Secretory carrier-associated membrane protein

Overview
NameSecretory carrier-associated membrane protein
Smed IDSMED30005604
Length (bp)3362
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Secretory carrier-associated membrane protein (SMED30005604) t-SNE clustered cells

Violin plots show distribution of expression levels for Secretory carrier-associated membrane protein (SMED30005604) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Secretory carrier-associated membrane protein (SMED30005604) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Secretory carrier-associated membrane protein (SMED30005604) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005604

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30005604 SmedASXL_009869SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30005604 dd_Smed_v4_30011_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30005604 dd_Smed_v4_8659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005604 OX_Smed_1.0.03080ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP4 (secretory carrier membrane protein 4 [Source:HGNC Symbol;Acc:HGNC:30385])

HSP 1 Score: 54.299 bits (129), Expect = 7.025e-8
Identity = 30/83 (36.14%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            R+DSS  +  FF     Q  +  IQ IG S  G+CGWL+ +  F  +     +ML  AIM+S+      + + KVH +YR +G
Sbjct:   54 RADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAG 136          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP1 (secretory carrier membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:10563])

HSP 1 Score: 55.0694 bits (131), Expect = 3.945e-7
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q AV  +Q  G    G+CGW++ L     N   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  211 RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 293          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP1 (secretory carrier membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:10563])

HSP 1 Score: 54.299 bits (129), Expect = 5.581e-7
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q AV  +Q  G    G+CGW++ L     N   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  185 RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 267          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP4 (secretory carrier membrane protein 4 [Source:HGNC Symbol;Acc:HGNC:30385])

HSP 1 Score: 53.5286 bits (127), Expect = 5.597e-7
Identity = 30/83 (36.14%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            R+DSS  +  FF     Q  +  IQ IG S  G+CGWL+ +  F  +     +ML  AIM+S+      + + KVH +YR +G
Sbjct:   98 RADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAG 180          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP4 (secretory carrier membrane protein 4 [Source:HGNC Symbol;Acc:HGNC:30385])

HSP 1 Score: 53.5286 bits (127), Expect = 5.597e-7
Identity = 30/83 (36.14%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            R+DSS  +  FF     Q  +  IQ IG S  G+CGWL+ +  F  +     +ML  AIM+S+      + + KVH +YR +G
Sbjct:   98 RADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAG 180          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 51.9878 bits (123), Expect = 1.412e-6
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 2
Query: 2669 IQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            +Q +G+S   +CGW+N L+ F ++     +ML  AI +++ L G +  L KVH LYR +G
Sbjct:  233 VQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAG 291          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 51.2174 bits (121), Expect = 1.890e-6
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 2
Query: 2669 IQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            +Q +G+S   +CGW+N L+ F ++     +ML  AI +++ L G +  L KVH LYR +G
Sbjct:  167 VQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAG 225          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 48.9062 bits (115), Expect = 3.814e-6
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 2
Query: 2669 IQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            +Q +G+S   +CGW+N L+ F ++     +ML  AI +++ L G +  L KVH LYR +G
Sbjct:   77 VQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAG 135          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp5a (secretory carrier membrane protein 5a [Source:NCBI gene;Acc:324467])

HSP 1 Score: 56.9954 bits (136), Expect = 2.591e-8
Identity = 31/83 (37.35%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            +SDSS  +  FF     Q+ +  IQ +GI   G CGWL  +  F+ N  +  +ML   IM++ + +   + L+KVHN YR SG
Sbjct:   95 KSDSSFNFMAFFFVFMAQVVISIIQTVGIPGWGVCGWLATITFFSTNIGSAVVMLIPTIMFTAVAVLSFIALTKVHNFYRGSG 177          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp3 (secretory carrier membrane protein 3 [Source:ZFIN;Acc:ZDB-GENE-041114-33])

HSP 1 Score: 55.4546 bits (132), Expect = 1.756e-7
Identity = 38/126 (30.16%), Postives = 69/126 (54.76%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSGMIQSSVEMDNDE----AMSTESLRDIATISQKTSSGYAMNGPK 2965
            RSDSS  +F FF   F Q+ +  +  IGI   G  GW+  L A + ++  G+IM+  A++++  L   +V+L +VH++YR +   ++S E    E     +S +++R  AT +  +++  A   P+
Sbjct:  219 RSDSSFNFFAFFFVFFAQLVLYVMMTIGIPGWGFSGWIVSLAALSTSKAVGAIMMMNAVLFTAQLAMGIVLLKRVHSMYRQT---EASFEKAQAEFATGVLSNQAVRQAATNATVSAAQGAFTAPR 341          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp1 (secretory carrier membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1803])

HSP 1 Score: 54.6842 bits (130), Expect = 3.672e-7
Identity = 31/83 (37.35%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q  V  +Q IGI+  G+ GW++ L     +   G IM+ IA +++   +  L++  KVH LYR +G
Sbjct:  216 RSDSSFRFFVFFFVYICQFGVHVLQAIGITGWGASGWISALTGLNTSIPVGIIMILIAALFTASAVISLIMFKKVHALYRTTG 298          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp5b (secretory carrier membrane protein 5b [Source:ZFIN;Acc:ZDB-GENE-120215-76])

