TIR domain-containing protein

Overview
NameTIR domain-containing protein
Smed IDSMED30005603
Length (bp)1973
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TIR domain-containing protein (SMED30005603) t-SNE clustered cells

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30005603) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TIR domain-containing protein (SMED30005603) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30005603) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005603

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005603SMESG000065938.1 PL08003A1B06ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30005603SMESG000065938.1 dd_Smed_v4_13709_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30005603SMESG000065938.1 dd_Smed_v6_13709_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TIR domain-containing protein vs. TrEMBL
Match: W4XMC6 (TIR domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 7.919e-63
Identity = 147/456 (32.24%), Postives = 245/456 (53.73%), Query Frame = 2
Query:  503 SLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLL-EKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXX-----------XXXXXXXXXXXXXXXAATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKS-------IALLTEFSKESVHFDMKL----WSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGM-NFIEIIKFNAAIIDL 1798
            SL I+HN+ + P  +   +  K+   +   +E D    ++ VSMM LA +V+E    +L EKG N+++ ++E++  A  +K+KR  G SV E+  AL  ++V+DN K  IVE  G+ ++I +L+D S   ++ E S   +WNL F +++   L ++ +    L+ L T  SS++ K A                  E++      ++ + ++ ++ LSY W  + +V  + + L K+   +W+D   M  S L+ MAE IEN+   VM MS+ Y+ SPNCR EAEYA+ L+K IIP+++E  Y+P GWLGII G K Y +FS R D    + KLL++V+          E KI +K        +     F  ES    +K+    WS   V+ WL+ENEL  ++   +  NG+LL  + K+  ++  +   ++ ++FG+   I+I++F  A+  L
Sbjct:   38 SLNILHNLAKAPGNKHVYREEKVVESMEPFLEGDPY--LKAVSMMTLAYIVEEGQEEILAEKGTNTIEYLVEILKDAQNSKDKRCQGLSVEEVTAALGRLAVHDNNKYKIVEAGGLPLMISMLHDESV--ETQEASAHAVWNLAFSDDVSEKLRSNTDCMMALQDLSTSSSSEVAKAANGALWVINKEGEKKDLVKENEDDTGLGHSLSRKQPHIMLSYQWGCQPLVLKMRDVLAKAGYNIWVDVDCMYGSTLQAMAEAIENACAIVMCMSERYKESPNCRTEAEYAFQLRKRIIPVMMEEYYQPDGWLGIILGAKFYMDFSGRLDIEEEMNKLLKEVQMH------SAEAKIIYKDDTDDGVLVGASISFPLESAGISIKMESLDWSASQVQDWLIENELEHLRPLMAEYNGKLLNQLYKMRQEAPDFFYLSIKEDFGLKKLIDILRFTEALDSL 483          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A210QF19 (Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22612 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 5.721e-56
Identity = 143/490 (29.18%), Postives = 257/490 (52.45%), Query Frame = 2
Query:  350 LSCVCNLTDSNEKFVISVAQXXXXXXXXXXXXXXPHETASSDRFHFQFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIES-DLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXXXXXXXXXXXXXXXXAATE-KFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVK------CKLKNENTDVEDKIEFKSIALLTEFSKESVHFDMKL--WSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFIEIIKFNAAI 1789
            L+ + N TD++ +   +VA+S  +     N    P  T   ++  +  +K S+ I+HNI R P      + NK   V+ + + S +  E +++++M+ L+ +V+E +   L     S++  I+ I+KA  ++ +RY GF+  EL+  L  ++VNDN KK IVE   + + + +L   S  E++V  +   IW L FD+ +   ++   ++  +LEKL+    S +RK     ++ ++ ++   +   +  + K +VF+SY+W  K IV  I E L    ++VWID ++M  S L  MAE +EN+ + ++ MS+ Y+ SPNCRLEAEY + L+K  IP++++ KY+P GWLG I G K+Y +FS +  F      L ++++              DV D     + A     S  S+         + +DV  WL + +L       +  +G+LL  + ++  ++ ++   +L K+  MN +EI+ F  A+
Sbjct:  218 LNTLWNFTDASLRLAKTVAESDGVRFFTVNCSHEPFLTNLDNKNVYYIVKSSMSIIHNIARNPDVIHFFKENKTTDVMLKFVRSYEEHEMLKIMAMLTLSHIVEEEENDKLMDDTGSIEGTIKYIDKAIEDERRRYRGFTPQELMDGLGKLAVNDNNKKKIVEAGALPVFMKMLKSDSAEEQTV--TARAIWTLSFDKEVSQKIVEHPDMMTSLEKLRESSDSDVRKNVNGALFVLKGENDVSRRPRSGKKNKGHVFISYSWNEKEIVLKIRERLKAEGVEVWIDIERMGGSTLTAMAEAVENAAVVLLCMSEKYKQSPNCRLEAEYTFQLRKDYIPLMMQKKYRPDGWLGAILGAKLYFDFSGKYPFEKPWNGLQKELRGIGRLSTPSATPGKDVTDGPIMATSACTAASSPGSLSTSSHAHKMTTEDVGNWLCQVKLDGCVPSLAQFDGKLLVQLQRMKVEAPEFYYASLEKKLNMNLVEILTFTEAL 705          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: W4XJB9 (TIR domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.225e-49
Identity = 135/489 (27.61%), Postives = 250/489 (51.12%), Query Frame = 2
Query:  359 VCNLTDSNEKFVISVAQXXXXXXXXXXXXXXPHETASSDRFHFQFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEP-VRLVSMMILASLVKEN-DLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXXXXXXXXXXXXXXXXAATEKF--------NVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTEFSKESVHFDMKL-WSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFI-EIIKFNAAI 1789
