Zinc finger RNA-binding protein

Overview
NameZinc finger RNA-binding protein
Smed IDSMED30005588
Length (bp)2712
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger RNA-binding protein (SMED30005588) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger RNA-binding protein (SMED30005588) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger RNA-binding protein (SMED30005588) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger RNA-binding protein (SMED30005588) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005588

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30005588SMESG000022723.1 SmedASXL_008290SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30005588SMESG000022723.1 dd_Smed_v4_3762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005588SMESG000022723.1 dd_Smed_v4_3762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005588SMESG000022723.1 dd_Smed_v4_3762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005588SMESG000022723.1 dd_Smed_v4_3762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005588SMESG000022723.1 dd_Smed_v4_3762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005588SMESG000022723.1 dd_Smed_v4_3762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005588SMESG000022723.1 dd_Smed_v4_3762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger RNA-binding protein vs. Ensembl Human
Match: ZFR (zinc finger RNA binding protein [Source:HGNC Symbol;Acc:HGNC:17277])

HSP 1 Score: 510.375 bits (1313), Expect = 9.805e-165
Identity = 323/763 (42.33%), Postives = 440/763 (57.67%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXX-----NQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTE--------------------NTVEIG-----GGTT---------------------VSKITAAPKINYIHKVAYKALTENPIDEK-------PPAPAEEQTEKIAEEHVD-------LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRR-------DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG-MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATV----QPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + +      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+   T+ST                     NT  +      G TT                      +K T+ PKIN++     ++      D K        P  +  Q  ++ ++ V        L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR        D + RM +           G          Q      +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + E    ++ + ++ +  K+   +R+L GV+RVG LA  LLL GD  V+LVLLCS+ P+ TL+ ++ + LP +L    P +K+DI     E  I++    EP M+  I LTS ++REE+  EG  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS     SPG +LRR FEC++SGI+L G PGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQIHKVL M+PL   ++  N  +N ++RR SD         KKDKK+
Sbjct:  314 FQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNSSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQATSSTAVSASKPTASPSSIAANNCTVNTSSVATSSMKGLTTTGNSSLNSTSNTKVSAVPTNMAAKKTSTPKINFVGGNKLQSTGNKAEDIKGTECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLLGVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEH---EKNKNKEGDDKKEGGKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKTLLSRIAENLPKQLAVISP-EKYDIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGIILKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKD 1070          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Human
Match: ZFR2 (zinc finger RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:29189])

HSP 1 Score: 456.833 bits (1174), Expect = 1.022e-145
Identity = 269/652 (41.26%), Postives = 387/652 (59.36%), Query Frame = 1
Query:  580 NQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN--QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDE----------KPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXX------------XXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPE----DGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDME 2451
            ++  R +      Q+ YCD+CKISCAGPQTY+EHL GQKH+KK +  K  V         Q QL C+LC V+CTGADAY AHIRG+KHQK FKLH +LGKPIP  +P +   +    E       G +V   ++ P +     VA KAL E P +           KP  P  E      +           +  PVG EY+E   ++ G+V++F CKLC C FND +AK++H++GRRHRLQY+KKV+P L +  +  + R  ++ E+++R+++H  +  R   ++    E +RLE         +                  S  +  G R   + DD+HV+ KH+ IYPTE+EL  V   V   E+AL+ +S+ + E       EEE  + +      R L GVMRVG LA  LLL GD  V L LLCS+ PT +L+R++  +LP +L + +  D++++S +D E  I+++  +EP M+  I +TS ++RE+ +      +P+    D L  K+CL++LA+LRH +WFQA+ + LQPC+I+IR+LRDLC+RVPTW  L  W +EL+VEK +SS    L PG ++RR  EC+A+G LL  GPGL+DPCE++  DA   ++ Q+RED+TASAQHALR++AFRQ HKVL M+
Sbjct:  256 SKLPRPKAGPRQLQLHYCDICKISCAGPQTYREHLGGQKHRKKEAAQKTGVQPNGSPRGVQAQLHCDLCAVSCTGADAYAAHIRGSKHQKVFKLHAKLGKPIPTLEPALATESPPGAEAKPTSPTGPSVC-ASSRPALAK-RPVASKALCEGPPEPQAAGCRPQWGKPAQPKLEGPGAPTQGGSKEAPAGCSDAQPVGPEYVEEVFSDEGRVLRFHCKLCECSFNDLNAKDLHVRGRRHRLQYRKKVNPDLPIATEPSS-RARKVLEERMRKQRHLAE-ERLEQLRRWHAERRRLEEEPPQDVPPHAPPDWAQPLLMGRPESPASAPLQPGRRPASS-DDRHVMCKHATIYPTEQELLAVQRAVSHAERALKLVSDTLAE-EDRGRREEEGDKRSSVAPQTRVLKGVMRVGILAKGLLLRGDRNVRLALLCSEKPTHSLLRRIAQQLPRQL-QMVTEDEYEVS-SDPEANIVISSCEEPRMQVTISVTSPLMREDPSTDPGVEEPQADAGDVLSPKKCLESLAALRHARWFQARASGLQPCVIVIRVLRDLCRRVPTWGALPAWAMELLVEKAVSSAAGPLGPGDAVRRVLECVATGTLLTDGPGLQDPCERDQTDALEPMTLQEREDVTASAQHALRMLAFRQTHKVLGMD 899          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Human
Match: STRBP (spermatid perinuclear RNA binding protein [Source:HGNC Symbol;Acc:HGNC:16462])

HSP 1 Score: 268.47 bits (685), Expect = 6.813e-78
Identity = 153/326 (46.93%), Postives = 214/326 (65.64%), Query Frame = 1
Query: 1522 DDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE-------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE----STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSA 2466
            DD+HV+ KHS IYP+ EEL+ V ++V   E AL+ +S+ + E       +   + +++E  E+  K+   R+L GVMR+G +A  LL+  D+ + LVL+C   PT TL+  V D LP ++++ L  +K+ +     E  I++   +EP +   + LTS ++R+E      E V+   P D LDR++CL+ALASLRH KWFQA+   L+ C+I++RILRDLC RVPTW PL  W LELI EK I +    L  G +LRR  ECLASGILLPGGPGL DPCE++  DA S ++ Q +ED+T SAQHALRL AF QI+KVL+M+PL S+
Sbjct:   10 DDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKTEGETEVKKDEAGENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQK-LTEEKYQVEQCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVSMKDPPDLLDRQKCLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPTWAPLKGWPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGGPGLHDPCERDPTDALSYMTIQQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSS 334          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Human
Match: STRBP (spermatid perinuclear RNA binding protein [Source:HGNC Symbol;Acc:HGNC:16462])

HSP 1 Score: 268.47 bits (685), Expect = 6.813e-78
Identity = 153/326 (46.93%), Postives = 214/326 (65.64%), Query Frame = 1
Query: 1522 DDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE-------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE----STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSA 2466
            DD+HV+ KHS IYP+ EEL+ V ++V   E AL+ +S+ + E       +   + +++E  E+  K+   R+L GVMR+G +A  LL+  D+ + LVL+C   PT TL+  V D LP ++++ L  +K+ +     E  I++   +EP +   + LTS ++R+E      E V+   P D LDR++CL+ALASLRH KWFQA+   L+ C+I++RILRDLC RVPTW PL  W LELI EK I +    L  G +LRR  ECLASGILLPGGPGL DPCE++  DA S ++ Q +ED+T SAQHALRL AF QI+KVL+M+PL S+
Sbjct:   10 DDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKTEGETEVKKDEAGENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQK-LTEEKYQVEQCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVSMKDPPDLLDRQKCLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPTWAPLKGWPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGGPGLHDPCERDPTDALSYMTIQQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSS 334          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Human
Match: ILF3 (interleukin enhancer binding factor 3 [Source:HGNC Symbol;Acc:HGNC:6038])

HSP 1 Score: 263.848 bits (673), Expect = 5.609e-76
Identity = 166/348 (47.70%), Postives = 218/348 (62.64%), Query Frame = 1
Query: 1501 MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE--------------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE-----STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSN 2487
            MR F   DD+HV+AKHS +YPT+EEL+ V ++V   E+AL+ +S+ I E              D+P +++ +E +   K E   R+L GVMRVG +A  LLL GDL + LVLLC + PT  L+ KV D L  +L      DK++I  + ++  I++   +EP +   I LTS VVREE     + E ++   P D LDR++CL ALASLRH KWFQA+   L+ C+I+IR+LRDLC RVPTW PL  W LEL+ EK I +    +  G +LRR  ECLASGI++P G G+ DPCEKE  DA   L  Q RED+T SAQHALRL AF Q+HKVL M+PL S    K  N
Sbjct:    4 MRIF-VNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVT-EDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKN 349          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Celegans
Match: Y95B8A.8 (pep chromosome:WBcel235:I:853451:872103:1 gene:WBGene00022388.1 transcript:Y95B8A.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y95B8A.8)

HSP 1 Score: 301.982 bits (772), Expect = 9.912e-90
Identity = 207/638 (32.45%), Postives = 327/638 (51.25%), Query Frame = 1
Query:  613 DSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXX-XXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIK-STTASTENTVE-------IGGGTTVSKI-----TAAPKINYIHKVAYK----ALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXX--RSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLN---DEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL 2457
            D++ +YC+VCKISCAG  TYKEHL+GQ+HKKK +  K  + ST    N+   RC+LCDVTCTG D Y AH+RG KH KT +LH++LGKP+P   P +I       TE   +       + GG  V  I         K+N   ++  K    A   + +  K    A   T ++ +E +      E+ + PVG E++   ++ +GK++QF CKLC+CKF+DP+AKE+H+KGRRHR+ Y++K+DP+LVVD K  N R+   +++++        F +         E                             R F+ +DD+ +  K++ + P  E +  V  ++    ++L+ +S+ I  D+    E+  +  +      +  R++ G  RVG +A    + GD    +VL C+  PT  L+        ++++         +++    +    ++VT    P M+C I +TS+VVR++    V         D+  C+ ALAS+R+TKW+ +    L  C  +IR+LRDL  + P    L D+ +ELIV  +I S P+ L    + +R  E LASG L      L DPCE    +    L+D+ +  LTA AQ+ +R IAF QIH++L ++ L
Sbjct:  123 DNKQYYCEVCKISCAGGITYKEHLEGQRHKKKEAMAKQGIPSTSLAKNKLSYRCDLCDVTCTGQDTYSAHVRGGKHLKTAQLHKKLGKPVPEDVPTIIAPGADGPTETKAKPKWHQQALPGGKIVIGINTVNFVGGTKLNSTGQLEEKKREVAAAVSSVGRKTGGAAATTTIEVEDEKLRAMIAAEE-VQPVGEEHVTEERDATGKLVQFHCKLCDCKFSDPNAKEIHIKGRRHRVSYRQKIDPTLVVDVKPSNKRSQEKRKNQLPAVHEPPSFMKTPWFAPPAPE----------------------------GREFNIVDDRTINEKYAGLNPGVEFISNVDRLISDINESLKYVSDKIERDVRKIPEDVVELPTTTTTTEQPPRTVLGCSRVGIIAKGTFIKGDRCAEVVLTCTPVPTSGLV--------EQIRRLFGESTTSLTIEPDPESPSSLIVTANYFPNMKCRILITSAVVRKDDDSIVTGC----AADKDLCIYALASIRNTKWYDSHCQYLNSCQSVIRLLRDLRNKYPEVACLDDYKMELIVSNIIDSSPMSLGLSDAFKRIVEALASGYLYSA--ILSDPCETSRPNVLDALTDEQKHSLTALAQNFVRQIAFNQIHEILGIDRL 717          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Celegans
Match: R11H6.5 (pep chromosome:WBcel235:V:14610734:14612222:-1 gene:WBGene00011253.1 transcript:R11H6.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R11H6.5)

HSP 1 Score: 72.4034 bits (176), Expect = 4.283e-13
Identity = 68/248 (27.42%), Postives = 111/248 (44.76%), Query Frame = 1
Query: 1714 SLSGVMRVGALANCLLLHG----DLVVSLVLLCSKWPTFTLMRKVID--KLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPC-----XXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDP--IKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIA 2418
             ++ +  VG+       H     D+VV L  L S      L RKV++  K+ D  +   P       L  E  C++ +        C +RL  +++ EEST+    ++P   LD K+ +    S RH  WF    + L P        L+R+L+D   R   + PL+ WT++ +    +++ P   K   G++ RRFFE +A+GI LP  P L DP     +    +   Q  + +   AQ  +R+ A
Sbjct:  107 GIATISHVGSFVTDTTTHSSDKSDVVVQLSTLPSYETVAELGRKVVENMKIADPKETGEP-------LQMEYGCLITSHN------CQVRLLITIIPEESTK----LEPLLHLDSKQMMINFFSTRHITWFSQISSELPPAFIQEWQALVRVLKDTRSRYSDFQPLSIWTIQYLAFYCLANGPNRQKACLGTAFRRFFEIIAAGIFLPKSPCLIDPVSANYRIGFDLTLPQ-MDTVCMGAQTLVRIFA 336          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0333294)