HSP 1 Score: 51.2174 bits (121), Expect = 2.006e-6
Identity = 31/90 (34.44%), Postives = 46/90 (51.11%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSGMIQSSVE 2869
            ++DSS  +  FF     Q+ +  IQ IGI   G CGWL  +  F  +     IML   +M++ + +   + L+KVHN YR SG   S  +
Sbjct:   95 KTDSSFYFMAFFFVFMAQLFIAIIQAIGIPGWGVCGWLGTISFFGTSIFASIIMLIPTLMFTAVSVISFLALTKVHNFYRGSGASMSKAQ 184          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp5 (secretory carrier membrane protein 5 gene 2 [Source:NCBI gene;Acc:779947])

HSP 1 Score: 52.373 bits (124), Expect = 1.393e-6
Identity = 29/83 (34.94%), Postives = 45/83 (54.22%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            ++DSS  +  FF T  GQ+ +  IQ +GI   G CGW+  +  F  +     +ML   IM++ + +   V L+KVH  YR +G
Sbjct:   98 KTDSSFNFMAFFFTFTGQLVISIIQAVGIPGWGVCGWIATISFFGTSIGAAVVMLIPTIMFTAVAVLSFVALTKVHRFYRGAG 180          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 52.373 bits (124), Expect = 2.591e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q  V  +Q  G    G+CGW++ L     +   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  213 RSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 295          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 52.373 bits (124), Expect = 2.659e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q  V  +Q  G    G+CGW++ L     +   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  213 RSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 295          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 51.9878 bits (123), Expect = 3.739e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q  V  +Q  G    G+CGW++ L     +   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  213 RSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 295          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp5 (secretory carrier membrane protein 5 gene 2 [Source:NCBI gene;Acc:779947])

HSP 1 Score: 50.0618 bits (118), Expect = 6.829e-6
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            ++DSS  +  FF T   Q+ +  IQ +GI   G CGW+  +  F  +     +MLF  I+++ + +   V L+KVH  YR +G
Sbjct:   98 KTDSSFNFMAFFFTFSAQLVISIIQAVGIPGWGVCGWIATVGFFGTSVGAAVVMLFPTILFTAVAVLSFVALTKVHRFYRGAG 180          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 55.4546 bits (132), Expect = 2.350e-7
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q AV  +Q  G    G+CGW++ L     N   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  211 RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 293          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 53.9138 bits (128), Expect = 4.483e-7
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q AV  +Q  G    G+CGW++ L     N   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  159 RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 241          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 53.9138 bits (128), Expect = 4.483e-7
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q AV  +Q  G    G+CGW++ L     N   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  159 RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 241          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp4 (secretory carrier membrane protein 4 [Source:MGI Symbol;Acc:MGI:1928947])

HSP 1 Score: 51.6026 bits (122), Expect = 1.851e-6
Identity = 38/129 (29.46%), Postives = 59/129 (45.74%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG--MIQSSVEMDND------------EAMSTESLRDIATISQKTSSG 2944
            R+DSS  +  FF     Q  +  IQ IG S  G+CGWL  +  F  +     +ML  AI++S+  +   V + KVH +YR +G  + ++  E                 + S  SL +  T+   +SSG
Sbjct:   98 RADSSFNFMTFFFIFGAQFVLTVIQAIGFSGWGACGWLAAVGFFGTSVGAAVVMLVPAILFSLSALVMAVTIVKVHRIYRGAGGSLQKAQTEWSAGTWRNPPSREAQFNSFSGNSLPEYPTVPSYSSSG 226          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp4 (secretory carrier membrane protein 4 [Source:MGI Symbol;Acc:MGI:1928947])

