    +        ++P +  + +S  ++ DL++ +    +   D   FRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYE NYLKKYYPEISNQHGI+ALIN LIDKLR+EIKNNLPTILKEIIRRKEFLTLEMN MVS GENTNATFVILEFIKNYKNHIY    FDPNVLI GAKISKILYEDYLKE+ESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVK+EIEKLQKPSEDALQDVVILLNQFVSEVIEQT IKIYPNL NWI+IEMR IIEKRHNKTKG+VKKL+ICEQNDVFCIHPNSECFY+LRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVH CGNIKALASVPNWKEFNFESVLG
Sbjct:  100 DVPDVIITDDDPVSGEDINVPD------DAPISGDVPVSGEDMEDLSSKEDDDFSESGD--KFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYEKNYLKKYYPEISNQHGIQALINVLIDKLRIEIKNNLPTILKEIIRRKEFLTLEMNRMVSPGENTNATFVILEFIKNYKNHIYAKKAFDPNVLIGGAKISKILYEDYLKEVESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKREIEKLQKPSEDALQDVVILLNQFVSEVIEQTSIKIYPNLYNWIKIEMRKIIEKRHNKTKGLVKKLLICEQNDVFCIHPNSECFYYLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHSCGNIKALASVPNWKEFNFESVLG 509          
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Match: SMESG000059025.1 (SMESG000059025.1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 335/358 (93.58%), Postives = 344/358 (96.09%), Query Frame = 1
Query:  649 KGFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAXXXXXXXXXXXXPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEFLTLEMNHMVSSGENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKISKILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKKEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRTIIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLG 1722
            + FRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYE NYLKKYYPEISNQHGI+ALIN LIDKLR+EIKNNLPTILKEIIRRKEFLTLEMN MVS GENTNATFVILEFIKNYKNHIY    FDPNVLI GAKISKILYEDYLKE+ESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVK+EIEKLQKPSEDALQDVVILLNQFVSEVIEQT IKIYPNL NWI+IEMR IIEKRHNKTKG+VKKL+ICEQNDVFCIHPNSECFY+LRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVH CGNIKALASVPNWKEFNFESVLG
Sbjct:  402 RKFRTLNVITKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEYEKNYLKKYYPEISNQHGIQALINVLIDKLRIEIKNNLPTILKEIIRRKEFLTLEMNRMVSPGENTNATFVILEFIKNYKNHIYAKKAFDPNVLIGGAKISKILYEDYLKEVESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVKREIEKLQKPSEDALQDVVILLNQFVSEVIEQTSIKIYPNLYNWIKIEMRKIIEKRHNKTKGLVKKLLICEQNDVFCIHPNSECFYYLRKENHKQGENFEETINKSANAADILMPPYIKQFLRNVHSCGNIKALASVPNWKEFNFESVLG 759          
The following BLAST results are available for this feature:
BLAST of Dynamin-1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNM1L4.790e-7030.66dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L6.879e-7031.16dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L4.851e-6829.97dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L5.010e-6829.79dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
DNM1L1.218e-6729.75dynamin 1 like [Source:HGNC Symbol;Acc:HGNC:2973][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drp-14.206e-6428.36Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-14.206e-6428.36Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-14.206e-6428.36Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-17.258e-6428.11Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-17.258e-6428.11Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drp14.455e-6027.80gene:FBgn0026479 transcript:FBtr0077744[more]
Drp14.455e-6027.80gene:FBgn0026479 transcript:FBtr0335173[more]
shi4.155e-5430.93gene:FBgn0003392 transcript:FBtr0074122[more]
shi4.155e-5430.93gene:FBgn0003392 transcript:FBtr0074121[more]
shi4.155e-5430.93gene:FBgn0003392 transcript:FBtr0074119[more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l1.413e-6929.83dynamin 1-like [Source:NCBI gene;Acc:393896][more]
dnm1l7.848e-6929.45dynamin 1-like [Source:NCBI gene;Acc:393896][more]
si:dkey-32e23.44.022e-6128.49si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-4... [more]