HSP 1 Score: 452.981 bits (1164), Expect = 3.002e-145
Identity = 283/666 (42.49%), Postives = 375/666 (56.31%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQR--QLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYI---HKVAYKALTENPIDEKPPAPAEEQTEKIAE-EHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQK---------QHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG------------MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE--------------------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDK--FDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDG----LDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL 2457
            Q+ YC+VCKISCAGPQTY+EHL+GQKHKK+ +  K+  S  + +  R     CELCDVTCTG DAY AH+RG KHQK  KLHQ+LGKPIP  +P  +                          KIN++      A  A TE   +E   A   +     +  E+ D       NI PVG EYIE  K+E GK++ F CKLC+CKFNDP+AKEMH+KGRRHRLQYK+KV P LVVD K   PR  RL E +  +           H   +W     + R R+    EY      + +         + +G            +R  ++ DD+H +A+H+ IYP EEEL+T+  +V   E+AL+ +S+ + E                    D    +    + +++      R L GVMRVG LA  LLLHGD  V LV+LC++ PT  L+++V + LPDKLKE   + +  + + +N EE  ++V  +    +   I LTS ++R+ +    AT    +G    L R+ CL ALA LRH KWFQA+ T LQ C+++IRILRDLCQRV +W  L  W+LEL+VEKVISS    +SPG  +RR  E L+SG L+  GPGL DPCEK+  DA   L+ Q+REDLT SAQ  LR IAFRQI+KVL MEPL
Sbjct:  203 QLHYCEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQKLGKPIPSEEPKKMG-------------------------KINFVPAAAGGAGVAKTEGGANESDAAGDLDDNLDDSLGENTD-------NIKPVGGEYIEEVKDEEGKILSFNCKLCDCKFNDPNAKEMHMKGRRHRLQYKRKVQPDLVVDFKP-TPRQRRLAEARANRAMMSSHRGGDDHDGGYWE----EQRNRQYNE-EYDYNNWMSRSFGGAQRFGRMGNGPPPHFGMMPGGNVRRPESTDDRHAIARHAEIYPKEEELQTIQRIVSHTERALKLVSDALAEQPSDAGAANKKDKAEKPSEKDGRDNQIFSFQKDADNGGNVVRILKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVAGDTQVNYRVEVNAEEAALIVLDES---VSVKITLTSPLLRDANPGEAATTDEGEGDSEFLPREPCLRALADLRHAKWFQARATGLQSCVMVIRILRDLCQRVSSWQSLPQWSLELLVEKVISSAGFPISPGDCMRRIMEALSSGFLI-NGPGLLDPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIYKVLGMEPL 826          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0310582)

HSP 1 Score: 452.981 bits (1164), Expect = 3.002e-145
Identity = 283/666 (42.49%), Postives = 375/666 (56.31%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQR--QLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYI---HKVAYKALTENPIDEKPPAPAEEQTEKIAE-EHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQK---------QHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG------------MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE--------------------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDK--FDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDG----LDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL 2457
            Q+ YC+VCKISCAGPQTY+EHL+GQKHKK+ +  K+  S  + +  R     CELCDVTCTG DAY AH+RG KHQK  KLHQ+LGKPIP  +P  +                          KIN++      A  A TE   +E   A   +     +  E+ D       NI PVG EYIE  K+E GK++ F CKLC+CKFNDP+AKEMH+KGRRHRLQYK+KV P LVVD K   PR  RL E +  +           H   +W     + R R+    EY      + +         + +G            +R  ++ DD+H +A+H+ IYP EEEL+T+  +V   E+AL+ +S+ + E                    D    +    + +++      R L GVMRVG LA  LLLHGD  V LV+LC++ PT  L+++V + LPDKLKE   + +  + + +N EE  ++V  +    +   I LTS ++R+ +    AT    +G    L R+ CL ALA LRH KWFQA+ T LQ C+++IRILRDLCQRV +W  L  W+LEL+VEKVISS    +SPG  +RR  E L+SG L+  GPGL DPCEK+  DA   L+ Q+REDLT SAQ  LR IAFRQI+KVL MEPL
Sbjct:  203 QLHYCEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQKLGKPIPSEEPKKMG-------------------------KINFVPAAAGGAGVAKTEGGANESDAAGDLDDNLDDSLGENTD-------NIKPVGGEYIEEVKDEEGKILSFNCKLCDCKFNDPNAKEMHMKGRRHRLQYKRKVQPDLVVDFKP-TPRQRRLAEARANRAMMSSHRGGDDHDGGYWE----EQRNRQYNE-EYDYNNWMSRSFGGAQRFGRMGNGPPPHFGMMPGGNVRRPESTDDRHAIARHAEIYPKEEELQTIQRIVSHTERALKLVSDALAEQPSDAGAANKKDKAEKPSEKDGRDNQIFSFQKDADNGGNVVRILKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVAGDTQVNYRVEVNAEEAALIVLDES---VSVKITLTSPLLRDANPGEAATTDEGEGDSEFLPREPCLRALADLRHAKWFQARATGLQSCVMVIRILRDLCQRVSSWQSLPQWSLELLVEKVISSAGFPISPGDCMRRIMEALSSGFLI-NGPGLLDPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIYKVLGMEPL 826          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0310581)

HSP 1 Score: 452.981 bits (1164), Expect = 3.002e-145
Identity = 283/666 (42.49%), Postives = 375/666 (56.31%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQR--QLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYI---HKVAYKALTENPIDEKPPAPAEEQTEKIAE-EHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQK---------QHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG------------MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE--------------------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDK--FDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDG----LDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL 2457
            Q+ YC+VCKISCAGPQTY+EHL+GQKHKK+ +  K+  S  + +  R     CELCDVTCTG DAY AH+RG KHQK  KLHQ+LGKPIP  +P  +                          KIN++      A  A TE   +E   A   +     +  E+ D       NI PVG EYIE  K+E GK++ F CKLC+CKFNDP+AKEMH+KGRRHRLQYK+KV P LVVD K   PR  RL E +  +           H   +W     + R R+    EY      + +         + +G            +R  ++ DD+H +A+H+ IYP EEEL+T+  +V   E+AL+ +S+ + E                    D    +    + +++      R L GVMRVG LA  LLLHGD  V LV+LC++ PT  L+++V + LPDKLKE   + +  + + +N EE  ++V  +    +   I LTS ++R+ +    AT    +G    L R+ CL ALA LRH KWFQA+ T LQ C+++IRILRDLCQRV +W  L  W+LEL+VEKVISS    +SPG  +RR  E L+SG L+  GPGL DPCEK+  DA   L+ Q+REDLT SAQ  LR IAFRQI+KVL MEPL
Sbjct:  203 QLHYCEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQKLGKPIPSEEPKKMG-------------------------KINFVPAAAGGAGVAKTEGGANESDAAGDLDDNLDDSLGENTD-------NIKPVGGEYIEEVKDEEGKILSFNCKLCDCKFNDPNAKEMHMKGRRHRLQYKRKVQPDLVVDFKP-TPRQRRLAEARANRAMMSSHRGGDDHDGGYWE----EQRNRQYNE-EYDYNNWMSRSFGGAQRFGRMGNGPPPHFGMMPGGNVRRPESTDDRHAIARHAEIYPKEEELQTIQRIVSHTERALKLVSDALAEQPSDAGAANKKDKAEKPSEKDGRDNQIFSFQKDADNGGNVVRILKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVAGDTQVNYRVEVNAEEAALIVLDES---VSVKITLTSPLLRDANPGEAATTDEGEGDSEFLPREPCLRALADLRHAKWFQARATGLQSCVMVIRILRDLCQRVSSWQSLPQWSLELLVEKVISSAGFPISPGDCMRRIMEALSSGFLI-NGPGLLDPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIYKVLGMEPL 826          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0075494)

HSP 1 Score: 452.981 bits (1164), Expect = 3.002e-145
Identity = 283/666 (42.49%), Postives = 375/666 (56.31%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQR--QLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYI---HKVAYKALTENPIDEKPPAPAEEQTEKIAE-EHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQK---------QHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG------------MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE--------------------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDK--FDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDG----LDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL 2457
            Q+ YC+VCKISCAGPQTY+EHL+GQKHKK+ +  K+  S  + +  R     CELCDVTCTG DAY AH+RG KHQK  KLHQ+LGKPIP  +P  +                          KIN++      A  A TE   +E   A   +     +  E+ D       NI PVG EYIE  K+E GK++ F CKLC+CKFNDP+AKEMH+KGRRHRLQYK+KV P LVVD K   PR  RL E +  +           H   +W     + R R+    EY      + +         + +G            +R  ++ DD+H +A+H+ IYP EEEL+T+  +V   E+AL+ +S+ + E                    D    +    + +++      R L GVMRVG LA  LLLHGD  V LV+LC++ PT  L+++V + LPDKLKE   + +  + + +N EE  ++V  +    +   I LTS ++R+ +    AT    +G    L R+ CL ALA LRH KWFQA+ T LQ C+++IRILRDLCQRV +W  L  W+LEL+VEKVISS    +SPG  +RR  E L+SG L+  GPGL DPCEK+  DA   L+ Q+REDLT SAQ  LR IAFRQI+KVL MEPL
Sbjct:  203 QLHYCEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQKLGKPIPSEEPKKMG-------------------------KINFVPAAAGGAGVAKTEGGANESDAAGDLDDNLDDSLGENTD-------NIKPVGGEYIEEVKDEEGKILSFNCKLCDCKFNDPNAKEMHMKGRRHRLQYKRKVQPDLVVDFKP-TPRQRRLAEARANRAMMSSHRGGDDHDGGYWE----EQRNRQYNE-EYDYNNWMSRSFGGAQRFGRMGNGPPPHFGMMPGGNVRRPESTDDRHAIARHAEIYPKEEELQTIQRIVSHTERALKLVSDALAEQPSDAGAANKKDKAEKPSEKDGRDNQIFSFQKDADNGGNVVRILKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVAGDTQVNYRVEVNAEEAALIVLDES---VSVKITLTSPLLRDANPGEAATTDEGEGDSEFLPREPCLRALADLRHAKWFQARATGLQSCVMVIRILRDLCQRVSSWQSLPQWSLELLVEKVISSAGFPISPGDCMRRIMEALSSGFLI-NGPGLLDPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIYKVLGMEPL 826          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0075493)

HSP 1 Score: 287.73 bits (735), Expect = 1.550e-85
Identity = 182/463 (39.31%), Postives = 244/463 (52.70%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQR--QLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYI---HKVAYKALTENPIDEKPPAPAEEQTEKIAE-EHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQ---------KQHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG------------MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE--------------------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKE 1866
            Q+ YC+VCKISCAGPQTY+EHL+GQKHKK+ +  K+  S  + +  R     CELCDVTCTG DAY AH+RG KHQK  KLHQ+LGKPIP  +P  +                          KIN++      A  A TE   +E   A   +     +  E+ D       NI PVG EYIE  K+E GK++ F CKLC+CKFNDP+AKEMH+KGRRHRLQYK+KV P LVVD K   PR  RL E +  +           H   +W     + R R+    EY      + +         + +G            +R  ++ DD+H +A+H+ IYP EEEL+T+  +V   E+AL+ +S+ + E                    D    +    + +++      R L GVMRVG LA  LLLHGD  V LV+LC++ PT  L+++V + LPDKLKE
Sbjct:  203 QLHYCEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQKLGKPIPSEEPKKMG-------------------------KINFVPAAAGGAGVAKTEGGANESDAAGDLDDNLDDSLGENTD-------NIKPVGGEYIEEVKDEEGKILSFNCKLCDCKFNDPNAKEMHMKGRRHRLQYKRKVQPDLVVDFKP-TPRQRRLAEARANRAMMSSHRGGDDHDGGYWE----EQRNRQYNE-EYDYNNWMSRSFGGAQRFGRMGNGPPPHFGMMPGGNVRRPESTDDRHAIARHAEIYPKEEELQTIQRIVSHTERALKLVSDALAEQPSDAGAANKKDKAEKPSEKDGRDNQIFSFQKDADNGGNVVRILKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKE 627          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Zebrafish
Match: zfr2 (zinc finger RNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-070705-184])