            +CNL++++   V+S+       + + +   + +    S R     +++SL I+ N+   P  R   +   +   +   ++ D   P ++ + M+ LA +++E  +  L+EK  ++++ ++ ++  A  + NKR+ G    E+ LAL  ++V+D+ K  I++  G+ +++ +L D S    + E +   IWNL F E+ R  +  + +    LE L     S +   A   +W I     K        E          ++ +SY W ++ +V +I + L  +  +VW+D   M  S L+ MAE +E S + +M +S+ Y+ SPNCR EAEY + L K IIP+++E  Y+P GWLGII G+K+Y +FS + D    + KLL +V+    +    V+ + E K + LLT+ S +       L WS + V+ WL  + L + +      +G  LF++ KL  ++ ++   ++  + G+  + EI KF AA+
Sbjct:   90 LCNLSEAS--LVLSIQMGEKGMVKLCSSNIVKYRGKMSIRDILSLIRVSLGILCNMSTTPGNRHLFREEGVAEKMQPYLKGD---PFLKTICMITLAYIIEEGQEDSLIEKETDTIEYLVGILRDAVKSPNKRFQGLCDREIALALGRLAVHDSSKCKILKAGGLPLLVKMLEDKS--ADTQEAAANTIWNLAFSEDGRQKIAENKDCLKLLESLTQCSESHVADAAKGALWVITQGQAKQVEKEVEAEGMQGEEKSYSHIMISYQWGSQPVVLTIRDALKAAGYQVWLDVDHMHGSTLQAMAEAVEKSYVVLMCISEGYKESPNCRTEAEYTFKLGKCIIPVMMEEYYQPDGWLGIILGSKLYMDFSGKLDQTEEMKKLLREVQTNHADAGDTVK-RAEVKEVKLLTQLSTQPNTPSQVLSWSNEQVQDWLKNSGLDKWRPSLQEYDGTFLFNLHKLRLEAPEFFYSSIQDDQGLQKLREIFKFTAAL 570          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A2B4RLI9 (U-box domain-containing protein 4 OS=Stylophora pistillata OX=50429 GN=PUB4 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.355e-47
Identity = 132/444 (29.73%), Postives = 237/444 (53.38%), Query Frame = 2
Query:  488 QFLKLSLCIVHNI-KRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXXXXXXXXXXXXXXXXAATEKFN---VFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIAL---LTEFSKESVHFDMKLWSFQDVERWLVENEL-GRIKS-KFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFI-EIIKFNAAI 1789
            + L  SL I+HN+ KR P       +  + +++  ++++++       S+++LA L+ E + HL+      +  +I L+ KA      RYLGFS  E+   L  I+VNDN KK IV+   + I++ +L ++   E+ V N+   +W L FDE  +  +  D +    L KL T  + +++K A   +W IE K K  ++   + +K +   V +SY W  + +V  I   L     KVW+D  +M  S LE MA  +EN+++ ++ +S  Y+ SPNCR EAEY Y L K IIP++++ KY+P GWLG I G+K + +FSE+   +  + KL++++  +          KIE +  A+   + +    S    ++ W+  DV+ WL++  L  R+ S     +NG++L  +  L  +S ++   ++  +F +  + ++++F  A+
Sbjct:  298 KMLSRSLGILHNLSKRVPTRTNFASAQAVNSLLLPLLKAEITF-YSAKSLLVLAYLIDEQNNHLIMADAEPINFLIRLLRKAIGTDYHRYLGFSAREIAEGLTQIAVNDNNKKTIVKCGAIPILVNMLQNAKDDEERV-NACNTLWTLAFDEENKKNIKEDEHACAELRKLLTSNNREVKKAAAGALWEIEGKEKHAEDKQQSVKKSDAKHVMISYQWDVQKLVIQIKNKLQSDGFKVWMDIDEMGGSTLESMARAVENASVVLVCVSQKYKESPNCRSEAEYTYQLHKDIIPLMMDGKYRPDGWLGFIVGSKFWIDFSEKHKLDSNVDKLVKELGTR---------GKIELQENAMKATVMDVVDASPQSTIRSWTSSDVKAWLMDVGLKDRLDSNTLKRLNGQILLRLQDLRKESPEFFYSSVRTDFKLGTVFDVLEFVDAL 730          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A0L8HV44 (TIR domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22006151mg PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 3.193e-47
Identity = 143/507 (28.21%), Postives = 258/507 (50.89%), Query Frame = 2
Query:  365 NLTDSNEKFVISVAQXXXXXXXXXXXXXXPHETA-SSDRFHFQFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFN-LSDTLEKLKTHESSKIR---KLATXXXXXXXXXXXXXXXXXAATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDV---------------------KCKLKNENTDVEDKIEFKSIA---LLTEFSKESVHFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFIEIIKFNAAIIDL 1798
            N +D++ +  +S+A+S  + LL  N    P+  A  S   H+  +K SL I+HNI R P  +   +  K   VI   I S   E  +++SMM +A +V+E D   L +   S+  +++ ++KA     +RY GF+ +E+V  L+ ++V D+ K  IV+   + ++  +L      E+   ++  I+W L FDEN+R  L+ND   L   LE LK ++   +    K    ++      ++  K    A  K +VF+SY+  +K  V  I + L +   ++WID   M  S L+ MA GIEN+ + ++ MS+ Y+ SP+CR EAEY + L+K  IP++++ KY P GWLG + G K++ +FS +  F  +   L++++                     K     EN+  E +   K I+   L+ +    S   +M   +  ++  WL  ++L      FS  +G++LF + ++  ++ +Y  + + K+  M+ ++ ++F AA+  +
Sbjct:  125 NFSDASAQLALSLAESDAVRLLTCNCGHKPYLNAIHSKNVHY-IIKASLSILHNIARNPSIKHYFKEQKTSEVIQTFISSK-DEMFKVLSMMTMAYIVEEEDNQTLIEETGSILCMLQWLDKALDCNKRRYKGFTPYEIVQGLEKLAVTDSNKLKIVDGGILSMLSRMLQFDDVREQC--SAARILWTLMFDENVRERLINDEQALVTLLESLKDNKDKLVSANVKGVLWLLNGATQVTEVDKETVRARAKTHVFISYSVVDKESVWRIRDRLKEEGYQLWIDVDCMGPSNLQAMASGIENAAVVLICMSEKYKQSPSCRTEAEYTFRLRKDYIPMMMQKKYNPDGWLGTMLGAKLFFDFSGKYPFEKSFGGLIKELRGRGQYSPGDAQVDGAEDQTNKAGTSTENSGNEQQSPSKKISIDHLVNDIGALSPIVEM---TNDEIASWLHYHKLAEYSEAFSQFDGKMLFQLSEMKKEAPEYFYQCMEKKMNMSLVDTLRFTAALASI 624          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO45030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU69])