si:dkey-32e23.44.022e-6128.49si:dkey-32e23.4 [Source:ZFIN;Acc:ZDB-GENE-081105-4... [more]
dnm2a2.581e-5831.82dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l1.095e-7230.54dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l1.137e-7230.07dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l1.204e-7230.60dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l1.701e-7230.86dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
dnm1l1.720e-7130.24dynamin 1-like [Source:NCBI gene;Acc:100494576][more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnm1l1.206e-7031.28dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm1l5.531e-7031.13dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm1l9.539e-6930.69dynamin 1-like [Source:MGI Symbol;Acc:MGI:1921256][more]
Dnm21.362e-5732.52dynamin 2 [Source:MGI Symbol;Acc:MGI:109547][more]
Dnm21.370e-5732.45dynamin 2 [Source:MGI Symbol;Acc:MGI:109547][more]
back to top
BLAST of Dynamin-1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SXN5|DNM1L_DANRE1.066e-6829.83Dynamin-1-like protein OS=Danio rerio OX=7955 GN=d... [more]
sp|Q8K1M6|DNM1L_MOUSE1.680e-6830.33Dynamin-1-like protein OS=Mus musculus OX=10090 GN... [more]
sp|O00429|DNM1L_HUMAN5.848e-6729.75Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=... [more]
sp|Q2KIA5|DNM1L_BOVIN4.801e-6629.53Dynamin-1-like protein OS=Bos taurus OX=9913 GN=DN... [more]
sp|O35303|DNM1L_RAT7.747e-6534.54Dynamin-1-like protein OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of Dynamin-1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5F4694.343e-7230.82Uncharacterized protein OS=Gallus gallus OX=9031 G... [more]
A0A3Q3ACH08.155e-7230.64Uncharacterized protein OS=Gallus gallus OX=9031 G... [more]
F1NPT02.182e-7130.82Uncharacterized protein OS=Gallus gallus OX=9031 G... [more]
A0A3P8YHR22.776e-7130.64Dynamin 1 like OS=Esox lucius OX=8010 GN=DNM1L PE=... [more]
A0A091VV783.216e-7130.74Dynamin-1-like OS=Nipponia nippon OX=128390 GN=Y95... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1l6.319e-7129.91dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
dnm1l9.379e-7029.63dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
dnm1l5.112e-6929.45dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
dnm1l8.227e-6929.45dynamin 1 like [Source:NCBI gene;Acc:103030788][more]
si:dkey-32e23.44.723e-6528.59dynamin-1-like protein [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002816.12.698e-6335.28pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
ENSPMAT00000006976.15.984e-4330.48pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
ENSPMAT00000007915.12.901e-2430.35pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene... [more]
mxb2.139e-2224.75myxovirus (influenza) resistance B [Source:NCBI ge... [more]
opa12.944e-1628.17OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
VPS11.374e-5230.07Dynamin-like GTPase required for vacuolar sorting;... [more]
DNM17.009e-4829.80Dynamin-related GTPase involved in mitochondrial o... [more]
MGM14.237e-3639.27Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO348959.091e-6427.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321913.620e-5532.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403591.133e-1932.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013419.22.216e-7130.58dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000042041.12.460e-7030.43dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
DNM1L1.952e-6729.12dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
DNM1L1.333e-6629.50dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
DNM1L5.820e-6529.51dynamin-1-like protein [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Dynamin-1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059031.19.475e-11797.18SMESG000059031.1[more]