HSP 1 Score: 512.686 bits (1319), Expect = 1.737e-166
Identity = 297/672 (44.20%), Postives = 409/672 (60.86%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN--QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTAS-TENTVEIGGGTTVSKITAAPKINYIHK----------------------VAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQ-------KQHREDFWR------RR---DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGM---RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE---STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDM 2448
            +QN+  + +      Q+ YCD+CKISCAGPQTY+EHL+GQKHKKK +  K            Q QLRCELCDV+CTGADAY AHIRG+KHQK  KLH +LGKPIP  +P+++ ST A+ T  T +    T+ +  +AA KI                           V  K  T   +  +   P   +T+  +++     +  + +I PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AK+MHLKGRRHRLQYKKKV+P L V+ K  N R  +L E K+R+       K+ +ED  R      RR   DM  R  E +++ ++                     +   R  D+ DD+H++AKHS IYP EEEL+ V  +V   E+AL+ +S+ + E +   +++E +++   +    R+L GVMRVG LA  LLL GD  V L+LL +  PT +L++ V ++LP +L  F   D++++ ++ EE  I++   +EP M+  I LTS V+RE+   + E V+   P D L+R +CL+ LA+LRH KWFQA+   LQ C+I+IR+LRDLCQR+PTW  + +W +ELIVEK ISS    LSPG +LRR  EC+A+GILLP GPGL DPCEK   DA   +S Q RED+TA+AQHALRL+AFRQIHKVL M
Sbjct:  303 HQNKIQKPKGPPKQPQLHYCDICKISCAGPQTYREHLEGQKHKKKEAAQKSGSQVTNGPRGVQTQLRCELCDVSCTGADAYAAHIRGSKHQKVVKLHTKLGKPIPSTEPVLVSSTPAAMTTTTSKPAASTSSTPTSAAQKIQTAAPPKPAAAPVKKPPPAVSAAKAPAVVSKPSTSTVVKMEEVKPPVVKTDPSSDDEDADATGPQGDIQPVGHDYVEEVRNDDGKVIRFHCKLCECSFNDPNAKDMHLKGRRHRLQYKKKVNPDLPVEIKPSN-RARKLLEVKLRKQKQKSVLKRQQEDEQRWHMEMSRRYEEDMYWRRMEEEQVYWAEPRRRMAPPPLMGRPSIPVPPLLPVRRPDSPDDRHIMAKHSAIYPVEEELQAVQRIVSHSERALKLVSDTLLEKVACADDDESETDKQSETQS-RTLKGVMRVGILAKGLLLRGDRNVQLILLAANKPTVSLLKTVAEQLPKQLATFS-EDQYEVQVHPEEANIVIFSSKEPKMQVTISLTSPVMREDPVPNMEKVSEKDPPDLLNRIKCLEYLAALRHAKWFQARANGLQSCVIIIRVLRDLCQRIPTWGKMPNWAMELIVEKAISSASGPLSPGEALRRVLECIATGILLPDGPGLLDPCEKGQTDALGTMSKQAREDVTANAQHALRLLAFRQIHKVLGM 971          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Zebrafish
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:321659])

HSP 1 Score: 402.519 bits (1033), Expect = 3.103e-124
Identity = 234/528 (44.32%), Postives = 328/528 (62.12%), Query Frame = 1
Query: 1099 LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGM-----------RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIF-EDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATVQ----PEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL---SSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKE 2556
            L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    E +R                 G   +  GM           R  D+ DD++V+ KH+ IYP+E+EL+ +  +V + E+AL+ +S+II  +D     + +E+ +  K+   +R L GVMRVG LA  LLL GD  V+LVLLCS+ PT  L+ ++++ LP +L    P +K+++  + +E  I++T   +P M+  I LTS ++REES+ +G  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS    +SPG +LRR FEC++SGILL G PGL DPCEK   D  + + +Q RED+T+SAQ ALRL+AFRQIHKVL M+PL   +S    +N+  R+R +SD         KKDKK+
Sbjct:  526 LAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWEDRRR--MPDGGYPQGPPGPPGLLGVRPGMPIPQPQGPVPPRRPDSSDDRYVMTKHAAIYPSEDELQAIQKIVSITERALKLVSDIITDQDAGASAKGKEEDKEKKEPPKDRLLKGVMRVGVLAKGLLLRGDKEVNLVLLCSEKPTKNLLTRIVEHLPKQLTMVTP-EKYEVKGSIQESAIILTSCGDPKMQVTITLTSPIIREESSRDGDVTSSMVKDPADVLDRQKCLDALAALRHAKWFQARANGLQSCVIVIRILRDLCQRVPTWSAFPSWAMELLVEKAISSASGPMSPGDALRRVFECISSGILLSGAPGLIDPCEKNPTDTLAFMEEQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMNSRFNVRNTRKRRRDNSDGADGFEAEGKKDKKD 1048          

HSP 2 Score: 130.568 bits (327), Expect = 2.044e-30
Identity = 66/115 (57.39%), Postives = 80/115 (69.57%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXX--------XXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADP 894
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +         +     +  +  Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P
Sbjct:  285 FQNKTLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKVSQSSSSSSGGGSSARGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEP 399          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Zebrafish
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:321659])

HSP 1 Score: 402.134 bits (1032), Expect = 6.840e-124
Identity = 234/528 (44.32%), Postives = 328/528 (62.12%), Query Frame = 1
Query: 1099 LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGM-----------RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIF-EDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATVQ----PEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL---SSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKE 2556
            L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    E +R                 G   +  GM           R  D+ DD++V+ KH+ IYP+E+EL+ +  +V + E+AL+ +S+II  +D     + +E+ +  K+   +R L GVMRVG LA  LLL GD  V+LVLLCS+ PT  L+ ++++ LP +L    P +K+++  + +E  I++T   +P M+  I LTS ++REES+ +G  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS    +SPG +LRR FEC++SGILL G PGL DPCEK   D  + + +Q RED+T+SAQ ALRL+AFRQIHKVL M+PL   +S    +N+  R+R +SD         KKDKK+
Sbjct:  548 LAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWEDRRR--MPDGGYPQGPPGPPGLLGVRPGMPIPQPQGPVPPRRPDSSDDRYVMTKHAAIYPSEDELQAIQKIVSITERALKLVSDIITDQDAGASAKGKEEDKEKKEPPKDRLLKGVMRVGVLAKGLLLRGDKEVNLVLLCSEKPTKNLLTRIVEHLPKQLTMVTP-EKYEVKGSIQESAIILTSCGDPKMQVTITLTSPIIREESSRDGDVTSSMVKDPADVLDRQKCLDALAALRHAKWFQARANGLQSCVIVIRILRDLCQRVPTWSAFPSWAMELLVEKAISSASGPMSPGDALRRVFECISSGILLSGAPGLIDPCEKNPTDTLAFMEEQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMNSRFNVRNTRKRRRDNSDGADGFEAEGKKDKKD 1070          

HSP 2 Score: 130.568 bits (327), Expect = 2.239e-30
Identity = 66/115 (57.39%), Postives = 80/115 (69.57%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXX--------XXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADP 894
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +         +     +  +  Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P
Sbjct:  307 FQNKTLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKVSQSSSSSSGGGSSARGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEP 421          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Zebrafish
Match: zfr2 (zinc finger RNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-070705-184])

HSP 1 Score: 381.719 bits (979), Expect = 2.483e-121
Identity = 219/468 (46.79%), Postives = 301/468 (64.32%), Query Frame = 1
Query: 1120 NIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQ-------KQHREDFWR------RR---DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGM---RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE---STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL 2457
            +I PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AK+MHLKGRRHRLQYKKKV+P L V+ K  N R  +L E K+R+       K+ +ED  R      RR   DM  R  E +++ ++                     +   R  D+ DD+H++AKHS IYP EEEL+ V  +V   E+AL+ +S+ + E +   +++E +++   +    R+L GVMRVG LA  LLL GD  V L+LL +  PT +L++ V ++LP +L  F   D++++ ++ EE  I++   +EP M+  I LTS V+RE+   + E V+   P D L+R +CL+ LA+LRH KWFQA+   LQ C+I+IR+LRDLCQR+PTW  + +W +ELIVEK ISS    LSPG +LRR  EC+A+GILLP GPGL DPCEK   DA   +S Q RED+TA+AQHALRL+AFRQIHKVL M  L
Sbjct:   90 DIQPVGHDYVEEVRNDDGKVIRFHCKLCECSFNDPNAKDMHLKGRRHRLQYKKKVNPDLPVEIKPSN-RARKLLEVKLRKQKQKSVLKRQQEDEQRWHMEMSRRYEEDMYWRRMEEEQVYWAEPRRRMAPPPLMGRPSIPVPPLLPVRRPDSPDDRHIMAKHSAIYPVEEELQAVQRIVSHSERALKLVSDTLLEKVACADDDESETDKQSETQS-RTLKGVMRVGILAKGLLLRGDRNVQLILLAANKPTVSLLKTVAEQLPKQLATF-SEDQYEVQVHPEEANIVIFSSKEPKMQVTISLTSPVMREDPVPNMEKVSEKDPPDLLNRIKCLEYLAALRHAKWFQARANGLQSCVIIIRVLRDLCQRIPTWGKMPNWAMELIVEKAISSASGPLSPGEALRRVLECIATGILLPDGPGLLDPCEKGQTDALGTMSKQAREDVTANAQHALRLLAFRQIHKVLGMGSL 554          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Zebrafish
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:321659])

HSP 1 Score: 319.701 bits (818), Expect = 7.987e-94
Identity = 202/528 (38.26%), Postives = 291/528 (55.11%), Query Frame = 1
Query: 1099 LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGM-----------RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIF-EDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATVQ----PEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPL---SSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKE 2556
            L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    E +R                 G   +  GM           R  D+ DD++V+ KH+ IYP+E+EL+ +  +V + E+AL+ +S+II  +D     + +E+ +  K+   +R L GVMRVG LA  LLL GD  V+LVLLCS+ PT  L+ ++++ LP +L    P +K+++  + +E  I++T   +P M+  I LTS ++REES+ +G  T      P D LDR++CLDALA+LRH K    ++TN                                                +LRR FEC++SGILL G PGL DPCEK   D  + + +Q RED+T+SAQ ALRL+AFRQIHKVL M+PL   +S    +N+  R+R +SD         KKDKK+
Sbjct:  548 LAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWEDRRR--MPDGGYPQGPPGPPGLLGVRPGMPIPQPQGPVPPRRPDSSDDRYVMTKHAAIYPSEDELQAIQKIVSITERALKLVSDIITDQDAGASAKGKEEDKEKKEPPKDRLLKGVMRVGVLAKGLLLRGDKEVNLVLLCSEKPTKNLLTRIVEHLPKQLTMVTP-EKYEVKGSIQESAIILTSCGDPKMQVTITLTSPIIREESSRDGDVTSSMVKDPADVLDRQKCLDALAALRHAKCNGFQITN------------------------------------------------ALRRVFECISSGILLSGAPGLIDPCEKNPTDTLAFMEEQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMNSRFNVRNTRKRRRDNSDGADGFEAEGKKDKKD 1022          