HSP 1 Score: 176.792 bits (447), Expect = 9.819e-47
Identity = 119/434 (27.42%), Postives = 228/434 (52.53%), Query Frame = 2
Query:  488 QFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXXXXXXXXXXXXXXXXAATEKF--NVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNV--TLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTEFSKESVHFDMKLWSFQDVERWL--VENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFIEII 1771
            + L  ++  +HN+ R   CR   +      V+  ++  ++ +     +++ILA L  E++  L+   +  ++ +I +++K+  + + RYLGF+  EL   L  I+VND+ KK I +   + I++ +L ++   E+        +W L FD   +  ++   N  + L++L+  E   ++K A  ++W IE K       + A E    +V +SY W  +  +  +   L  +  +VW+D +QM  S L+ MA  +EN+ + +M +S  Y+ SPNCR EAEYA+ L+K I+P+++E  Y+P GWLG+I G K++ +FS+++   V  +  KL +++  + +     VE K+      ++  F K     D+  WS  DV  W+      LG   +  S ++G+LL  + KL ++S ++   ++ ++FG   ++ +
Sbjct:  391 KILNTAMGTMHNLSRRIPCRQYFKKADTVKVLLPMLNDEVSQ-FAAKALLILAYLTDESNNSLIMASEEPIQFLIHILSKSCSSNSNRYLGFTNSELAEGLSQIAVNDSNKKLIGQHGAIPILVDMLANAKNDEQR-RCGAEALWVLAFDNENKEAILTTPNAVELLKELQHSEDDSVKKAAAGVLWEIEGKESHTVKESTADEPLRNHVMISYQWDVQPTMIQVKSKLQAAGYRVWMDLEQMGGSTLQAMANAVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEKSYRPDGWLGMIMGAKLWIDFSDKQTLRVDDSFEKLQKEIGMRGRGRGNVVESKLVAVQHDVVDVFPK----IDISKWSKDDVMNWMNGFGLRLGNDSTIASHLSGKLLQRLAKLRSESPEFFYSSVKQDFGFAHLQEV 818          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO41008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P1])