SMESG000059031.15.543e-11797.18SMESG000059031.1[more]
SMESG000059025.10.000e+082.78SMESG000059025.1[more]
SMESG000059025.10.000e+082.78SMESG000059025.1[more]
SMESG000059025.10.000e+093.58SMESG000059025.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005617 ID=SMED30005617|Name=Dynamin-1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2205bp
TTTATTTAAAGTAAAAATAAAACGTATTTAGTTATACTCCATTTGGATAG
TTCACGCATTTTAAAATATAATTTGATGGAAGATTTGATTGAAATAATTA
ATAAATTACAAGCTTGCAGCAACAGATATGGAAAGGAAGCCATTCATTAT
CCCGAAATCGTTGTAATTGGATCTCAGAGCTCTGGAAAAAGTTCAATACT
TGAGAGGATCATAGATTGTGATATTTTACCGAAAGATGCTCAGTCCGCTA
CTTTATCTCCTATAATTATACAACTTATCAACGATGCGAGTCTAGAGGAT
TTGCAAGCTTTTTTTTCAGATTCAAGAAGCAAAATTTACATCGGGGAATG
TGAAATCCGACAAAAATTACAAGAGTTAACAAATCAAATTAGGGACAAGT
TTCAAGGTGTTACAGAAACTCCCATACTCCTACAATTGAAAGGAAATAAT
TTACCTACTTTGACTCTAATTGACCTACCTGGAGTTATTAAAAATGAAGG
AGAACTTCAATCGGGTTCCATTCAAAAGATTCAACAGCTCGTGGAGGCAT
TCGTTGAATCTCCCCAGGCTATAATATTAGCTATATCTGCAGCAAATGTG
GATCTCGCAAACAGTGATGCCATTCAAATCGCACGGAAATATGATCCGAA
AGGATTTCGAACATTAAATGTGATAACGAAATTGGATTTGATGGATCAAG
GAACTGATGGCCGAGATTTATTGAGAAGCAATTTTGTTCAAAACTCACTA
GGAACAATATTTCTTGTTAACAGAAGCCAGAAGTGTATTCAAGAAAAAGC
CTCATTGGTTTCTGCAAAAGAATACGAAAATAATTATTTAAAGAAGTATT
ACCCAGAAATATCAAATCAACATGGAATTAAAGCTTTGATAAATGCGCTT
ATAGATAAATTGCGGATGGAAATCAAAAACAATTTGCCAACCATATTAAA
AGAAATAATTAGAAGAAAGGAATTTCTGACTCTAGAAATGAACCATATGG
TGTCTTCTGGCGAGAATACAAATGCTACTTTTGTAATTTTGGAATTCATA
AAAAACTATAAAAATCATATTTATGGCAATAATGTTTTTGACCCAAATGT
ACTGATAAGAGGAGCCAAAATAAGCAAAATTCTCTATGAGGATTATTTGA
AAGAATTAGAAAGTCTAGTTACTGATAAGTTTACACAAGAGAACATTGTA
ATGATTATAAAAAATGCTACTGGAAATCGAAAGATGTCATATTCTATAGA
GAAAACATTTATACTTCTGGTTAAAAAAGAAATTGAAAAATTACAAAAAC
CAAGTGAAGATGCACTGCAAGACGTGGTGATATTGCTGAACCAATTTGTT
TCGGAGGTCATTGAACAGACGGGTATAAAGATTTATCCAAACCTTTCCAA
TTGGATCGAGATTGAGATGCGCACAATTATCGAAAAGCGTCATAACAAAA
CCAAAGGCATTGTTAAAAAATTGATAATTTGTGAACAAAACGACGTATTC
TGCATACATCCAAACAGTGAATGTTTTTATCATTTACGAAAGGAAAATCA
TAAACAAGGAGAAAATTTTGAGGAAACAATAAACAAGTCTGCGAATGCTG
CTGACATTCTTATGCCTCCATATATTAAACAATTTTTGCGAAACGTTCAT
TTGTGTGGCAATATAAAGGCGTTGGCATCGGTACCAAATTGGAAAGAATT
CAATTTTGAGTCTGTATTAGGGAAAAACATGAACTCAGAGGTCGAGTCCA
GGAAAACGGACATAATAAATTTTGCCGATAAAAATGTAAAATTCACGAAT
GCCCTCAAATATATGGCCAAACAAGAGAATAATAATAATGAAGTCATTGA
GGACTGGAAGGAAAGAGAAGTGATGGTTTTGTGTGACATGGTAAAAGATT
ATTTCGATATGGTACAGAAGAATACAATTTACAATTTTCCGAAATGGATT
CAGACATTTCTAATCAAGGAATTGATTAAGGAAATGTACAAAACTCTGGT
AGCAGTTGATGAATGTACCAAAGAAAAATTGCTGAAATTGGATGAAAAGC
TATCAGATAAAGTTACTAGCACTAAAGATGAATTACGGGACCTAGAAGAA
ATCGAAAGAAGTTTACAAAGCTATTTCTGTTCAAATTAATGACAAAATTA
TAAAATACTTTAAAACAATGTTTGGTATTTGGTTTTTGATTGTTGAAATT
GATTA
back to top

protein sequence of SMED30005617-orf-1

>SMED30005617-orf-1 ID=SMED30005617-orf-1|Name=SMED30005617-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=688bp
MEDLIEIINKLQACSNRYGKEAIHYPEIVVIGSQSSGKSSILERIIDCDI
LPKDAQSATLSPIIIQLINDASLEDLQAFFSDSRSKIYIGECEIRQKLQE
LTNQIRDKFQGVTETPILLQLKGNNLPTLTLIDLPGVIKNEGELQSGSIQ
KIQQLVEAFVESPQAIILAISAANVDLANSDAIQIARKYDPKGFRTLNVI
TKLDLMDQGTDGRDLLRSNFVQNSLGTIFLVNRSQKCIQEKASLVSAKEY
ENNYLKKYYPEISNQHGIKALINALIDKLRMEIKNNLPTILKEIIRRKEF
LTLEMNHMVSSGENTNATFVILEFIKNYKNHIYGNNVFDPNVLIRGAKIS
KILYEDYLKELESLVTDKFTQENIVMIIKNATGNRKMSYSIEKTFILLVK
KEIEKLQKPSEDALQDVVILLNQFVSEVIEQTGIKIYPNLSNWIEIEMRT
IIEKRHNKTKGIVKKLIICEQNDVFCIHPNSECFYHLRKENHKQGENFEE
TINKSANAADILMPPYIKQFLRNVHLCGNIKALASVPNWKEFNFESVLGK
NMNSEVESRKTDIINFADKNVKFTNALKYMAKQENNNNEVIEDWKEREVM
VLCDMVKDYFDMVQKNTIYNFPKWIQTFLIKELIKEMYKTLVAVDECTKE
KLLKLDEKLSDKVTSTKDELRDLEEIERSLQSYFCSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000120progenitor cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR001401Dynamin_GTPase
IPR003130GED
IPR000375Dynamin_central
IPR027417P-loop_NTPase
IPR030381G_DYNAMIN_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0000266mitochondrial fission
GO:0016559peroxisome fission