HSP 2 Score: 130.183 bits (326), Expect = 2.930e-30
Identity = 66/115 (57.39%), Postives = 80/115 (69.57%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXX--------XXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADP 894
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +         +     +  +  Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P
Sbjct:  307 FQNKTLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKVSQSSSSSSGGGSSARGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEP 421          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 504.212 bits (1297), Expect = 6.647e-163
Identity = 314/728 (43.13%), Postives = 432/728 (59.34%), Query Frame = 1
Query:  571 RYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN-----QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTAST------ENTVEIGGGTTVSKITAAPKINYIHKVAYKALT--------------ENPIDEKPPAPAEEQTEKI---AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQR--------LEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES------TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            ++QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + S      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+  +  S         +    G    S + A+P +  +   +  + +               +     P   A+ Q  KI   +E    L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    + +R                                 +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + +     + + ++S+  K+   ER+L GV+RVG LA  LLL GD  VSLVLLC++ PT  L+ ++ + LP +L    P +K+++S +  E  I++    EP M+  I LTS V+REE+      T G+    P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W LEL+VEK ISS     SPG +LRR FEC++SGI+L GGPGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQI+KVL M+PLS   +  N  +N ++RR SD         KKDKK+
Sbjct:  306 QFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTTSSSTAVRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQSVTSAAVSKPSTTSSSTSGANGSSSVGASPSVKLLTSSSSLSTSSSSKASIIFNFCKMSDSAKTTPSTAAQTQEAKIDPMSEAAQTLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRVPEGGYPHGPPGPPGLLGVRPGMPPQPQGPSPLRRPDSSDDRYVMTKHAAIYPTEEELQAVQKIVSLTERALKLVSDSMADQ---DKSKTKESDDKKEPSKERALKGVLRVGVLAKGLLLRGDRNVSLVLLCAEKPTRALLSRITESLPKQLAVICP-EKYEVSCSLAEAAIILNSCVEPKMQVTITLTSPVIREENLRDGDVTPGMVK-DPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWALELLVEKAISSSSGPQSPGDALRRVFECISSGIILKGGPGLLDPCEKDPYDTLATMNDQQREDITSSAQFALRLLAFRQIYKVLGMDPLSQMNQRFNVHNNRKRRRDSDGVDSFEAEGKKDKKD 1026          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 501.516 bits (1290), Expect = 1.293e-161
Identity = 321/758 (42.35%), Postives = 439/758 (57.92%), Query Frame = 1
Query:  571 RYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN-----QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTAST---------------ENTVEIGGG--------------------------TTVSKITAAPKINYIHKVAYKALTENPIDEK---------PPAPAEEQTEKI---AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQR--------LEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES------TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            ++QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + S      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+  +  S                  +  +G                            + V K+T  PKI +I     ++ T N +D+          P   A+ Q  KI   +E    L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    + +R                                 +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + +     + + ++S+  K+   ER+L GV+RVG LA  LLL GD  VSLVLLC++ PT  L+ ++ + LP +L    P +K+++S +  E  I++    EP M+  I LTS V+REE+      T G+    P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W LEL+VEK ISS     SPG +LRR FEC++SGI+L GGPGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQI+KVL M+PLS   +  N  +N ++RR SD         KKDKK+
Sbjct:  298 QFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTTSSSTAVRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQSVTSAAVSKPSTTSSSTSGANGSSSVGASPSVKLLTSSSSLSTSSSSKASSMSSTSIVKKVTT-PKITFIGGNKLQS-TGNKVDDSKMSDSAKTTPSTAAQTQEAKIDPMSEAAQTLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRVPEGGYPHGPPGPPGLLGVRPGMPPQPQGPSPLRRPDSSDDRYVMTKHAAIYPTEEELQAVQKIVSLTERALKLVSDSMADQ---DKSKTKESDDKKEPSKERALKGVLRVGVLAKGLLLRGDRNVSLVLLCAEKPTRALLSRITESLPKQLAVICP-EKYEVSCSLAEAAIILNSCVEPKMQVTITLTSPVIREENLRDGDVTPGMVK-DPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWALELLVEKAISSSSGPQSPGDALRRVFECISSGIILKGGPGLLDPCEKDPYDTLATMNDQQREDITSSAQFALRLLAFRQIYKVLGMDPLSQMNQRFNVHNNRKRRRDSDGVDSFEAEGKKDKKD 1046          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 501.901 bits (1291), Expect = 1.482e-161
Identity = 321/758 (42.35%), Postives = 439/758 (57.92%), Query Frame = 1
Query:  571 RYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN-----QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTAST---------------ENTVEIGGG--------------------------TTVSKITAAPKINYIHKVAYKALTENPIDEK---------PPAPAEEQTEKI---AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQR--------LEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES------TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            ++QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + S      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+  +  S                  +  +G                            + V K+T  PKI +I     ++ T N +D+          P   A+ Q  KI   +E    L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    + +R                                 +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + +     + + ++S+  K+   ER+L GV+RVG LA  LLL GD  VSLVLLC++ PT  L+ ++ + LP +L    P +K+++S +  E  I++    EP M+  I LTS V+REE+      T G+    P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W LEL+VEK ISS     SPG +LRR FEC++SGI+L GGPGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQI+KVL M+PLS   +  N  +N ++RR SD         KKDKK+
Sbjct:  314 QFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTTSSSTAVRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQSVTSAAVSKPSTTSSSTSGANGSSSVGASPSVKLLTSSSSLSTSSSSKASSMSSTSIVKKVTT-PKITFIGGNKLQS-TGNKVDDSKMSDSAKTTPSTAAQTQEAKIDPMSEAAQTLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRVPEGGYPHGPPGPPGLLGVRPGMPPQPQGPSPLRRPDSSDDRYVMTKHAAIYPTEEELQAVQKIVSLTERALKLVSDSMADQ---DKSKTKESDDKKEPSKERALKGVLRVGVLAKGLLLRGDRNVSLVLLCAEKPTRALLSRITESLPKQLAVICP-EKYEVSCSLAEAAIILNSCVEPKMQVTITLTSPVIREENLRDGDVTPGMVK-DPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWALELLVEKAISSSSGPQSPGDALRRVFECISSGIILKGGPGLLDPCEKDPYDTLATMNDQQREDITSSAQFALRLLAFRQIYKVLGMDPLSQMNQRFNVHNNRKRRRDSDGVDSFEAEGKKDKKD 1062          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 501.13 bits (1289), Expect = 2.728e-161
Identity = 321/758 (42.35%), Postives = 439/758 (57.92%), Query Frame = 1
Query:  571 RYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN-----QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTAST---------------ENTVEIGGG--------------------------TTVSKITAAPKINYIHKVAYKALTENPIDEK---------PPAPAEEQTEKI---AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQR--------LEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES------TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            ++QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + S      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+  +  S                  +  +G                            + V K+T  PKI +I     ++ T N +D+          P   A+ Q  KI   +E    L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    + +R                                 +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + +     + + ++S+  K+   ER+L GV+RVG LA  LLL GD  VSLVLLC++ PT  L+ ++ + LP +L    P +K+++S +  E  I++    EP M+  I LTS V+REE+      T G+    P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W LEL+VEK ISS     SPG +LRR FEC++SGI+L GGPGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQI+KVL M+PLS   +  N  +N ++RR SD         KKDKK+
Sbjct:  313 QFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTTSSSTAVRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQSVTSAAVSKPSTTSSSTSGANGSSSVGASPSVKLLTSSSSLSTSSSSKASSMSSTSIVKKVTT-PKITFIGGNKLQS-TGNKVDDSKMSDSAKTTPSTAAQTQEAKIDPMSEAAQTLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRVPEGGYPHGPPGPPGLLGVRPGMPPQPQGPSPLRRPDSSDDRYVMTKHAAIYPTEEELQAVQKIVSLTERALKLVSDSMADQ---DKSKTKESDDKKEPSKERALKGVLRVGVLAKGLLLRGDRNVSLVLLCAEKPTRALLSRITESLPKQLAVICP-EKYEVSCSLAEAAIILNSCVEPKMQVTITLTSPVIREENLRDGDVTPGMVK-DPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWALELLVEKAISSSSGPQSPGDALRRVFECISSGIILKGGPGLLDPCEKDPYDTLATMNDQQREDITSSAQFALRLLAFRQIYKVLGMDPLSQMNQRFNVHNNRKRRRDSDGVDSFEAEGKKDKKD 1061          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 498.434 bits (1282), Expect = 3.908e-161
Identity = 321/758 (42.35%), Postives = 439/758 (57.92%), Query Frame = 1
Query:  571 RYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN-----QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTAST---------------ENTVEIGGG--------------------------TTVSKITAAPKINYIHKVAYKALTENPIDEK---------PPAPAEEQTEKI---AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQR--------LEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES------TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            ++QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + S      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+  +  S                  +  +G                            + V K+T  PKI +I     ++ T N +D+          P   A+ Q  KI   +E    L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    + +R                                 +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + +     + + ++S+  K+   ER+L GV+RVG LA  LLL GD  VSLVLLC++ PT  L+ ++ + LP +L    P +K+++S +  E  I++    EP M+  I LTS V+REE+      T G+    P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W LEL+VEK ISS     SPG +LRR FEC++SGI+L GGPGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQI+KVL M+PLS   +  N  +N ++RR SD         KKDKK+
Sbjct:  232 QFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTTSSSTAVRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQSVTSAAVSKPSTTSSSTSGANGSSSVGASPSVKLLTSSSSLSTSSSSKASSMSSTSIVKKVTT-PKITFIGGNKLQS-TGNKVDDSKMSDSAKTTPSTAAQTQEAKIDPMSEAAQTLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRVPEGGYPHGPPGPPGLLGVRPGMPPQPQGPSPLRRPDSSDDRYVMTKHAAIYPTEEELQAVQKIVSLTERALKLVSDSMAD---QDKSKTKESDDKKEPSKERALKGVLRVGVLAKGLLLRGDRNVSLVLLCAEKPTRALLSRITESLPKQLAVICP-EKYEVSCSLAEAAIILNSCVEPKMQVTITLTSPVIREENLRDGDVTPGMVK-DPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWALELLVEKAISSSSGPQSPGDALRRVFECISSGIILKGGPGLLDPCEKDPYDTLATMNDQQREDITSSAQFALRLLAFRQIYKVLGMDPLSQMNQRFNVHNNRKRRRDSDGVDSFEAEGKKDKKD 980          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Mouse
Match: Zfr (zinc finger RNA binding protein [Source:MGI Symbol;Acc:MGI:1341890])

HSP 1 Score: 504.982 bits (1299), Expect = 9.903e-163
Identity = 324/763 (42.46%), Postives = 438/763 (57.40%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXX-----NQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKST-----------TAS---------TENTVEIG------------------GGTTVSKI--------TAAPKINYIHKVAYKALTENPIDEK-------PPAPAEEQTEKIAEEH-------VDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRR-------DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG-MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATV----QPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + +      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+              TAS         T NT  I                     T VS I        T+ PKIN++     ++      D K        PA +  Q  ++ ++          L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR        D + RM +           G          Q      +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + E    ++ + ++ +  K+   +R+L GV+RVG LA  LLL GD  V+LVLLCS+ P+ +L+ ++ + LP +L    P +K+DI     E  I++    EP M+  I LTS ++REE+  EG  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS     SPG +LRR FEC++SGI+L G PGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQIHKVL M+PL    +  N  +N ++RR SD         KKDKK+
Sbjct:  314 FQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNNSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQATSSTAASASKPTASPSSIGASNCTLNTSSIATSSVKGLSTTGNSSLNSTSNTKVSAIPTNMAAKKTSTPKINFVGGNKLQSTGNKTEDLKGIDCVKNTPAASAVQIPEVKQDAGSEPVTPASLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEIRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLLGVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEH---EKSKNKEGDDKKEGGKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKSLLSRIAENLPKQLAVISP-EKYDIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGIILKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMNQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKD 1070          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Mouse
Match: Zfr2 (zinc finger RNA binding protein 2 [Source:MGI Symbol;Acc:MGI:2143792])

HSP 1 Score: 452.21 bits (1162), Expect = 7.958e-145
Identity = 272/688 (39.53%), Postives = 391/688 (56.83%), Query Frame = 1
Query:  622 MFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQRQ-LRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIG--------------GGTTVSKITAA-----PKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNP----------RNWRLQEDKIRQKQHREDFWRRRDMQARMREM-------QRLEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST----EGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAE-DKNSNGRKRRHSDEEVVIVGNQKKDKKEG 2559
            M YC+VC++SCAGPQTY++HL+GQKH+KK +  +            Q L C LC V+CTGADAY AH+RG +HQK FKLH RLGKPIP        + T  +++T E                G    +K +AA     P++  +H          P D +P     E T     E     S    ++APVG+EY+E   ++ GKVI+F CKLC C FND +A++MHL GRRHRLQY+KKVDP+L V A+   P          R+W+  + ++   +  +   R+++  +R  E        ++L      +          + +     R  ++ DD+HV+ KH+ IYPTEEEL+ + + V   E+ALR +S+ + E+                  P R L GV+RVG LA  L+L GD  V L LLCSK PT +L++++  +LP +L   +  DK+++S +D +  I+++   EP ++  +  TS ++RE+ +    +  A   PED LDR+RCL+ LA+LRH KWFQA+ + LQPC+I+IR+LR+LC+ +P W  L  W +EL+VEKV+SS P  LSPG ++RR  E +A+G LL  GPGL+DPCEK  +DA   ++ Q REDLTASAQ ALRL+AFRQIHKVL ME L         +  RKR     +      ++K  ++G
Sbjct:  204 MHYCEVCRVSCAGPQTYRDHLEGQKHRKKQAAQRTSTQPSGGPRGSQSLHCGLCAVSCTGADAYAAHMRGARHQKVFKLHTRLGKPIPSEPTPRSVTYTRGSDSTPETSVKHEAHARHSSHTQGRPAPAKGSAASRKGPPELQTMHG--------RPGDRRPSHFKVEATRGGPGE----ASGSSGDMAPVGTEYVEEVCSDEGKVIRFRCKLCECSFNDRNARDMHLTGRRHRLQYRKKVDPTLPVAARPSGPIQRVLAKRLQRHWQQVQTQLEDTRRWDSELRQQEEHSRQPEETPQPQVEEQLPGLPAWALPAPTTRPGMATARRQSGRRPESSDDRHVMCKHASIYPTEEELQAIQTAVSHTERALRLVSDTLAEE--------SSQHGTLASPPPRMLKGVVRVGILAKGLVLRGDHSVQLTLLCSKKPTHSLLQRIKQELPRELS-IVAEDKYEVS-SDHDANIVISACVEPGVKVTVSATSPLMREDPSVKQGQQDALSDPEDVLDRERCLETLAALRHAKWFQARASGLQPCVIVIRVLRELCRCLPPWGALPAWAMELLVEKVLSSAPRPLSPGDAMRRVLEYVATGALLTDGPGLQDPCEKGPQDALEPMTPQQREDLTASAQRALRLVAFRQIHKVLHMEQLPPRTRFGAGARARKRMREASQAQEGTRERKRGRQG 869          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Mouse
Match: Strbp (spermatid perinuclear RNA binding protein [Source:MGI Symbol;Acc:MGI:104626])