HSP 1 Score: 154.066 bits (388), Expect = 6.721e-39
Identity = 118/447 (26.40%), Postives = 229/447 (51.23%), Query Frame = 2
Query:  488 QFLKLSLCIVHNIKRFP-ICRGKIQSNKLKTVICEIIESDLCEPVRLV--SMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXXXXXXXXXXXXXXXXAATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTEFS-KESV---------HFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNF---IEIIKFN 1780
            + L   L  +HN+ R P + R   +SN +K ++  +     C     V  +++ LA LV E +  L+   +  +  ++ +++ A  +  +++LGF+ WE+   +  ++ ND  K+ I    GV I+  ++ ++    + V   L  ++ L FD   + +L  D    + L  LK     +++K A  I+W IE K  + +N ++   + ++ +SY W N+  + ++ + L ++  KVW+D +QM  S LE MA  +EN+++ ++AMS  Y+ SPNCR EAEYA+  +K I+P+++E  Y+P GWLG+I G K++ +F E  D  +    L+++++           D +   +  +++    KE             D+  W  +DV +WL +  L         ++G +L  + +L  +S ++   ++ K+  M+F   IE+++F 
Sbjct:  812 ELLSHVLGALHNLSRRPAVKRFFEESNGVKHLLLFM----KCGVTYFVMNALLCLAYLVDERNNDLIMADEEPITFLLRMLSSAISDSRRQHLGFAAWEIACGIGRVASNDKNKRLIGRHDGVSILSTLVKEAKNDAERV-YGLQALYMLSFDGENKKILCKDKATVNLLRNLKQSGHKEVQKAAVGILWEIEGKVGRDRNEDS---QQHIMISYQWDNQKAMLAVNKRLKEAGHKVWMDVEQMGGSTLEAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQDYRPDGWLGMILGAKLWMDFRESVDTGIV--HLMKELQYNQTAALQQPHDPVTVDTTTVISSPPDKEDGPPGPTDVVDRPDVSKWKKEDVAKWLSDIGLSSSNKVRKKLDGSMLILLYRLKQESPEFYYASVKKD--MDFPTVIEVLQFT 1246          

HSP 2 Score: 119.013 bits (297), Expect = 1.052e-27
Identity = 52/125 (41.60%), Postives = 83/125 (66.40%), Query Frame = 2
Query: 1106 NVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDV 1480
            +V LSY W  + +V  + + L  +  KVWID +QM+ S LE MA  +EN+   +M +S +Y+ SPNCR EAEY++ L+K IIP+++E +YKP GWLGII G K++ +F  +   +  +  L++++
Sbjct:  554 HVMLSYQWGYQDVVLKVRDELRAAGYKVWIDVEQMEGSTLEAMASAVENAAAVLMCVSRAYKESPNCRSEAEYSFQLRKDIIPLMMEPQYKPDGWLGIIVGAKLWMDFRSKDATSSAVQGLIKEL 678          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG5])

HSP 1 Score: 81.6481 bits (200), Expect = 3.132e-19
Identity = 38/75 (50.67%), Postives = 51/75 (68.00%), Query Frame = 2
Query: 1208 MKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFS 1432
            M  S LE MA  +ENS + +M  S  Y+ S N R EAEYAY+ KK I+P+++E  YKP GWLG+I G+K+Y  F+
Sbjct:    1 MGGSTLEAMANAVENSAVVLMCASRKYKDSVNYRSEAEYAYTQKKPIVPLMMENGYKPDGWLGMIMGSKLYFNFA 75          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO39316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI7])