HSP 1 Score: 51.6026 bits (122), Expect = 1.851e-6
Identity = 38/129 (29.46%), Postives = 59/129 (45.74%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG--MIQSSVEMDND------------EAMSTESLRDIATISQKTSSG 2944
            R+DSS  +  FF     Q  +  IQ IG S  G+CGWL  +  F  +     +ML  AI++S+  +   V + KVH +YR +G  + ++  E                 + S  SL +  T+   +SSG
Sbjct:   98 RADSSFNFMTFFFIFGAQFVLTVIQAIGFSGWGACGWLAAVGFFGTSVGAAVVMLVPAILFSLSALVMAVTIVKVHRIYRGAGGSLQKAQTEWSAGTWRNPPSREAQFNSFSGNSLPEYPTVPSYSSSG 226          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q6P0C7|SCAM5_DANRE (Secretory carrier-associated membrane protein 5 OS=Danio rerio OX=7955 GN=scamp5 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.956e-7
Identity = 31/83 (37.35%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            +SDSS  +  FF     Q+ +  IQ +GI   G CGWL  +  F+ N  +  +ML   IM++ + +   + L+KVHN YR SG
Sbjct:   95 KSDSSFNFMAFFFVFMAQVVISIIQTVGIPGWGVCGWLATITFFSTNIGSAVVMLIPTIMFTAVAVLSFIALTKVHNFYRGSG 177          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q6GM42|SCM5B_XENLA (Secretory carrier-associated membrane protein 5B OS=Xenopus laevis OX=8355 GN=scamp5-b PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 5.077e-7
Identity = 31/90 (34.44%), Postives = 48/90 (53.33%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSGMIQSSVE 2869
            ++DSS  +  FF T  GQ+ +  IQ +GI   G CGW+  +  F  N  +  +ML   IM++ + +   V L+KVH  YR +G   S  +
Sbjct:   98 KTDSSFNFMAFFFTFTGQLVISIIQAVGIPGWGVCGWIASISFFGTNVGSAVVMLIPTIMFTAVAVLSFVALTKVHRFYRGAGGSMSKAQ 187          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q8K021|SCAM1_MOUSE (Secretory carrier-associated membrane protein 1 OS=Mus musculus OX=10090 GN=Scamp1 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.644e-6
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q AV  +Q  G    G+CGW++ L     N   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  211 RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 293          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|P56603|SCAM1_RAT (Secretory carrier-associated membrane protein 1 OS=Rattus norvegicus OX=10116 GN=Scamp1 PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.749e-6
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q AV  +Q  G    G+CGW++ L     N   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  211 RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 293          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O15126|SCAM1_HUMAN (Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 PE=1 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 1.894e-6
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q AV  +Q  G    G+CGW++ L     N   G +M+ IA +++   +  LV+  KVH LYR +G
Sbjct:  211 RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTG 293          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A183LFK4 (Secretory carrier-associated membrane protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS2579 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.399e-14
Identity = 44/95 (46.32%), Postives = 62/95 (65.26%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG--MIQSSVEMDN 2878
            RSDSS  Y LFF+   GQ  ++ IQC+GI +LGSCGW+NG++  + N   G +ML IA ++SIL      +L KVH  YR+SG  + ++ +EM N
Sbjct:  100 RSDSSANYLLFFLFFSGQTVIVLIQCLGIDYLGSCGWINGIKTISRNDGVGVLMLLIATIFSILAGFCSFLLFKVHRYYRSSGASLHKAKLEMAN 194          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: C1LED4 (Secretory carrier-associated membrane protein OS=Schistosoma japonicum OX=6182 GN=EWB00_008970 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.700e-14
Identity = 43/95 (45.26%), Postives = 61/95 (64.21%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG--MIQSSVEMDN 2878
            RSDSS  Y +FF+   GQ  +I IQC+GI +LGSCGW+NG++    +   G +ML IA ++SIL     ++L KVH  YR SG  + ++ +EM N
Sbjct:  204 RSDSSANYLIFFLFFSGQTIIILIQCLGIDYLGSCGWINGIKTLHHSDGVGVLMLLIATLFSILAGFCCLLLFKVHRHYRTSGASLQKAKLEMTN 298          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A4Z2CN86 (Secretory carrier-associated membrane protein OS=Schistosoma japonicum OX=6182 GN=EWB00_008970 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.206e-14
Identity = 43/95 (45.26%), Postives = 61/95 (64.21%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG--MIQSSVEMDN 2878
            RSDSS  Y +FF+   GQ  +I IQC+GI +LGSCGW+NG++    +   G +ML IA ++SIL     ++L KVH  YR SG  + ++ +EM N
Sbjct:  210 RSDSSANYLIFFLFFSGQTIIILIQCLGIDYLGSCGWINGIKTLHHSDGVGVLMLLIATLFSILAGFCCLLLFKVHRHYRTSGASLQKAKLEMTN 304          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A3Q0KL87 (Secretory carrier-associated membrane protein OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.808e-14
Identity = 44/95 (46.32%), Postives = 61/95 (64.21%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG--MIQSSVEMDN 2878
            RSDSS  Y +FF+   GQ  +I IQC+GI +LGSCGW+NG++    N   G +ML IA ++SIL      +L KVH  YR+SG  + ++ +EM N
Sbjct:  204 RSDSSANYLIFFLFFSGQTIIILIQCLGIDYLGSCGWINGIKTVNHNDGVGVLMLLIATIFSILAGFCSFLLFKVHKYYRSSGASLHKAKLEMAN 298          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: G4VML6 (Secretory carrier-associated membrane protein OS=Schistosoma mansoni OX=6183 GN=Smp_127650 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.260e-14
Identity = 44/95 (46.32%), Postives = 61/95 (64.21%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG--MIQSSVEMDN 2878
            RSDSS  Y +FF+   GQ  +I IQC+GI +LGSCGW+NG++    N   G +ML IA ++SIL      +L KVH  YR+SG  + ++ +EM N
Sbjct:  150 RSDSSANYLIFFLFFSGQTIIILIQCLGIDYLGSCGWINGIKTVNHNDGVGVLMLLIATIFSILAGFCSFLLFKVHKYYRSSGASLHKAKLEMAN 244          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp5a (secretory carrier-associated membrane protein 5 [Source:NCBI gene;Acc:103029914])