HSP 1 Score: 269.24 bits (687), Expect = 1.556e-78
Identity = 153/326 (46.93%), Postives = 213/326 (65.34%), Query Frame = 1
Query: 1522 DDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE-------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE----STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSA 2466
            DD+HV+ KHS IYP+ EEL+ V ++V   E AL+ +S+ + E       +   + +++E  E+  K+   R+L GVMR+G +A  LL+  D+ + LVL+C   PT TL+  V D LP ++++ L  +K+ +     E  I++   +EP +   + LTS ++R+E      E V    P D LDR++CL+ALASLRH KWFQA+   L+ C+I++RILRDLC RVPTW PL  W LELI EK I +    L  G +LRR  ECLASGILLPGGPGL DPCE++  DA S ++ Q +ED+T SAQHALRL AF QI+KVL+M+PL S+
Sbjct:   10 DDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKPEGETEVKKDEAVENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQK-LTEEKYQVEQCINEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVMMKDPPDLLDRQKCLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPTWAPLKGWPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGGPGLHDPCERDPTDALSYMTTQQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSS 334          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Mouse
Match: Zfr (zinc finger RNA binding protein [Source:MGI Symbol;Acc:MGI:1341890])

HSP 1 Score: 256.914 bits (655), Expect = 4.606e-78
Identity = 150/299 (50.17%), Postives = 200/299 (66.89%), Query Frame = 1
Query: 1555 IYPTEEELKTVHSVVVVCEKALRQISEII--FEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATV----QPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQI 2430
            IYPTEEEL+ V  +V + E+AL+ +S+ +   E    KE +++K          R+L GV+RVG LA  LLL GD  V+LVLLCS+ P+ +L+ ++ + LP +L    P +K+DI     E  I++    EP M+  I LTS ++REE+  EG  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS     SPG +LRR FEC++SGI+L G PGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQI
Sbjct:    2 IYPTEEELQAVQKIVSITERALKLVSDSLSEHEKSKNKEGDDKKEGGKDSGFCCRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKSLLSRIAENLPKQLAVISP-EKYDIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGIILKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQI 299          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Mouse
Match: Strbp (spermatid perinuclear RNA binding protein [Source:MGI Symbol;Acc:MGI:104626])

HSP 1 Score: 268.47 bits (685), Expect = 5.281e-78
Identity = 153/326 (46.93%), Postives = 213/326 (65.34%), Query Frame = 1
Query: 1522 DDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE-------DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE----STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSA 2466
            DD+HV+ KHS IYP+ EEL+ V ++V   E AL+ +S+ + E       +   + +++E  E+  K+   R+L GVMR+G +A  LL+  D+ + LVL+C   PT TL+  V D LP ++++ L  +K+ +     E  I++   +EP +   + LTS ++R+E      E V    P D LDR++CL+ALASLRH KWFQA+   L+ C+I++RILRDLC RVPTW PL  W LELI EK I +    L  G +LRR  ECLASGILLPGGPGL DPCE++  DA S ++ Q +ED+T SAQHALRL AF QI+KVL+M+PL S+
Sbjct:   10 DDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKPEGETEVKKDEAVENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQK-LTEEKYQVEQCINEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVMMKDPPDLLDRQKCLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPTWAPLKGWPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGGPGLHDPCERDPTDALSYMTTQQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSS 334          
BLAST of Zinc finger RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q96KR1|ZFR_HUMAN (Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2)

HSP 1 Score: 510.375 bits (1313), Expect = 4.709e-164
Identity = 323/763 (42.33%), Postives = 440/763 (57.67%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXX-----NQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTE--------------------NTVEIG-----GGTT---------------------VSKITAAPKINYIHKVAYKALTENPIDEK-------PPAPAEEQTEKIAEEHVD-------LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRR-------DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG-MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATV----QPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + +      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+   T+ST                     NT  +      G TT                      +K T+ PKIN++     ++      D K        P  +  Q  ++ ++ V        L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR        D + RM +           G          Q      +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + E    ++ + ++ +  K+   +R+L GV+RVG LA  LLL GD  V+LVLLCS+ P+ TL+ ++ + LP +L    P +K+DI     E  I++    EP M+  I LTS ++REE+  EG  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS     SPG +LRR FEC++SGI+L G PGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQIHKVL M+PL   ++  N  +N ++RR SD         KKDKK+
Sbjct:  314 FQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNSSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQATSSTAVSASKPTASPSSIAANNCTVNTSSVATSSMKGLTTTGNSSLNSTSNTKVSAVPTNMAAKKTSTPKINFVGGNKLQSTGNKAEDIKGTECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLLGVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEH---EKNKNKEGDDKKEGGKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKTLLSRIAENLPKQLAVISP-EKYDIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGIILKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKD 1070          
BLAST of Zinc finger RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q5REX3|ZFR_PONAB (Zinc finger RNA-binding protein OS=Pongo abelii OX=9601 GN=ZFR PE=2 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 7.045e-164
Identity = 323/763 (42.33%), Postives = 437/763 (57.27%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXX-----XXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTE--------------------NTVEIG-----GGTT---------------------VSKITAAPKINYIHKVAYKALTENPIDEK-------PPAPAEEQTEKIAEEHVD-------LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQ---------------------HRED-FWRRR-------DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG-MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATV----QPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +           +  T+  Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+   T+ST                     NT  I      G TT                      +K T+ PKIN++     ++      D K        P  +  Q  ++ ++ V        L  LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++                      + ED +WRR        D + RM +           G          Q      +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + E    ++ + ++ +  K+   +R+L GV+RVG LA  LLL GD  V+LVLLCS+ P+ TL+ ++ + LP +L    P +K+DI     E  I++    EP M+  I LTS ++REE+  EG  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS     SPG +LRR FEC++SGI+L G PGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQIHKVL M+PL   ++  N  +N ++RR SD         KKDKK+
Sbjct:  314 FQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNASSSNNSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQATSSTAVSASKPTASPSSIAANNCTVNTSSIATSSMKGLTTTGNSSLNSTSNTKVSAVPTNMAAKKTSTPKINFVGGNKLQSTGNKTEDIKGTECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAVLQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQREEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLLGVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEH---EKNKNKEGDDKKEGSKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKTLLSRIAENLPKQLAVISP-EKYDIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGIILKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKD 1070          
BLAST of Zinc finger RNA-binding protein vs. UniProt/SwissProt
Match: sp|O88532|ZFR_MOUSE (Zinc finger RNA-binding protein OS=Mus musculus OX=10090 GN=Zfr PE=1 SV=2)