HSP 1 Score: 73.559 bits (179), Expect = 2.469e-14
Identity = 40/130 (30.77%), Postives = 69/130 (53.08%), Query Frame = 2
Query: 1106 NVFLSYAWANKTIVSSIYEHLVKSDIKVWID-EKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKT----IIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDV 1480
            +V LSY W  + +V  +Y+ L    I+VW+D    ++  I   MA+G++ + I    MS  Y  S NC+ E  YA          I+P++ E  +K KGWLGII+   ++ +F +  +F  ++  L +++
Sbjct:    3 HVMLSYQWDIQDLVKKVYDGLRAYGIRVWMDIHGGIRGDINGSMAKGVDGAAILCCFMSTKYSESKNCKKELSYADGKTGCEEVIIVPVMCEKGFKAKGWLGIITAGLLWIDFRDEANFENSVKSLAQEI 132          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST59])

HSP 1 Score: 65.855 bits (159), Expect = 2.867e-11
Identity = 41/120 (34.17%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 1097 EKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWID-EKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNV 1453
            +KF++ LSY W  ++ V  +Y  L +   + W+D    M+ +I E MA  +ENST+ V  +++ Y+ S NC LE +YA   +K II I  E     K W+  +    +  E S   DF V
Sbjct:  409 QKFDIMLSYNWGIQSFVREVYMELSQQTFQTWMDIWGGMQGNINEAMATAVENSTMLVAFLTEKYQQSVNCNLELKYATMKEKPIIFIKAEKDLVLKDWIQQLVDKSVVFEMSSSGDFKV 528          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000065938.1 (SMESG000065938.1)

HSP 1 Score: 1035.79 bits (2677), Expect = 0.000e+0
Identity = 566/572 (98.95%), Postives = 568/572 (99.30%), Query Frame = 2
Query:   98 MEKVIPSEFENFLLFSIMKLKDLNNMMDSKFVKTIFSQIMEKKHILNNVXXXXXXXXXXXNLLNHLKQINYFSTIDTVSCCNDILSCVCNLTDSNEKFVISVAQXXXXXXXXXXXXXXPHETASSDRFHFQFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXXXXXXXXXXXXXXXXAATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTEFSKESVHFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFIEIIKFNAAIIDLNCEYQ 1813
            MEKVIPSEFENFLLFSIMKLKDLNNMMDSKFVKTIFSQIMEKK ILNNVEIIEDFIEIIINLLNHLKQINYFSTIDTVSCCNDILSCVCNLTDSNEKFVISVAQSPLLSLLISNIIDIPHETAS+DRFHFQFLKLSLCIVHNIKRFPICR KIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHES KIRKLATSIIWSIESKSKKLKNNNAATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTEFSKESVHFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKS KYVC+NLFKEFGMNFIEIIKFNAAIIDLNCEYQ
Sbjct:    1 MEKVIPSEFENFLLFSIMKLKDLNNMMDSKFVKTIFSQIMEKKPILNNVEIIEDFIEIIINLLNHLKQINYFSTIDTVSCCNDILSCVCNLTDSNEKFVISVAQSPLLSLLISNIIDIPHETASTDRFHFQFLKLSLCIVHNIKRFPICRRKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESPKIRKLATSIIWSIESKSKKLKNNNAATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTEFSKESVHFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSPKYVCQNLFKEFGMNFIEIIKFNAAIIDLNCEYQ 572          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000015387.1 (SMESG000015387.1)