HSP 1 Score: 56.6102 bits (135), Expect = 2.694e-8
Identity = 31/92 (33.70%), Postives = 49/92 (53.26%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSGMIQSSVEMD 2875
            ++DSS  +  FF     Q+ +  IQ +GI   G CGWL  +  F+ N  +  +ML   IM++ + +   + L+KVHN YR SG   S  + +
Sbjct:   95 KTDSSFNFMAFFFVFMAQVVISIIQTVGIPGWGVCGWLATITFFSTNIGSAVVMLIPTIMFTAVAVLSFIALTKVHNFYRGSGGSMSKAQQE 186          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:103025528])

HSP 1 Score: 54.6842 bits (130), Expect = 2.725e-7
Identity = 31/83 (37.35%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q  V  +Q IGI+  G+ GW++ L     +   G IM+ IA +++   +  L++  KVH LYR +G
Sbjct:  216 RSDSSFRFFVFFFVYICQFGVHVLQAIGIAGWGASGWISALTGLNTSIPVGIIMILIAALFTASAVISLIMFKKVHGLYRTTG 298          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp3 (secretory carrier membrane protein 3 [Source:NCBI gene;Acc:103021636])

HSP 1 Score: 53.1434 bits (126), Expect = 8.642e-7
Identity = 34/82 (41.46%), Postives = 46/82 (56.10%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNS 2845
            RSDSS  +F FF   F Q+ V  I  IGI   G  GW+ GL A   N   G IML  A++++      +V+L KVH++YR +
Sbjct:  217 RSDSSFNFFAFFFIFFAQVVVYVIMTIGIPGWGFSGWIVGLYALKKNVAVGVIMLLNAVLFTAQAAMGVVMLKKVHSMYRQT 298          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: SCAMP5 (secretory carrier membrane protein 5 [Source:HGNC Symbol;Acc:HGNC:30386])

HSP 1 Score: 71.2478 bits (173), Expect = 4.118e-14
Identity = 36/83 (43.37%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS  Y LFF T  GQ+ +  IQ +GI   G CGW+  +  F  N   G +MLF  IM++ L +   + L KVH+ YR  G
Sbjct:   98 RSDSSFNYMLFFFTFSGQVVLNIIQAVGIPGWGVCGWIATISYFGTNIGVGVVMLFPTIMFTGLAVISFLALIKVHSFYRGGG 180          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: scamp1 (secretory carrier membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1803])

HSP 1 Score: 53.5286 bits (127), Expect = 1.186e-7
Identity = 35/83 (42.17%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS  +FLFF   F Q  V  +Q IGI   G+CGW+  LEA   +   G I++ +A  ++   +  +V+L KVH+LYR +G
Sbjct:  212 RSDSSFNFFLFFFIFFCQFVVHVMQSIGIPGWGNCGWIASLEALNHSIGVGIILMLLAAFFTGSAVLSVVMLKKVHSLYRQTG 294          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Nematostella
Match: EDO31962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWE3])

HSP 1 Score: 49.2914 bits (116), Expect = 6.076e-6
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIG---HLVVLSKVHNLYRNSG 2848
            ++DSS  Y +FF+  F  I++     +G+   GSCG++   + +       SIM+FI    ++LL G     +++ KVH +YR +G
Sbjct:  223 KNDSSFSYIIFFLIFFLHISINIYYTLGMPGGGSCGFITATDTWHGTNKAVSIMMFICA--AMLLAGVGIDCILIVKVHRIYRQAG 306          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: SCAMP1 (secretory carrier-associated membrane protein 1 [Source:NCBI gene;Acc:101157947])

HSP 1 Score: 65.4698 bits (158), Expect = 1.150e-10
Identity = 35/83 (42.17%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q  V  +Q IGI+  G+CGW+  L     +   G IML IA +++ L +G L++  KVH LYR +G
Sbjct:  220 RSDSSFRFFVFFFIYICQFGVHVLQAIGITGWGTCGWIAALTGLNTSIPVGIIMLLIAALFTALAVGSLIMFKKVHALYRTTG 302          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: SCAMP1 (secretory carrier-associated membrane protein 1 [Source:NCBI gene;Acc:101157947])

HSP 1 Score: 64.6994 bits (156), Expect = 1.604e-10
Identity = 35/83 (42.17%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q  V  +Q IGI+  G+CGW+  L     +   G IML IA +++ L +G L++  KVH LYR +G
Sbjct:  187 RSDSSFRFFVFFFIYICQFGVHVLQAIGITGWGTCGWIAALTGLNTSIPVGIIMLLIAALFTALAVGSLIMFKKVHALYRTTG 269          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:101169127])

HSP 1 Score: 58.151 bits (139), Expect = 2.166e-8
Identity = 32/83 (38.55%), Postives = 50/83 (60.24%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            RSDSS ++F+FF     Q  +  IQCIGIS  G+ GW++ L     +   G IM+ +A +++ L +  L++  K+H LYR +G
Sbjct:  215 RSDSSFRFFVFFFVYVCQFGIYVIQCIGISGWGASGWISALMGLNTSIPVGIIMILVAALFTSLAVMSLIMFKKIHALYRTTG 297          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp5a (secretory carrier-associated membrane protein 5 [Source:NCBI gene;Acc:101171075])