HSP 1 Score: 504.982 bits (1299), Expect = 6.927e-162
Identity = 324/763 (42.46%), Postives = 438/763 (57.40%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXX-----NQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKST-----------TAS---------TENTVEIG------------------GGTTVSKI--------TAAPKINYIHKVAYKALTENPIDEK-------PPAPAEEQTEKIAEEH-------VDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRR-------DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG-MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATV----QPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + +      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+              TAS         T NT  I                     T VS I        T+ PKIN++     ++      D K        PA +  Q  ++ ++          L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR        D + RM +           G          Q      +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + E    ++ + ++ +  K+   +R+L GV+RVG LA  LLL GD  V+LVLLCS+ P+ +L+ ++ + LP +L    P +K+DI     E  I++    EP M+  I LTS ++REE+  EG  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS     SPG +LRR FEC++SGI+L G PGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQIHKVL M+PL    +  N  +N ++RR SD         KKDKK+
Sbjct:  314 FQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNNSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQATSSTAASASKPTASPSSIGASNCTLNTSSIATSSVKGLSTTGNSSLNSTSNTKVSAIPTNMAAKKTSTPKINFVGGNKLQSTGNKTEDLKGIDCVKNTPAASAVQIPEVKQDAGSEPVTPASLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEIRRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLLGVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEH---EKSKNKEGDDKKEGGKDRALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKSLLSRIAENLPKQLAVISP-EKYDIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASSPQSPGDALRRVFECISSGIILKGSPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQMNQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKD 1070          
BLAST of Zinc finger RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q5U231|ZFR_XENTR (Zinc finger RNA-binding protein OS=Xenopus tropicalis OX=8364 GN=zfr PE=2 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 1.445e-160
Identity = 321/758 (42.35%), Postives = 439/758 (57.92%), Query Frame = 1
Query:  571 RYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN-----QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTAST---------------ENTVEIGGG--------------------------TTVSKITAAPKINYIHKVAYKALTENPIDEK---------PPAPAEEQTEKI---AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQR--------LEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES------TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            ++QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + S      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+  +  S                  +  +G                            + V K+T  PKI +I     ++ T N +D+          P   A+ Q  KI   +E    L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR + +    + +R                                 +R  D+ DD++V+ KH+ IYPTEEEL+ V  +V + E+AL+ +S+ + +     + + ++S+  K+   ER+L GV+RVG LA  LLL GD  VSLVLLC++ PT  L+ ++ + LP +L    P +K+++S +  E  I++    EP M+  I LTS V+REE+      T G+    P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W LEL+VEK ISS     SPG +LRR FEC++SGI+L GGPGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQI+KVL M+PLS   +  N  +N ++RR SD         KKDKK+
Sbjct:  313 QFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTTSSSTAVRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQSVTSAAVSKPSTTSSSTSGANGSSSVGASPSVKLLTSSSSLSTSSSSKASSMSSTSIVKKVTT-PKITFIGGNKLQS-TGNKVDDSKMSDSAKTTPSTAAQTQEAKIDPMSEAAQTLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRVPEGGYPHGPPGPPGLLGVRPGMPPQPQGPSPLRRPDSSDDRYVMTKHAAIYPTEEELQAVQKIVSLTERALKLVSDSMADQ---DKSKTKESDDKKEPSKERALKGVLRVGVLAKGLLLRGDRNVSLVLLCAEKPTRALLSRITESLPKQLAVICP-EKYEVSCSLAEAAIILNSCVEPKMQVTITLTSPVIREENLRDGDVTPGMVK-DPPDVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWALELLVEKAISSSSGPQSPGDALRRVFECISSGIILKGGPGLLDPCEKDPYDTLATMNDQQREDITSSAQFALRLLAFRQIYKVLGMDPLSQMNQRFNVHNNRKRRRDSDGVDSFEAEGKKDKKD 1061          
BLAST of Zinc finger RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q6GPM1|ZFR_XENLA (Zinc finger RNA-binding protein OS=Xenopus laevis OX=8355 GN=zfr PE=2 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 4.842e-158
Identity = 326/755 (43.18%), Postives = 441/755 (58.41%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN-----QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVS---------------------------------------KITAAPKINYIHKVAYKALTENPIDEK---------PPAPAEEQTEKI---AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHRE---------DFWR---RR---DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHG---------------MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES------TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKN--SNGRKRRHSDEEVVIVGNQKKDKKE 2556
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +  K   +T + S      Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P V+  +  S  +       +T S                                       K+T  PKI +I     ++ T N +D+          P + A+ Q  KI   +E    L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +E         D WR   RR   DM  R  E ++  + +                                   +R  D+ DD++V+ KH+ IYPTE+EL+ V  +V + E+AL+ +S+ + +     + + ++S+  K+   ER+L GV+RVG LA  LLL GD  V+LVLLCS+ PT  L+  + + LP +L    P +KF+++ +  E  I++    EP M+  I LTS V+REE+      T G+    P D LDR++CLDALASLRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+   +W LEL+VEK ISS     SPG +LRR FEC++SGI+L GGPGL DPCEK+  D  + ++DQ RED+T+SAQ ALRL+AFRQI+KVL M+PLS   +  N  SN ++RR SD         KKDKK+
Sbjct:  305 FQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTTSSSTAVRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQSVTSAVSKASATSSSTSSANGSSSVASPAVKLLTSSSSMSTSNSSKVSSISSTSIVKKVTT-PKITFIGGNKLQS-TGNKVDDSKMSDISKATPSSAAQTQEVKIDPMSEAAQTLAALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEDQWRMEMRRYEEDMYWRRMEEEQHHWDDRRRVPEGGYPHGPPGPPGLLGVRPGMPPQPQGPAPLRRPDSSDDRYVMTKHAAIYPTEDELQAVQKIVSLTERALKLVSDSMTDQ---DKTKTKESDEKKEPTKERALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPTRALLSCISESLPTQLAVICP-EKFEVTSSIPEAAIILNSCVEPKMQVTITLTSPVIREETPRDGDVTPGMVK-DPPDVLDRQKCLDALASLRHAKWFQARANGLQSCVIVIRILRDLCQRVPTWSDFPNWALELLVEKAISSSSGPQSPGDALRRVFECISSGIILKGGPGLLDPCEKDPYDTLATMNDQQREDITSSAQFALRLLAFRQIYKVLGMDPLSQTNQRFNVHSNRKRRRDSDSVDSFEAEGKKDKKD 1050          
BLAST of Zinc finger RNA-binding protein vs. TrEMBL
Match: A0A2C9K2A4 (DZF domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078671 PE=4 SV=1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 328/704 (46.59%), Postives = 440/704 (62.50%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVI--KSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQ------TEKIAEEHVD-LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLE--------------------YXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXX----------------------XXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST---EGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAA-EDKNSNGRKRRHSD---EEVVIVGNQKKDKKE 2556
            Q+ YCDVCKISCAGPQTY+EHL+GQKHKKK +  K    +  + +  Q+RCELCDVTCTG DAY AHIRG KHQK  KLH +LGKPIP A+P+V   KS+  +T     +   T   K+  APKIN++     K L   P + K                 ++++  D  NS  EK++ PVG EYIE  KNE GK++ F CKLC+CKFNDP+AKEMHLKGRRHRLQ+KKKVDP+L V+ K  + R  ++QEDK+R++  +E+FWRR++ Q R+RE  R+E                    + +                ++  +R  D+ DD+HV+ KH  IYPTEEEL+ V ++V  CEKAL+ +S+++ ++    ++ E+                                 R L GVMRVG LA  LLLHGDL V+LV+LCS+ PT T++ +V D LP +L + + ++ +++    EE  I+V+   EP   C I LTS ++RE++    E V    P D LDR++CLDALA+LRH KWFQA+   L  C+I+IRILRDLCQRVP+W PL +W +EL+VEK +S+  I ++PG SLRR FEC++SGI LPGGPGL DPCEKE  D ++ L++Q RED+TA AQHALRLIAFRQIHKVL M+PL +     K  + RKRRH++   EE    G +KKD+KE
Sbjct:  235 QLHYCDVCKISCAGPQTYREHLEGQKHKKKEAALKASQPSGRQ-SHNQMRCELCDVTCTGQDAYAAHIRGAKHQKVVKLHTKLGKPIPSAEPVVSTNKSSGKTTAKAATVPTATVAKKVLPAPKINFVGGTQLKTLAGKPEEVKTATTTTTTAVGSVDAASMSDDDGDESNSASEKDVTPVGHEYIEEIKNEIGKLVSFNCKLCDCKFNDPNAKEMHLKGRRHRLQFKKKVDPNLQVEVKP-SIRVRKIQEDKMRRQAQKEEFWRRKEQQERLREEMRMEDEIYWGHRRMEMMGGPIPPEFMDWQRFGPMGPMMRAPFPMHPMLRRPDSSDDRHVMTKHHSIYPTEEELQAVQNIVSACEKALKLVSDVLADNDTKDKKAEKPDTKKVAVKIETTSETEKEGEKKEKEKEESTATRVLKGVMRVGVLAKGLLLHGDLNVNLVVLCSEKPTRTILEQVADALPKQL-QTVTSEVYEVRRCVEEAAIIVSSDVEPQTSCTITLTSPIMREQNQPEGETVNVKDPPDVLDRQKCLDALAALRHAKWFQARANGLPSCVIIIRILRDLCQRVPSWAPLNEWAMELLVEKCVSTGGINMAPGDSLRRVFECISSGIFLPGGPGLYDPCEKEAYDVTATLTNQQREDITALAQHALRLIAFRQIHKVLGMDPLPAPRFPTKRFSNRKRRHTNSTGEE----GAEKKDRKE 931          
BLAST of Zinc finger RNA-binding protein vs. TrEMBL
Match: A0A2C9K2B7 (DZF domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078671 PE=4 SV=1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 328/704 (46.59%), Postives = 440/704 (62.50%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVI--KSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQ------TEKIAEEHVD-LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLE--------------------YXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXX----------------------XXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST---EGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAA-EDKNSNGRKRRHSD---EEVVIVGNQKKDKKE 2556
            Q+ YCDVCKISCAGPQTY+EHL+GQKHKKK +  K    +  + +  Q+RCELCDVTCTG DAY AHIRG KHQK  KLH +LGKPIP A+P+V   KS+  +T     +   T   K+  APKIN++     K L   P + K                 ++++  D  NS  EK++ PVG EYIE  KNE GK++ F CKLC+CKFNDP+AKEMHLKGRRHRLQ+KKKVDP+L V+ K  + R  ++QEDK+R++  +E+FWRR++ Q R+RE  R+E                    + +                ++  +R  D+ DD+HV+ KH  IYPTEEEL+ V ++V  CEKAL+ +S+++ ++    ++ E+                                 R L GVMRVG LA  LLLHGDL V+LV+LCS+ PT T++ +V D LP +L + + ++ +++    EE  I+V+   EP   C I LTS ++RE++    E V    P D LDR++CLDALA+LRH KWFQA+   L  C+I+IRILRDLCQRVP+W PL +W +EL+VEK +S+  I ++PG SLRR FEC++SGI LPGGPGL DPCEKE  D ++ L++Q RED+TA AQHALRLIAFRQIHKVL M+PL +     K  + RKRRH++   EE    G +KKD+KE
Sbjct:  236 QLHYCDVCKISCAGPQTYREHLEGQKHKKKEAALKASQPSGRQ-SHNQMRCELCDVTCTGQDAYAAHIRGAKHQKVVKLHTKLGKPIPSAEPVVSTNKSSGKTTAKAATVPTATVAKKVLPAPKINFVGGTQLKTLAGKPEEVKTATTTTTTAVGSVDAASMSDDDGDESNSASEKDVTPVGHEYIEEIKNEIGKLVSFNCKLCDCKFNDPNAKEMHLKGRRHRLQFKKKVDPNLQVEVKP-SIRVRKIQEDKMRRQAQKEEFWRRKEQQERLREEMRMEDEIYWGHRRMEMMGGPIPPEFMDWQRFGPMGPMMRAPFPMHPMLRRPDSSDDRHVMTKHHSIYPTEEELQAVQNIVSACEKALKLVSDVLADNDTKDKKAEKPDTKKVAVKIETTSETEKEGEKKEKEKEESTATRVLKGVMRVGVLAKGLLLHGDLNVNLVVLCSEKPTRTILEQVADALPKQL-QTVTSEVYEVRRCVEEAAIIVSSDVEPQTSCTITLTSPIMREQNQPEGETVNVKDPPDVLDRQKCLDALAALRHAKWFQARANGLPSCVIIIRILRDLCQRVPSWAPLNEWAMELLVEKCVSTGGINMAPGDSLRRVFECISSGIFLPGGPGLYDPCEKEAYDVTATLTNQQREDITALAQHALRLIAFRQIHKVLGMDPLPAPRFPTKRFSNRKRRHTNSTGEE----GAEKKDRKE 932          
BLAST of Zinc finger RNA-binding protein vs. TrEMBL
Match: A0A2C9K2B0 (DZF domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078671 PE=4 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 328/704 (46.59%), Postives = 440/704 (62.50%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVI--KSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQ------TEKIAEEHVD-LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLE--------------------YXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXX----------------------XXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST---EGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAA-EDKNSNGRKRRHSD---EEVVIVGNQKKDKKE 2556
            Q+ YCDVCKISCAGPQTY+EHL+GQKHKKK +  K    +  + +  Q+RCELCDVTCTG DAY AHIRG KHQK  KLH +LGKPIP A+P+V   KS+  +T     +   T   K+  APKIN++     K L   P + K                 ++++  D  NS  EK++ PVG EYIE  KNE GK++ F CKLC+CKFNDP+AKEMHLKGRRHRLQ+KKKVDP+L V+ K  + R  ++QEDK+R++  +E+FWRR++ Q R+RE  R+E                    + +                ++  +R  D+ DD+HV+ KH  IYPTEEEL+ V ++V  CEKAL+ +S+++ ++    ++ E+                                 R L GVMRVG LA  LLLHGDL V+LV+LCS+ PT T++ +V D LP +L + + ++ +++    EE  I+V+   EP   C I LTS ++RE++    E V    P D LDR++CLDALA+LRH KWFQA+   L  C+I+IRILRDLCQRVP+W PL +W +EL+VEK +S+  I ++PG SLRR FEC++SGI LPGGPGL DPCEKE  D ++ L++Q RED+TA AQHALRLIAFRQIHKVL M+PL +     K  + RKRRH++   EE    G +KKD+KE
Sbjct:  229 QLHYCDVCKISCAGPQTYREHLEGQKHKKKEAALKASQPSGRQ-SHNQMRCELCDVTCTGQDAYAAHIRGAKHQKVVKLHTKLGKPIPSAEPVVSTNKSSGKTTAKAATVPTATVAKKVLPAPKINFVGGTQLKTLAGKPEEVKTATTTTTTAVGSVDAASMSDDDGDESNSASEKDVTPVGHEYIEEIKNEIGKLVSFNCKLCDCKFNDPNAKEMHLKGRRHRLQFKKKVDPNLQVEVKP-SIRVRKIQEDKMRRQAQKEEFWRRKEQQERLREEMRMEDEIYWGHRRMEMMGGPIPPEFMDWQRFGPMGPMMRAPFPMHPMLRRPDSSDDRHVMTKHHSIYPTEEELQAVQNIVSACEKALKLVSDVLADNDTKDKKAEKPDTKKVAVKIETTSETEKEGEKKEKEKEESTATRVLKGVMRVGVLAKGLLLHGDLNVNLVVLCSEKPTRTILEQVADALPKQL-QTVTSEVYEVRRCVEEAAIIVSSDVEPQTSCTITLTSPIMREQNQPEGETVNVKDPPDVLDRQKCLDALAALRHAKWFQARANGLPSCVIIIRILRDLCQRVPSWAPLNEWAMELLVEKCVSTGGINMAPGDSLRRVFECISSGIFLPGGPGLYDPCEKEAYDVTATLTNQQREDITALAQHALRLIAFRQIHKVLGMDPLPAPRFPTKRFSNRKRRHTNSTGEE----GAEKKDRKE 925          
BLAST of Zinc finger RNA-binding protein vs. TrEMBL
Match: A0A2C9K299 (DZF domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078671 PE=4 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 328/704 (46.59%), Postives = 440/704 (62.50%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVI--KSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQ------TEKIAEEHVD-LNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLE--------------------YXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXX----------------------XXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST---EGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAA-EDKNSNGRKRRHSD---EEVVIVGNQKKDKKE 2556
            Q+ YCDVCKISCAGPQTY+EHL+GQKHKKK +  K    +  + +  Q+RCELCDVTCTG DAY AHIRG KHQK  KLH +LGKPIP A+P+V   KS+  +T     +   T   K+  APKIN++     K L   P + K                 ++++  D  NS  EK++ PVG EYIE  KNE GK++ F CKLC+CKFNDP+AKEMHLKGRRHRLQ+KKKVDP+L V+ K  + R  ++QEDK+R++  +E+FWRR++ Q R+RE  R+E                    + +                ++  +R  D+ DD+HV+ KH  IYPTEEEL+ V ++V  CEKAL+ +S+++ ++    ++ E+                                 R L GVMRVG LA  LLLHGDL V+LV+LCS+ PT T++ +V D LP +L + + ++ +++    EE  I+V+   EP   C I LTS ++RE++    E V    P D LDR++CLDALA+LRH KWFQA+   L  C+I+IRILRDLCQRVP+W PL +W +EL+VEK +S+  I ++PG SLRR FEC++SGI LPGGPGL DPCEKE  D ++ L++Q RED+TA AQHALRLIAFRQIHKVL M+PL +     K  + RKRRH++   EE    G +KKD+KE
Sbjct:  232 QLHYCDVCKISCAGPQTYREHLEGQKHKKKEAALKASQPSGRQ-SHNQMRCELCDVTCTGQDAYAAHIRGAKHQKVVKLHTKLGKPIPSAEPVVSTNKSSGKTTAKAATVPTATVAKKVLPAPKINFVGGTQLKTLAGKPEEVKTATTTTTTAVGSVDAASMSDDDGDESNSASEKDVTPVGHEYIEEIKNEIGKLVSFNCKLCDCKFNDPNAKEMHLKGRRHRLQFKKKVDPNLQVEVKP-SIRVRKIQEDKMRRQAQKEEFWRRKEQQERLREEMRMEDEIYWGHRRMEMMGGPIPPEFMDWQRFGPMGPMMRAPFPMHPMLRRPDSSDDRHVMTKHHSIYPTEEELQAVQNIVSACEKALKLVSDVLADNDTKDKKAEKPDTKKVAVKIETTSETEKEGEKKEKEKEESTATRVLKGVMRVGVLAKGLLLHGDLNVNLVVLCSEKPTRTILEQVADALPKQL-QTVTSEVYEVRRCVEEAAIIVSSDVEPQTSCTITLTSPIMREQNQPEGETVNVKDPPDVLDRQKCLDALAALRHAKWFQARANGLPSCVIIIRILRDLCQRVPSWAPLNEWAMELLVEKCVSTGGINMAPGDSLRRVFECISSGIFLPGGPGLYDPCEKEAYDVTATLTNQQREDITALAQHALRLIAFRQIHKVLGMDPLPAPRFPTKRFSNRKRRHTNSTGEE----GAEKKDRKE 928          
BLAST of Zinc finger RNA-binding protein vs. TrEMBL
Match: A0A433U0U1 (DZF domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_004777 PE=4 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 335/700 (47.86%), Postives = 436/700 (62.29%), Query Frame = 1
Query:  619 QMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTA------STENTVEIGGGTTVSKITAAPKINYIHKVAYKAL--------TENPIDEKPPAPAEEQTEKIAEEHVDL-NSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLE--------------------YXXXXXXXXXXXXXXXXXXIN-HGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFED--------------MXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST---EGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAA-EDKNSNGRKRRHSDEEVVIVGNQKKDKKE 2556
            Q+ YCDVCKISCAGPQTY+EHL+GQKHKKK +  KV   T  + +  Q+RCELCDVTCTG DAY AHIRG KHQK  KLH +LGKPIP A+P+V  +         +    V +   T   K+ AAPKIN++     K+L        T   +    P  ++ Q     +E  D  NS  EK++APVG EYIE  KNE GK + F CKLC+CKFNDP+AKEMHLKGRRHRLQYKKKVDP+L V+ K    +  ++QEDK+R++  +E+FWRR++ Q R+RE  R+E                    + +                ++   MR  D+ DD+HV++KH  IYPTEEEL+ V ++V  CEKAL+ +S+ + ++                  EE E+  +  +  +  R L GVMRVG LA  LLLHGDL V+LV+LCS+ PT TL+ +V D LP +L      ++ ++    EE  I+V    EP   C I LTS V+RE +    E V    P D LDR++CLDALA+LRH KWFQA+   L  C+I+IRILRDLCQRVP W PL +W +EL+VEK +S+    ++PG SLRR FEC+ASGI+LPGGPGL DPCEKE  D ++ L++Q RED+TA AQHALRLIAFRQIHKVL M+P+ +     K  N RKRRH++      G +KKD+KE
Sbjct:  225 QLHYCDVCKISCAGPQTYREHLEGQKHKKKEAALKVSQPTGRQPHN-QMRCELCDVTCTGQDAYAAHIRGAKHQKVVKLHTKLGKPIPSAEPVVTPAAVPKPAAKPAPGKAVVVQSNTAAKKVLAAPKINFVGGTQLKSLGGKTEEVKTAAVVAPTTPTTSDNQASLSEDEGDDAGNSSAEKDVAPVGHEYIEEIKNEMGKTVSFNCKLCDCKFNDPNAKEMHLKGRRHRLQYKKKVDPNLQVEVKPSI-KVRKIQEDKLRRQAQKEEFWRRKEQQERLREEMRMEDEIYWGHRRMEMMGGPMPPDFMDWQRFGPMGPMMRAPFPMHPMQMRRPDSSDDRHVMSKHHSIYPTEEELQAVQNIVSACEKALKLVSDTLADNENKDKLPEKTETKKTAKAEEAEKDGDKKEDAISTRVLKGVMRVGVLAKGLLLHGDLNVNLVVLCSEKPTRTLLEQVADALPKQLATVT-TEELEVRRCVEEAAIIVRSDVEPSATCTITLTSPVMRESNLNEGETVNVKDPPDVLDRQKCLDALAALRHAKWFQARANGLPSCVIIIRILRDLCQRVPAWTPLNEWAMELLVEKCVSTGAASMAPGDSLRRVFECIASGIILPGGPGLYDPCEKEAYDVTATLTNQQREDITALAQHALRLIAFRQIHKVLGMDPMPAGRFAAKRFNNRKRRHTN-STGEDGGEKKDRKE 920          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Cavefish
Match: zfr2 (zinc finger RNA-binding protein-like [Source:NCBI gene;Acc:103035531])