HSP 1 Score: 364.385 bits (934), Expect = 1.264e-117
Identity = 228/575 (39.65%), Postives = 351/575 (61.04%), Query Frame = 2
Query:  143 SIMKLKDLNNMMDSKFVKTIFSQIME-----KKHI--LNNVXXXXXXXXXXXNLLNHLKQINYFSTIDTVSCCNDILSCVCNLTDSNEKFVISVAQXXXXXXXXXXXXXXPHETASSDRFHFQFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRK-------LATXXXXXXXXXXXXXXXXXAATE---KFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTEFSKESVH---------FDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFIEIIKFNAAI 1789
            ++ KLK+L + ++   +  IF  I +     K H+  L+NV +   ++ I  N +    +  YF   D        L+ + N  D  ++    +  + L   LI+N++  P+     +   F  +K S+ I+HNI R P    K Q  +LK V+  +I+ +  + + L+SM+ L+ LV E++LHLL++G+NS+K +I  I  A+ N +K+  GF++WELV  LK +S NDN+KK IV E G+++I  IL + + C+  +E  LG++WNLCFD++I+ +L+NDF+L   + + K H+ S I++       L    I S E       +   A++   KF+VF+SY WANK +V SI + LV+S+IK+WID  QMK S LE MA+GIENS IF+MA+S++YR SPNCR EAEYA+SL K IIP+I+E+KYKP  WLGII G+KMY+EFS+RR+F  ++  LL +V   ++N    VE KI  + I  + +   ES             +  WS + VE+WLV+N LG +KS+F + +G+LLFS+I + NKS KY+ + L  E+GM FI+++K ++AI
Sbjct:   25 ALEKLKELQDSLNFNIIYKIFKGISQSYFDLKSHLNALSNVLLNLKYVSITSNYVGKFSKEGYFVNDDVWFATYYALNSLWNYCDGFQEIANEIVVTDLPQYLIANLLHRPYLDNMKNTNIFYLIKASISIIHNIVRCPGNEEKFQIIELKNVLVGLIKRNDSDFIVLISMLTLSCLVNESELHLLDEGKNSIKALIMKIRTAFENDSKKVNGFAIWELVNGLKCVSANDNVKKTIVTENGIKLIFDILKNPT-CDNDIEKCLGVLWNLCFDKDIKAILVNDFDLKLFINRFKNHKLSTIKRCYNGILWLIDEKIQSKERILSAHLSKVKASKTHWKFDVFISYCWANKQMVLSIRDFLVQSNIKIWIDLDQMKGSTLEAMADGIENSNIFIMAISEAYRTSPNCRTEAEYAFSLNKPIIPLIVEMKYKPTSWLGIIMGSKMYYEFSKRRNFEESIHSLLANVNTIIQN----VERKIVTEIIVPVAQ--NESYQSSDGGTPKILSVHSWSNKIVEKWLVKNGLGHVKSRFMNFDGKLLFSLIDVKNKSRKYLIDALKVEYGMKFIDLLKLHSAI 592          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000047638.1 (SMESG000047638.1)

HSP 1 Score: 361.303 bits (926), Expect = 3.530e-117
Identity = 224/537 (41.71%), Postives = 333/537 (62.01%), Query Frame = 2
Query:  287 NHLKQINYFSTIDTVSC-CNDI---------------LSCVCNLTDSNEKFVISVAQXXXXXXXXXXXXXXPHETASSDRFHFQFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXXXXXXXXXXXXXXXXAATE----------KFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKN------ENTDVEDKIEFKSIALLTEFSKESVHFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFIEIIKFNAAIIDLN 1801
            N L ++NY S I  V C  ND+               L+   N  DSN++   S+  + L +LLISN++  P+         +  +K S+ I+HN+ R     G  Q+ +LK  +  +I  +  + + LVS++ LA LVKEN+LHLLE+G+N++  +I  I  A  +K KR  GFS+WELV  LK +S NDNMKK+IV E G+++++ I+   S C+  +E  LG++WNLCFD+ I+  L+ D+ LS  ++  ++H S+KI+K    I W IE+KS   +   +A            KF++FLSY+WANK I+ +I + L+KS I VWID  QMK S LE MA+GIENS IFVMA+S++YR SPNCR EAEYA+SLKK IIP+I+ELKYKP  WLG+I G+K Y+EFS+RR+FN ++  LL ++   + +        TDV ++     I  +   S E +  ++  W+ +DVE+WL+++ L  +K KFSS +GRL+ SM+ L +KS  ++  NL  E+GM  I+++KFN A+  +N
Sbjct:   10 NELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPS-CDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRTSPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETIIVPKTDVPNEANHVEIRNVNTVSNE-IRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQIN 544          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000079659.1 (SMESG000079659.1)

HSP 1 Score: 259.996 bits (663), Expect = 4.119e-78
Identity = 156/441 (35.37%), Postives = 271/441 (61.45%), Query Frame = 2
Query:  488 QFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXX-XXXXXXXXXXXXXXAATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTE---FSKESVHFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFIEIIKFNAAIIDL 1798
            +F++  + ++ N+ R    +   ++N+LK  + E I+    + + + SM++L+ ++K+++++LL +G N++ +I+ LI K   + NKR   +S+ EL+L L  IS N+ +K+ I +  G+ III IL+  +  E  +E +LG I+NLCF++ I+  L+++F +  +++  + H +  I+K    I+         K K +++   +F+VF+SYA  NK+ V  I+  L K +I++WID++QM  S+LE MA GIENS  F++ +S  Y  SPNCR EAEYAY  +KTIIP+IL  ++KP+GWLG I G KMY+E SERR+    +  L+  +K  +  +N +      FK     T+    + +S++  +K WS  +   WL +++LG +K + + ++G+LL+ M  + +KS  Y  + L KEFGM F+E++KF+ A+ +L
Sbjct:  139 EFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNSILMLIKKT-ASFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILH--AKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIEKSIKLYENHVNPVIKKYHDGIMWEIRGKNEIKKKGSDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGM-GDNGEQGKSEHFKEAGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGYLKKRLNDLDGKLLYVMFDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNL 575          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000079651.1 (SMESG000079651.1)