HSP 1 Score: 56.225 bits (134), Expect = 3.991e-8
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSG 2848
            ++DSS  +  FF     Q+ +  IQ +GI   G CGWL  +  F+ N  +  +ML   +M++ +    ++VL+KVHN YR SG
Sbjct:   95 KTDSSFNFMAFFFVFMAQVVISIIQAVGIPGWGVCGWLATITFFSTNIGSAVVMLIPTVMFTAVAALSVIVLTKVHNFYRGSG 177          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000014496.1 (SMESG000014496.1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.172e-15
Identity = 53/217 (24.42%), Postives = 94/217 (43.32%), Query Frame = 2
Query: 1508 DIGVTFKEKAHNLFLRIYILKISNKFSEDKIHQ---LKPNEIY-KLKLYRKWQLKITYLTERIAESELIKGMPALISCKAFGGFPHKYVEFYGIEKLNVTNRTLDRMNNILTISFIPQLSDYGETIGCKVGADRFTTRLRVYYPRKKLIVIPNLRREIEIHNFYFCSFAGKFTASFARWNFIKGPPGWERYLKIL-NGNVLHAFDAPQSENFWEFSC 2143
            +I + FK  AHN +L I+     NKF   K  +   L    +Y K++L+   QL ++     +   E+I     + SC+AFGG P +  +F     LNV  +  ++  N + ++    LSD+     C  G    T  +R+++    L + P +++    ++   C     +      W  I+GPP  +R+      G+ +H        + W F C
Sbjct:  109 NISIMFKRGAHNKYLEIFYFSAPNKFQRRKYLKNLSLAKRLLYQKIELFMPSQLNLSMYPLNVDRKEIIINDMVMASCRAFGGIPQEKPKFEDHVHLNVMEKIYNKTTNEIRMNLRASLSDHLTNFSCSAGNVTETYTIRIHHHPTALYIQPIIKKRFRSNSTIICFTKDGYPDPEINWQLIEGPPNADRFYNFPGKGDQIHINSNSPVGSKWTFKC 325          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000010460.1 (SMESG000010460.1)