HSP 1 Score: 515.768 bits (1327), Expect = 7.746e-168
Identity = 306/705 (43.40%), Postives = 406/705 (57.59%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXN---QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPA--PAEEQTEKIAE----------EHVDLNSLQEK--------------NIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIR-QKQ-----------HREDFWRRR---DMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGM---RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEG------------VATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSD 2511
            +QN+  + +      Q+ YCD+CKISCAGPQTY+EHL+GQKHKKK +  K             Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P+++        N+  +   TT  K TA        +V  K +  NP     PA  PA  +   IA           E V L  L +               +I PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AK+MHLKGRRHRLQYKKKV+P L+V+ K  N R  +L E K+R QKQ           HR     RR   DM  R  E + L +             S        +   R  D+ DD+H+++KH+ IYP EEEL+ V  +V   E+AL+ +S+ + E       + ++    + +   R L GVMRVG LA  LLLHGD  V L+LL +K PT +L+  + ++LP +LK F   D++++  + EE  I++   +EP M+  + LTS V+RE+   G            V    P D L+RK+CL+ LA+LRH KWFQA+   LQ C+I+IR+LRDLCQRVPTW  +  W +EL+VEK ISS    LSPG ++RR  EC+ASGILL  GPGL DPCEK   DA   ++ Q RED+TASAQHALRL+AFRQ+HKVL +E L ++     +  R+R  +D
Sbjct:  296 HQNKVQKPKGPPKQPQLHYCDICKISCAGPQTYREHLEGQKHKKKEASQKSGSQATNGPRGGVQTQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPVLV--------NSAPVPVTTTSGKPTAPAVAPASPRVPQKPIEPNPTKGPQPAKKPALSKASVIANKAAAPEPVKVEEVKLAVLNQDPLSDDEGDSCGAQGDIQPVGHDYVEEVRNDDGKVIRFHCKLCECSFNDPNAKDMHLKGRRHRLQYKKKVNPDLLVEIKPSN-RARKLLEGKLRKQKQKAVLKRQQEDEHRWHMEMRRYEEDMYWRKAEEEHLYWGEQRRRMAPPPLMSRPGMPVPPLLPVRRPDSPDDRHIMSKHATIYPVEEELQAVQQIVSHSERALKLVSDSLLEQ--ETVSQGKEEMDKQLDSQSRMLKGVMRVGILAKGLLLHGDRNVQLILLAAKKPTMSLLNSIAEQLPKQLKTFS-EDQYEVQAHPEESNIVIISSKEPKMQVTVCLTSPVMREDPASGPEEQAGLKLPEKVPEKDPPDVLNRKKCLEYLAALRHAKWFQARANGLQSCVIIIRLLRDLCQRVPTWGKMPAWAMELMVEKAISSASGPLSPGEAMRRVLECIASGILLQDGPGLFDPCEKIQTDALGCMTKQAREDVTASAQHALRLLAFRQVHKVLGIESLPASKASARNRKRRRDGTD 988          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Cavefish
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:103021415])

HSP 1 Score: 493.812 bits (1270), Expect = 6.623e-159
Identity = 320/775 (41.29%), Postives = 440/775 (56.77%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXX--------XXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCAD----------------------------------------------PLVIKSTTASTENTVEIGGGTTVSKITAA------PKINYI--HKVA--------YKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQ--EKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGM-----------RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES------TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEP---LSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKE 2556
            +QN+ L+ ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +         +    S+  +  Q QLRCELCDV CTGADAY AHIRG KHQK  KLH +LGKPIP  +                                              PL + ++T ++    +    +++S  +AA      PKIN++  +K+          K  T  P      AP++E    I +     ++L   + ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR  M+                         G   +  GM           R  D+ DD++V+ KH+ IYP+E+EL+ +  +V + E+AL+ +S+II +    KE+E+EK E  K     R+L GVMRVG LA  LLL GD  V+LVLLCS+ P+ +L+ ++++ LP +L    P +K+++  + +E  I++T   +P M+  I LTS V+REE       T G+    P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRVPTW+    W +EL+VEK ISS    +SPG +LRR FEC++SGILLPGGPGL DPCEK   D    + +Q RED+T+SAQ ALRL+AFRQIHKVL M+P   L+     +N+  R+R +SD      G  KKDKK+
Sbjct:  284 FQNKPLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKVSQSSSSSSGGSSSARGTQNQLRCELCDVACTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPSVVTQASTSTTSATSKTASAAINSSTSSTVSSLSSSSSISSSYLKPLGMVNSTLTSAVQGKSPAPSSLSATSAAVKKVNTPKINFVGGNKLQTTGVKMDDSKVETAKPAQLSLVAPSQEVKNDIPDPMSPQSALAALQSDVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRR--MEEEQHHWDDRRRMPEGGYPQGPPGPPGLLGVRPGMPMPQPQGPVPPRRPDSSDDRYVMTKHAAIYPSEDELQAIQKIVSITERALKLVSDIITDQDKGKEDEKEKKEPPKD----RALKGVMRVGVLAKGLLLRGDKNVNLVLLCSEKPSKSLLSRIVEHLPKQLTLVTP-EKYEVKGSVQESAIILTSGADPKMQVTITLTSPVIREEGPRDGDVTSGMVK-DPADVLDRQKCLDALAALRHAKWFQARANGLQSCVIVIRILRDLCQRVPTWSAFPSWAMELLVEKAISSASGPMSPGDALRRVFECISSGILLPGGPGLVDPCEKNPTDTLGAMEEQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQLNQRFNMRNNRKRRRDNSDGTDGFEGEGKKDKKD 1049          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Cavefish
Match: ilf3b (interleukin enhancer binding factor 3 [Source:NCBI gene;Acc:103029462])

HSP 1 Score: 263.077 bits (671), Expect = 5.926e-76
Identity = 163/334 (48.80%), Postives = 213/334 (63.77%), Query Frame = 1
Query: 1501 MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXX--------XXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES-----TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSS 2463
            MR F   DD+HV+AKHS IYPT+EEL+ V ++V   E+AL+ +S+ + E      + +         +SE    E   RSL GVMRVG +A  LLL GDL + LVLLC   PT TL+RKV + L  +LK  +  DK++++ +  E  I++   ++P +   I LTS VVREE+      E ++   P D LDR++CL ALASLRH KWFQA+   L+ C+I+IRILRDLC RVPTW PL  W LEL+ EK I +    +  G +LRR  ECLASGIL+  G G+ DPCEK+  DA   +  Q RED+T SAQHALRL AF Q+HKVL M+PL S
Sbjct:   10 MRIF-VNDDRHVMAKHSAIYPTQEELEAVQNMVSHTERALKAVSDWLDEQERGTAKTQTDTDVDGEKESEPKTAEQATRSLRGVMRVGLVAKGLLLKGDLGLELVLLCKDKPTTTLLRKVAENLGVQLK-LITEDKYEVTPSIREASIVIKNAKQPPLSLTIHLTSPVVREEAEKRAAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLRSCVIVIRILRDLCARVPTWAPLRGWPLELLCEKAIGTGNRPMGAGEALRRVLECLASGILMADGSGISDPCEKDPTDAIGHMDYQQREDITQSAQHALRLSAFGQLHKVLGMDPLPS 341          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Cavefish
Match: ilf3b (interleukin enhancer binding factor 3 [Source:NCBI gene;Acc:103029462])

HSP 1 Score: 265.774 bits (678), Expect = 1.207e-75
Identity = 163/334 (48.80%), Postives = 213/334 (63.77%), Query Frame = 1
Query: 1501 MRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXX--------XXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREES-----TEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSS 2463
            MR F   DD+HV+AKHS IYPT+EEL+ V ++V   E+AL+ +S+ + E      + +         +SE    E   RSL GVMRVG +A  LLL GDL + LVLLC   PT TL+RKV + L  +LK  +  DK++++ +  E  I++   ++P +   I LTS VVREE+      E ++   P D LDR++CL ALASLRH KWFQA+   L+ C+I+IRILRDLC RVPTW PL  W LEL+ EK I +    +  G +LRR  ECLASGIL+  G G+ DPCEK+  DA   +  Q RED+T SAQHALRL AF Q+HKVL M+PL S
Sbjct:   10 MRIF-VNDDRHVMAKHSAIYPTQEELEAVQNMVSHTERALKAVSDWLDEQERGTAKTQTDTDVDGEKESEPKTAEQATRSLRGVMRVGLVAKGLLLKGDLGLELVLLCKDKPTTTLLRKVAENLGVQLK-LITEDKYEVTPSIREASIVIKNAKQPPLSLTIHLTSPVVREEAEKRAAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLRSCVIVIRILRDLCARVPTWAPLRGWPLELLCEKAIGTGNRPMGAGEALRRVLECLASGILMADGSGISDPCEKDPTDAIGHMDYQQREDITQSAQHALRLSAFGQLHKVLGMDPLPS 341          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Cavefish
Match: strbp (spermatid perinuclear RNA binding protein [Source:ZFIN;Acc:ZDB-GENE-030729-18])