HSP 1 Score: 248.054 bits (632), Expect = 1.317e-73
Identity = 152/441 (34.47%), Postives = 266/441 (60.32%), Query Frame = 2
Query:  488 QFLKLSLCIVHNIKRFPICRGKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESSKIRKLATXXX-XXXXXXXXXXXXXXAATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTE---FSKESVHFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEFGMNFIEIIKFNAAIIDL 1798
            + L+  + ++ N+ R    + + +  +LK  + E I+    + + + SM+ L+ ++ +++++LL +G N++  I+ LI K   +   R   +S+ EL+L L  IS N+ +K+ I +  G+ III IL+  +  E  +E +LG I+NLCF++ I+  L+++F +  +++  + H + +I+K    I+         K K +++   +F+VF+SYA  NK+ V  I+  L K +I++WID++QM  S+LE MA GIENS  F++ +S  Y  SPNCR EAEYAY  +KTIIP+IL  ++KP+GWLG I G KMY+E SERR+    +  L+  +K  +  +N +      FK     T+    + +S++  +K WS  +   WL +++LG +K + + ++G+LL+ M+ + +KS  Y  + L KEFGM F+E++KF+ A+ +L
Sbjct:  141 EHLENCVLVISNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLI-KETCSIEGREGNYSIPELMLGLFRISANNEIKEKIYKNGGIPIIIDILH--AKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIEKSIKLYENHVNPEIKKYHDGIMWEIRGKNEIKKKGSDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVIEDLVHTLKTGM-GDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGYLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNL 577          
The following BLAST results are available for this feature:
BLAST of TIR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4XMC67.919e-6332.24TIR domain-containing protein OS=Strongylocentrotu... [more]
A0A210QF195.721e-5629.18Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6... [more]
W4XJB93.225e-4927.61TIR domain-containing protein OS=Strongylocentrotu... [more]
A0A2B4RLI91.355e-4729.73U-box domain-containing protein 4 OS=Stylophora pi... [more]
A0A0L8HV443.193e-4728.21TIR domain-containing protein OS=Octopus bimaculoi... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450309.819e-4727.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410086.721e-3926.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337203.132e-1950.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393162.469e-1430.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331052.867e-1134.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065938.10.000e+098.95SMESG000065938.1[more]
SMESG000015387.11.264e-11739.65SMESG000015387.1[more]
SMESG000047638.13.530e-11741.71SMESG000047638.1[more]
SMESG000079659.14.119e-7835.37SMESG000079659.1[more]
SMESG000079651.11.317e-7334.47SMESG000079651.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005603 ID=SMED30005603|Name=TIR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1973bp
ATTAATAAGTGTAACTACTTGAAATACCTTTTGAAATTCATTTTAATTTT
ATTTTGAATTTTTGTATTAAACATTACAAATACAGACAGGAATTCAAATG
GAAAAGGTAATTCCTAGTGAATTTGAAAATTTTTTGCTATTTTCAATAAT
GAAATTAAAAGATTTAAACAATATGATGGATTCAAAATTTGTGAAAACCA
TTTTTAGTCAAATAATGGAGAAGAAACATATTCTTAATAATGTGGAAATA
ATTGAAGATTTTATTGAAATAATAATTAATTTATTAAATCATTTAAAACA
AATAAATTACTTTTCCACAATTGACACTGTGTCGTGTTGCAATGATATTT
TGTCTTGCGTCTGCAATTTGACTGACAGCAATGAAAAGTTTGTCATTTCT
GTGGCACAGAGTCCTTTATTAAGTCTTTTAATTTCCAATATCATTGATAT
TCCACACGAAACGGCTTCTTCGGATCGCTTTCATTTTCAGTTTCTTAAAC
TATCTCTCTGCATCGTCCACAATATAAAAAGATTTCCCATATGTAGAGGA
AAAATACAAAGCAATAAGTTAAAAACGGTTATTTGTGAAATAATTGAATC
AGACCTTTGCGAACCAGTCCGCTTGGTCAGTATGATGATTCTCGCATCCT
TAGTAAAAGAAAATGATTTACATCTGTTAGAGAAAGGCCAAAATAGTTTA
AAAACGATAATTGAATTGATTAATAAAGCCTATTTAAACAAAAACAAACG
ATATCTTGGATTTTCAGTTTGGGAACTCGTTCTTGCTTTGAAAAACATCT
CAGTAAATGACAACATGAAAAAGAATATCGTCGAAGAGAAGGGAGTGGAA
ATTATAATTTGTATTTTAAATGATTCTTCGTTCTGTGAAAAAAGTGTAGA
AAATTCTTTAGGCATAATTTGGAATCTTTGTTTCGATGAAAACATCAGAA
TAATGTTGATGAATGATTTCAATCTATCAGATACCCTTGAGAAACTTAAA
ACTCACGAATCCTCGAAGATTAGAAAACTGGCTACGAGCATAATTTGGTC
TATAGAATCAAAAAGCAAAAAATTAAAAAACAATAATGCAGCGACAGAAA
AATTCAATGTGTTTTTGAGTTATGCCTGGGCAAATAAAACTATAGTTTCA
TCAATCTATGAACACCTCGTCAAATCGGATATCAAAGTTTGGATAGATGA
AAAACAAATGAAAAGATCAATTTTGGAAGATATGGCCGAGGGTATTGAAA
ATTCAACAATATTCGTTATGGCTATGTCTGATTCTTACCGAATCAGTCCG
AATTGCCGTTTGGAAGCAGAATATGCATATTCACTGAAAAAAACGATTAT
CCCAATAATTTTGGAGTTGAAATATAAACCAAAAGGTTGGCTCGGTATTA
TTTCCGGAAACAAAATGTATCATGAATTCAGCGAAAGGCGAGATTTCAAC
GTAACACTTACAAAGTTGCTTGAAGATGTAAAATGTAAATTAAAAAATGA
AAACACCGACGTTGAAGATAAGATAGAATTTAAATCCATCGCTCTGTTAA
CCGAGTTTTCAAAAGAATCGGTACATTTTGACATGAAATTGTGGAGTTTC
CAAGACGTCGAAAGGTGGCTGGTGGAAAATGAGTTGGGTCGGATAAAATC
AAAATTCAGCTCAATTAACGGAAGGCTTTTATTTTCAATGATAAAATTGA
TGAACAAATCTTCAAAATATGTCTGTGAAAATTTATTCAAAGAATTTGGA
ATGAATTTTATTGAAATTATCAAATTTAATGCAGCAATTATTGATTTGAA
TTGTGAATATCAATAGTAAATTTGCACTTGCACAATAATTGTGATCATGA
TCGATTTTTATTATGAATGAAATAACTGATGTATTGGAAATGTGATTTTT
GAATCAACAATATACGGGGTGCTTGCAGGTATGCTACTTGTACATGTTTT
GTGAATCTAGAGAAGCGAGAAAT
back to top