HSP 1 Score: 79.337 bits (194), Expect = 3.829e-15
Identity = 67/253 (26.48%), Postives = 111/253 (43.87%), Query Frame = 2
Query: 1424 PNFNNNGEKLLCGPYFDVVSAKFLNNGY--DIGVTFKEKAHNLFLRIYILKISNKFSE-------DKIHQLKPNEIYKLKLYRKWQLKITYLTERIAESELIKGMPALISCKAFGGFPHKYVEFYGIEKLNVTNRTLDRMNNILT---ISFIPQLSDYGETIGCKVGADRFTTRLRVYYPRKKLIVIPNLRREIEIHNFYFCSFAGKFTASFARWNFIKGPPGWERYLKIL-NGNVLHAFDAPQSENFWEFSC 2143
            P F ++  K + G YF+V    +  N Y  ++ V F E A+    ++   + S++          DK  Q K   +  + L+  W+L++   T    E  L      ++ CKA GGFP   V F G+E L+ T    ++ +NI T    +F  Q+  + + IGC+ G D F   L++++    +  +P +   +      +C          ARW ++ GP   E Y  I  NG+VLH        + W F C
Sbjct:   75 PGFQSSLPKRISGEYFNV--KNYTINPYLIEVVVKFHEIANKAQFQMIFFESSSRDHRMNVMNNIDKFPQYKFGPL-NISLWLHWKLELIQKTLDHREDGLTANSTGILICKASGGFPFSRVRFIGLESLSGT--LTEKSDNIATEIQFTFHSQIQHHMKKIGCQAGKDVFHDTLKIFHHPTSVKFVPAVDGFVRNGTSVYCYPGNGHPTPTARWVWVSGPKNSELYFLISKNGSVLHMNKNAPLGSKWIFEC 322          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000013579.1 (SMESG000013579.1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.091e-14
Identity = 51/193 (26.42%), Postives = 87/193 (45.08%), Query Frame = 2
Query: 1508 DIGVTFKEKAHNLFLRIYILKISNKFSEDKIHQLKPNEIYK------LKLYRKWQLKITYLTERIAESELIKGMPALISCKAFGGFPHKYVEFYGIEKLNVTNRTLDRMNNILTISFIPQLSDYGETIGCKVGADRFTTRLRVYYPRKKLIVIPNLRREIEIHNFYFCSFAGKFTASFARWNFIKGPPGWERY 2068
            +I + FK  AHN +L I+    SNKF   K   LK   + K      ++L+    L I+ L  ++   E+I     + SC+AFGG P +   F     LNVT R  ++  N + ++F   L+D+    GC  G    T  +R+Y+   ++ + P++   ++ +    C     +      +  I+GP     Y
Sbjct:  108 NISIIFKRGAHNKYLEIFYFSASNKFQRRKY--LKNLSLAKRLFHELIELFIPPGLAISVLPIKVDRKEIIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRISLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANRVIQCYAKNGYAQPSGHFQLIEGPSNASLY 298          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000064285.1 (SMESG000064285.1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.338e-14
Identity = 44/105 (41.90%), Postives = 64/105 (60.95%), Query Frame = 2
Query: 2600 RSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAFAINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSGMIQSSVEMDNDEAMSTESLRDI 2914
            R DSS  YF+FFI +  QI +  IQ +GI WLGSCG++N L+ F  +  TG IM FI + +S L    L++L KV+ +YR++  I    + DN +  ST  L+ +
Sbjct:  170 RWDSSTNYFMFFIIICCQIVITGIQMLGIDWLGSCGFINSLKMFRKDILTGCIMFFIGLWFSALFTLFLILLFKVNYIYRHA--IVPDAQADNSK-FSTNILKGV 271          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000013579.1 (SMESG000013579.1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.610e-14
Identity = 51/193 (26.42%), Postives = 87/193 (45.08%), Query Frame = 2
Query: 1508 DIGVTFKEKAHNLFLRIYILKISNKFSEDKIHQLKPNEIYK------LKLYRKWQLKITYLTERIAESELIKGMPALISCKAFGGFPHKYVEFYGIEKLNVTNRTLDRMNNILTISFIPQLSDYGETIGCKVGADRFTTRLRVYYPRKKLIVIPNLRREIEIHNFYFCSFAGKFTASFARWNFIKGPPGWERY 2068
            +I + FK  AHN +L I+    SNKF   K   LK   + K      ++L+    L I+ L  ++   E+I     + SC+AFGG P +   F     LNVT R  ++  N + ++F   L+D+    GC  G    T  +R+Y+   ++ + P++   ++ +    C     +      +  I+GP     Y
Sbjct:  108 NISIIFKRGAHNKYLEIFYFSASNKFQRRKY--LKNLSLAKRLFHELIELFIPPGLAISVLPIKVDRKEIIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRISLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANRVIQCYAKNGYAQPSGHFQLIEGPSNASLY 298          
The following BLAST results are available for this feature:
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCAMP47.025e-836.14secretory carrier membrane protein 4 [Source:HGNC ... [more]
SCAMP13.945e-738.55secretory carrier membrane protein 1 [Source:HGNC ... [more]
SCAMP15.581e-738.55secretory carrier membrane protein 1 [Source:HGNC ... [more]
SCAMP45.597e-736.14secretory carrier membrane protein 4 [Source:HGNC ... [more]
SCAMP45.597e-736.14secretory carrier membrane protein 4 [Source:HGNC ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
scm-11.412e-638.33Secretory carrier-associated membrane protein [So... [more]
scm-11.890e-638.33Secretory carrier-associated membrane protein [So... [more]
scm-13.814e-638.33Secretory carrier-associated membrane protein [So... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
scamp5a2.591e-837.35secretory carrier membrane protein 5a [Source:NCBI... [more]
scamp31.756e-730.16secretory carrier membrane protein 3 [Source:ZFIN;... [more]
scamp13.672e-737.35secretory carrier membrane protein 1 [Source:ZFIN;... [more]
scamp5b2.006e-634.44secretory carrier membrane protein 5b [Source:ZFIN... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp51.393e-634.94secretory carrier membrane protein 5 gene 2 [Sourc... [more]
scamp12.591e-636.14secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp12.659e-636.14secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp13.739e-636.14secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp56.829e-633.73secretory carrier membrane protein 5 gene 2 [Sourc... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scamp12.350e-738.55secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp14.483e-738.55secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp14.483e-738.55secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp41.851e-629.46secretory carrier membrane protein 4 [Source:MGI S... [more]
Scamp41.851e-629.46secretory carrier membrane protein 4 [Source:MGI S... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P0C7|SCAM5_DANRE1.956e-737.35Secretory carrier-associated membrane protein 5 OS... [more]
sp|Q6GM42|SCM5B_XENLA5.077e-734.44Secretory carrier-associated membrane protein 5B O... [more]
sp|Q8K021|SCAM1_MOUSE1.644e-638.55Secretory carrier-associated membrane protein 1 OS... [more]
sp|P56603|SCAM1_RAT1.749e-638.55Secretory carrier-associated membrane protein 1 OS... [more]
sp|O15126|SCAM1_HUMAN1.894e-638.55Secretory carrier-associated membrane protein 1 OS... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183LFK41.399e-1446.32Secretory carrier-associated membrane protein OS=S... [more]
C1LED42.700e-1445.26Secretory carrier-associated membrane protein OS=S... [more]
A0A4Z2CN863.206e-1445.26Secretory carrier-associated membrane protein OS=S... [more]
A0A3Q0KL873.808e-1446.32Secretory carrier-associated membrane protein OS=S... [more]
G4VML64.260e-1446.32Secretory carrier-associated membrane protein OS=S... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
scamp5a2.694e-833.70secretory carrier-associated membrane protein 5 [S... [more]
scamp12.725e-737.35secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp38.642e-741.46secretory carrier membrane protein 3 [Source:NCBI ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SCAMP54.118e-1443.37secretory carrier membrane protein 5 [Source:HGNC ... [more]
scamp11.186e-742.17secretory carrier membrane protein 1 [Source:ZFIN;... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319626.076e-631.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SCAMP11.150e-1042.17secretory carrier-associated membrane protein 1 [S... [more]
SCAMP11.604e-1042.17secretory carrier-associated membrane protein 1 [S... [more]
scamp12.166e-838.55secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp5a3.991e-836.14secretory carrier-associated membrane protein 5 [S... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014496.13.172e-1524.42SMESG000014496.1[more]
SMESG000010460.13.829e-1526.48SMESG000010460.1[more]
SMESG000013579.12.091e-1426.42SMESG000013579.1[more]
SMESG000064285.16.338e-1441.90SMESG000064285.1[more]
SMESG000013579.17.610e-1426.42SMESG000013579.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005604 ID=SMED30005604|Name=Secretory carrier-associated membrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3362bp
TAAAATACATTTAAACTTTTTTGATTTATAAAATCTTAAAACTAATATTA
ATAATTAATTTACATTAATATTATATAAATAATAAAAAAGTTAATGAATT
TATGTTATAAAAATACAAACTCTTGTTTGTTGATTTTAATATTGCAATTG
ATCAACGCCTATACACATGTTTCGACAGAATAACAACTATAATATAATGA
ACAATTAATAAACTAATATTATAGAGATATAAGTGGTGACAGAAGAAATA
ATAAATGTAACATGCACCATATTAGTAAAAATTGCATAGAAACTTGATAT
GTGGAATTGTTTGAATGAATAATAACTATAATATTATTATTATGTTATAA
ATTTTAGTTCAAAATTAATCTGAAATATATATAAATAAATCCGAAAAATC
TCATGATTCCTCAAAAGCCATTAAAATAACTGTAAGTAAATTCAGTTAGT
GTTAATTTTAACTGTGGATTAAGTCATTGAGTTCTTGTGAATCTGTTATA
TGGAGTTTTTTTTACAGCAAATTTCAATTAGGTAAAACTTCTATAATACA
AGTTAATGCCAAAAGAAATTTAATAACTATCGTATATACTCGCGTATACA
CCGATTAATTTTGGATTAATTTTTTTGTTGATGGGTCAGCTTATATGGTT
CAATAATTAATTGATAAAAAATGTTTACGTTCAAAGAAAATGTTTTGCTA
ATCTCTTCTGAAAAATAATTTTTGTCATGTTAAAGTGTTATGGTTCTTAG
TGAATTGCATAATTTGAAATAAATTATATATTACCCAAAAAATAATTTTT
AATAGGAAAGGCTTATACGCGGGTCATCTATTTTGGATATTTTTTTCAAC
CGAATTTGGGGGATCGGCTTATATGCGAGTATATACAGTAATTATTTCCG
TAATTTTTTTCCCGCTTGACATTTCCGTATATCAAATTTGAGTTTCCTGA
TTTATATTCTTCGAATTTCCTTTGATTTCGCTGTATCCCAATTTGTCCTG
TCTGATTAAAGGTAAAACAACATCCATTTCGGGCAACGCAGTTTCAGCCA
ATCGCGTTCAAGTGCGCATTTCGAAAAAAAAGATATTTTTGAGGCAAAGA
AAAAATTTTTTAGAGCAAAAAAATTTTAAGAGAAATCTGTTTATTTAATA
AAAAAATTAGTTATTTATTTTACCGCAATTTCTTTATATTTTGTTTTAAT
TAAAGGAATTTATTATATAATAATATTAAAAATGAAGATTTGTTATTTTT
TGATTGCAGCAATATTAAATTCAATTACTGCATTAAGTTTCGGTCTGAAA
ACCCTCACAGCGAAGATCCAAGAAGTCACCAACTTGAGACTGGATGAGGT
AGCATATAACAATTCGTATTTACTTATTATGTCAATTAAAACAAACATCA
GATTAAGATATGAAATGGAATTGCCAAATTTTAACAATAATGGGGAGAAA
CTTTTATGCGGTCCCTATTTTGATGTGGTTTCCGCCAAGTTCCTCAACAA
CGGCTACGATATTGGGGTAACGTTTAAGGAGAAAGCTCACAATCTCTTTC
TGCGGATTTATATTTTGAAAATTTCCAATAAGTTTTCGGAGGATAAAATA
CACCAGTTAAAACCAAATGAGATTTACAAATTGAAACTATATAGAAAATG
GCAACTGAAAATCACGTACTTGACGGAGAGAATCGCTGAAAGCGAATTGA
TCAAAGGAATGCCAGCCTTAATCTCTTGCAAGGCTTTCGGAGGGTTTCCG
CACAAATATGTGGAGTTTTACGGAATTGAGAAACTAAATGTCACCAACAG
AACACTCGACCGCATGAATAACATCCTCACCATATCATTCATTCCTCAGT
TATCTGATTATGGAGAAACCATCGGCTGCAAGGTCGGCGCCGACCGTTTC
ACAACGAGACTCAGAGTTTATTACCCAAGGAAAAAGCTTATAGTAATTCC
AAATTTGAGAAGAGAAATTGAAATTCACAACTTTTACTTCTGCAGCTTTG
CCGGAAAGTTTACCGCATCGTTTGCCAGATGGAATTTCATCAAGGGTCCA
CCTGGCTGGGAGAGATATTTAAAAATCTTGAATGGAAATGTTCTGCACGC
TTTTGATGCTCCGCAATCGGAGAATTTTTGGGAATTTTCTTGTGAAGAAG
CTGTGGAGAAAGATAAATTAAAATTTACGCTCCCTTCGAAATCGTTGAAG
TTCAAATTTTCGATCAAATCAAGATCAGCTACAACGTCAAAAGGTTTCTC
TCAAAAGGTAAGTCAAGGCGGGAGACTTTTCACATCAACTCTAAATCCTA
AAATCTTCAAATCTTCAAAGAAGTCAACTAAGAGCGGCAGGGAGTTTTCG
ATTCGGAAGGGTTTTATTTGCTACTTCATTTTCATTTCTGTTCTGCTAGC
CGGAATAATTACATTAATTTTCAGTTTGGTGGCGTACAAAACGTATAATA
AAAGGGTTGCTAGTAGCACCGAGGAAAATAGTAGGAAAATAAACACGATA
GAAGATGTTATATTTTCGCCGCCAGGGAGAAGGAAATTGAGTGAAATAAC
AAAGCCGATGAAAGATTTGAAATTCGATCTGGAAACTATTGTCGAAGAAA
GGTCCGACAGTTCAATTCAATACTTTCTGTTTTTCATAACAATGTTTGGC
CAGATCGCCGTTATTGCCATTCAGTGCATTGGAATCAGTTGGCTGGGATC
TTGCGGATGGCTGAATGGGCTTGAGGCATTTGCCATTAATCGCACAACCG
GTTCAATTATGCTATTTATAGCGATCATGTATTCGATCCTGTTGATCGGG
CACCTTGTAGTTTTGTCTAAAGTGCACAATCTGTATCGAAATTCAGGAAT
GATTCAGTCAAGCGTGGAAATGGATAACGATGAAGCCATGAGCACTGAAA
GTCTCAGAGATATCGCAACGATCTCGCAGAAGACCAGTTCAGGTTATGCA
ATGAACGGCCCGAAGGCCAGGAAATAAGGGAAACCCATTTGAGATGTGAT
TATCCTTGATGTATAAAATTGTGGCCTTTTTGCTCGTTTATTTCCAATTT
TAAACTGTTTGTAAATTAATGAAAATAATTTTGTTTGTATTAGAACAGTT
CAGCCTGTTTTCTCGGGTAACTATTGGTTACCGACGTTTGAAAGCATTTT
TCTTGCTTTATTTATACAAGTATAAAACTGAATAAAATTAATTCATTCTT
TTGAAACGACCAAAGAAAAGCTGTCAGGGTGAAAGTTTGAAAAAACGAAG
AAAATTAGCGTCGAGTTGATCTCAGATCTGAAAGTCCTCCCAATTCCATG
AATATTGAGGTCATCGGCTTTTGCAAGATCTTGTAAGACTTTTGTCATTG
AAGAATCGGATT
back to top