protein sequence of SMED30005603-orf-1

>SMED30005603-orf-1 ID=SMED30005603-orf-1|Name=SMED30005603-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=573bp
MEKVIPSEFENFLLFSIMKLKDLNNMMDSKFVKTIFSQIMEKKHILNNVE
IIEDFIEIIINLLNHLKQINYFSTIDTVSCCNDILSCVCNLTDSNEKFVI
SVAQSPLLSLLISNIIDIPHETASSDRFHFQFLKLSLCIVHNIKRFPICR
GKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNS
LKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGV
EIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKL
KTHESSKIRKLATSIIWSIESKSKKLKNNNAATEKFNVFLSYAWANKTIV
SSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRIS
PNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDF
NVTLTKLLEDVKCKLKNENTDVEDKIEFKSIALLTEFSKESVHFDMKLWS
FQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSSKYVCENLFKEF
GMNFIEIIKFNAAIIDLNCEYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR013809ENTH
IPR000157TIR_dom
IPR011989ARM-like
IPR016024ARM-type_fold
IPR013761SAM/pointed_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000157Toll/interleukin-1 receptor homology (TIR) domainSMARTSM00255till_3coord: 335..464
e-value: 5.8E-4
score: 23.1
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPFAMPF13676TIR_2coord: 338..450
e-value: 2.0E-20
score: 73.5
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 334..451
e-value: 2.2E-18
score: 68.5
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 334..451
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 36..331
e-value: 4.0E-15
score: 57.4
NoneNo IPR availablePANTHERPTHR46270:SF2coord: 58..562
NoneNo IPR availablePANTHERPTHR46270FAMILY NOT NAMEDcoord: 58..562
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 51..320
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 491..531