protein sequence of SMED30005604-orf-1

>SMED30005604-orf-1 ID=SMED30005604-orf-1|Name=SMED30005604-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=582bp
MKICYFLIAAILNSITALSFGLKTLTAKIQEVTNLRLDEVAYNNSYLLIM
SIKTNIRLRYEMELPNFNNNGEKLLCGPYFDVVSAKFLNNGYDIGVTFKE
KAHNLFLRIYILKISNKFSEDKIHQLKPNEIYKLKLYRKWQLKITYLTER
IAESELIKGMPALISCKAFGGFPHKYVEFYGIEKLNVTNRTLDRMNNILT
ISFIPQLSDYGETIGCKVGADRFTTRLRVYYPRKKLIVIPNLRREIEIHN
FYFCSFAGKFTASFARWNFIKGPPGWERYLKILNGNVLHAFDAPQSENFW
EFSCEEAVEKDKLKFTLPSKSLKFKFSIKSRSATTSKGFSQKVSQGGRLF
TSTLNPKIFKSSKKSTKSGREFSIRKGFICYFIFISVLLAGIITLIFSLV
AYKTYNKRVASSTEENSRKINTIEDVIFSPPGRRKLSEITKPMKDLKFDL
ETIVEERSDSSIQYFLFFITMFGQIAVIAIQCIGISWLGSCGWLNGLEAF
AINRTTGSIMLFIAIMYSILLIGHLVVLSKVHNLYRNSGMIQSSVEMDND
EAMSTESLRDIATISQKTSSGYAMNGPKARK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR007273SCAMP
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0006810transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007273SCAMPPFAMPF04144SCAMPcoord: 457..537
e-value: 4.2E-17
score: 63.0
IPR007273SCAMPPANTHERPTHR10687SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN SCAMPcoord: 458..540
NoneNo IPR availablePANTHERPTHR10687:SF61coord: 458..540
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.715
NoneNo IPR availableTMHMMTMhelixcoord: 378..400
NoneNo IPR availableTMHMMTMhelixcoord: 507..529
NoneNo IPR availableTMHMMTMhelixcoord: 465..487