HSP 1 Score: 253.832 bits (647), Expect = 2.400e-73
Identity = 150/336 (44.64%), Postives = 209/336 (62.20%), Query Frame = 1
Query: 1537 LAKHSVIYPTEEELKTVHSVVVVCEKALRQISEII----FEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAA-------EDKNSNGRKRRHSD 2511
            +AKHS IYP+ E+L+ V S+V   E AL+ +S+ +     ++    E   ++S         R L GV+R+G +A  LL+  D+ + LVL+C + PT TL+  V D LP ++ E L  +K+++     E  IL+    EP +   + LTS ++RE+  E  +  +P D LD++RCL ALASLRH KWFQA+V  L+  +I++RILRD+C RVP W PL  W LEL+ EK I++    L  G +LRR  ECLASGILLPGGPGL DPCEKE  D  S ++D++ E +T SAQH LRL+AF QI+KVL+M+PL S+         DK   G KR + D
Sbjct:    1 MAKHSTIYPSSEDLEAVQSLVSTVECALKHVSDWLDKSQCKEEAEAEASADESAEGSGADGGRVLCGVVRIGLVAKGLLIKEDMDLELVLMCREKPTQTLLSTVCDHLPQQI-EKLTEEKYEVQCCIPEAAILIRSTTEPKLTLKVMLTSPLIREDEEETAS--EPADLLDKQRCLVALASLRHAKWFQARVNGLKSGVIVLRILRDMCNRVPAWEPLKGWPLELLCEKAIATCNRPLGAGEALRRVMECLASGILLPGGPGLHDPCEKEPTDTLSAMTDEEAEAVTYSAQHFLRLMAFGQIYKVLEMDPLPSSKPSQKYPWSDKEGTGLKRPYED 333          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Sea Lamprey
Match: ilf3a (interleukin enhancer binding factor 3a [Source:ZFIN;Acc:ZDB-GENE-030131-3151])

HSP 1 Score: 229.95 bits (585), Expect = 2.900e-65
Identity = 143/336 (42.56%), Postives = 196/336 (58.33%), Query Frame = 1
Query: 1522 DDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXX---------------XRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST--------EGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLS 2460
            DD+H LAKH+ +YPT+ EL+ V  +V   EKAL+ +S+ I +    K+  E+  E+                     +R+L GVMRVG +A  LLL GD  + LVLLC + PT  L+ +V + LP +LK  + N++F + +   E  ++++R+ EP +   + LTS +VREE          E V   +  D LDR+ CL ALASLR  KWFQA+ + L+ C+I+IR+LR L    P W PL  W LELI EK + +    +  G  LRR  ECL+SG+L+P GPGL DPCEK   D  S LS Q  E LT SAQ+ LR +AF  +HKVL ME L+
Sbjct:   10 DDRHALAKHTEVYPTQAELEAVQEMVTTTEKALKLVSDSIDQTDQAKQSSEQVDEAPVTVKAEPGDVAVKEKPAEPPKRTLRGVMRVGKVAKGLLLTGDTDLELVLLCREKPTLHLLSRVSESLPAQLKA-VKNEEFLVEMRANEASVVISRQTEPFLTLTVTLTSPLVREEMEQQEEGGDGEKVTVKEAPDVLDRQHCLKALASLRRAKWFQARASPLRSCVIVIRLLRHLSSFDPAWEPLNGWALELICEKAMGTCNRPMGAGEGLRRVMECLSSGLLMPDGPGLGDPCEKVATDVLSDLSVQQLEQLTFSAQNYLRNMAFGHVHKVLGMESLT 344          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004510.1 (pep scaffold:Pmarinus_7.0:GL483741:8977:15999:1 gene:ENSPMAG00000004100.1 transcript:ENSPMAT00000004510.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 3.622e-25
Identity = 50/92 (54.35%), Postives = 68/92 (73.91%), Query Frame = 1
Query: 1081 AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIR 1356
             EE V+ + +Q  ++ PVG +Y+E   N+ G+VI+F+CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K    R  + QE+++R
Sbjct:  186 GEEAVESSPVQ--DVLPVGYDYVEEVCNDDGRVIRFYCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPELQVEVKPSI-RARKFQEERVR 274          

HSP 2 Score: 90.1225 bits (222), Expect = 1.124e-19
Identity = 51/76 (67.11%), Postives = 57/76 (75.00%), Query Frame = 1
Query:  664 QTYKEHLDGQKHXXXXXXXXXXXXXXXXXN---QRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIP 882
            QTY+EHL+GQKHKKK +  K   +T T +    Q QLRCELCDVTCTGADAY AHIRG KHQK  KLH +LG PIP
Sbjct:    1 QTYREHLEGQKHKKKEAAAKAGTATTTTAGRATQHQLRCELCDVTCTGADAYAAHIRGAKHQKVVKLHTKLGIPIP 76          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Nematostella
Match: EDO42107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2H5])

HSP 1 Score: 301.212 bits (770), Expect = 2.000e-92
Identity = 173/347 (49.86%), Postives = 227/347 (65.42%), Query Frame = 1
Query: 1510 FDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVRE------ESTEGVATVQPEDG---LDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAE---DKNSNGR-KRRHSD 2511
            +D+ DD+ V+ KH  IYP E+EL+TV S+V   EKAL+ +S++I  +   + E E   + + K+ P R+L GVMRVG LA  LLLH  L V LV+LC   PT TL+++V D LP +L E L  +K+++ LN EE  + V    EP +   + LTS V+R+       +   +    P+DG   LDR++CLDALASLRH KWFQAK   LQ C+++IR++RDLC+RVPT+ PL  W LEL+VEK +SS    L PG + RR  EC++SGI L GGPGL DPCEKEL DAS  +S Q+ EDLTA+AQHALRL AFRQ+HKVL ++PL          N  GR KRR  D
Sbjct:  163 YDSPDDRMVMMKHGTIYPNEQELQTVQSIVSASEKALKFVSDVIASEDNPQMENEGSEKMDAKQQPPRALKGVMRVGVLAKGLLLHERLDVYLVVLCHDKPTKTLLKRVSDNLPSQL-EVLTEEKYEVKLNSEESTVTVCTTSEPKVTVTVTLTSPVMRDTEAAVLNAFSNLPPCLPDDGPEVLDRQKCLDALASLRHAKWFQAKANGLQSCVVIIRVMRDLCERVPTFAPLNKWALELLVEKTLSSSEQPLGPGEAFRRIMECISSGIFLEGGPGLNDPCEKELVDASVGISQQEAEDLTAAAQHALRLQAFRQLHKVLGIDPLPPPQRRFGRFNRGGRFKRRRED 508          

HSP 2 Score: 111.309 bits (277), Expect = 1.419e-25
Identity = 52/90 (57.78%), Postives = 67/90 (74.44%), Query Frame = 1
Query: 1132 VGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDF--WRRRD 1395
            +GS+Y+E  KN+ GKV+ F CKLC CKFNDP+AK+ HL GRRHRLQYKKKV P LVV+ K    R  + QEDK+R++  +E++  WRR D
Sbjct:    1 LGSDYLEEIKNDEGKVVNFHCKLCECKFNDPNAKDAHLAGRRHRLQYKKKVQPDLVVENKPSTRRLSKSQEDKLRRQWEQENYYRWRRGD 90          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Nematostella
Match: EDO35124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMG3])

HSP 1 Score: 74.3294 bits (181), Expect = 3.081e-14
Identity = 60/187 (32.09%), Postives = 97/187 (51.87%), Query Frame = 1
Query: 2020 PEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEK----VISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLI---AFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEG 2559
            P   +D K    ALA++RH++WF+    +     IL+R+L+DL +R      LT W ++L+  +    V S  P  LS   + RR  + LA+G+ LPG  G+ DPCE     A S+LS ++++ +T  AQ  LR +   A+ +I  +L  +P +   E  + NG         +V  G +  +K+EG
Sbjct:  132 PAKHVDVKLLEGALATIRHSRWFEENAFHTS-IRILVRLLKDLRKRFTGLQGLTPWLIDLLAHRSTLAVTSRQP--LSINIAFRRALQLLAAGLFLPGSLGIVDPCESGQVRAHSVLSLEEQDAITTCAQTLLRCLNHGAYNEILGLLRTDPKAIETEVSSWNGV--------IVTPGTKAYEKQEG 307          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Medaka
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:101166968])

HSP 1 Score: 526.939 bits (1356), Expect = 9.087e-172
Identity = 331/737 (44.91%), Postives = 441/737 (59.84%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXX-------XXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVE------IGGGTTVSKITA------------------APKINYI--HKVAYKALTENPIDE------KPPAPAEEQTEKI----AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRR-RDMQARMREMQRLE---YXXXXXXXXXXXXXXXXXXINHGM--RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATV----QPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKE 2556
            +QN+ LR ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +        +      + +S Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P ++  T++S  +         +GG ++    +A                   PKIN++  +K+   A  E    E      KP AP     +K     A     L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR  + Q    + +RL    Y     G                M  R  D+ DD++V+ KH+ IYP+E+EL+++  +V + E+AL+ +S+II E       E  + E  + +  +R+L GVMRVG LA  LLL GD  V+LVLLCS+ PT TL+  +++ LP +L    P +K+++  + +E  I++T   +P M+  I LTS V+REE+  EG  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRV TW+P   W +EL+VEK ISS    LSPG +LRR FEC+ASGILLPGGPGL DPCEK+  D  S L +Q RED+T+SAQ ALRL+AFRQIHKVL M+PL       NS  R+R +SD      G  KKDKK+
Sbjct:  303 FQNKQLRPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKVSQSSSSTGGGAMARSAQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPSIVTQTSSSVTSASSKTTTAVLGGSSSALSASASCSSAASLSSSYMKPKICTPKINFVGGNKLQTTAKAEESRSEVKVDTCKPVAPPSGCLDKADVCDALSPSALVALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRLPDGGYPQGPPGLLGVRPGMPGLQPQGPMPPRRPDSSDDRYVMTKHAAIYPSEDELQSIQKIVSITERALKLVSDIITEQ------EGVQEEDKEAQAKDRALKGVMRVGVLAKGLLLRGDKDVNLVLLCSEKPTKTLLSSILEHLPKQLTVVTP-EKYEVKGSIQEAAIILTSCSDPKMQVTITLTSPVIREEAGREGDVTSGLVKDPADVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVSTWSPFPRWAMELLVEKAISSASAPLSPGDALRRVFECIASGILLPGGPGLMDPCEKKPVDTLSSLGEQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQINPRFNSRKRRRDNSDGTDSFEGEGKKDKKD 1030          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Medaka
Match: zfr2 (zinc finger RNA-binding protein [Source:NCBI gene;Acc:101166215])

HSP 1 Score: 507.679 bits (1306), Expect = 1.171e-164
Identity = 299/705 (42.41%), Postives = 405/705 (57.45%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQR----QLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTV-----------------------EIGGGTTVSKITAA--PKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRD------MQARMRE----MQRLEYXXXXXXXXXXXXXXXXXXINHGM---------RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFE-DMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTE-------GVATVQ------PEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRR 2502
            +QN+  R +     SQ+ YCD+CKISCAGPQTY+EH +GQKHKKK +  K    +   +  R    QLRCELCDV+CTG DAY AHIRG KHQK  KLH +LGKPIP ++P+++ S      ++                        +  G      +     P  + +   A+K +    +      P      K+  +  D  +  + +I PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AK+MHLKGRRHRLQYKKKV+P L V+ K  N R  +LQE K+++ + +    R+RD      ++ R  E     +RLE   +  G+              GM         R  D+ DD+H++AKHS IYP EEEL+ V  +V   E+AL+ +S+ + E ++P      E  E    +   R L GVMRVG LA  LLL GD  V L+LL +K PT TL++ V  +LP +L E    D++++    EE  I++   +EP M+  I LTS ++RE+          G A  +      P D L +K+CL+ LA+LRH KWFQA+   LQ C+I+IR+LRDLCQRVPTW  +  W LEL+VEK ISS    LSPG ++RR  EC+++G+LLP  PGL DPCEKE  DA   ++ Q RED+TASAQHALRL+AFRQIHKVL ME L   A   ++  RKRR
Sbjct:  290 HQNKLQRPKGPPKQSQLHYCDICKISCAGPQTYREHNEGQKHKKKEAALKAGAQSGASNGPRGVQTQLRCELCDVSCTGVDAYAAHIRGAKHQKVVKLHTKLGKPIPSSEPVLVNSAPILASSSAGKPPASPASSSPSTAAAPAAKLKQTAGNPPAKAVLPVKKPAFSKMSAAAHKPVGARAVTSAAEEPVLPPVPKLKPQSEDEGAGGQGDIQPVGHDYVEEVRNDDGKVIRFHCKLCECSFNDPNAKDMHLKGRRHRLQYKKKVNPELPVEIKPSN-RARKLQESKLKKLKQKAVLKRQRDDEQHWHLEMRRYEEDIYWRRLEEEQMYWGDQRRRIAPPPLMSRPGMPVPPLLTCVRRPDSSDDRHIMAKHSTIYPVEEELQAVQRIVSHTERALKLVSDSLLEKEVPAPASTSEDGEEKSADSAARLLKGVMRVGILAKGLLLRGDRNVELILLTAKKPTVTLLKTVAKQLPKEL-EIFSEDQYEVQARPEEANIVIISSKEPQMQVTISLTSPLMREDPAAETDKQAGGKAAEKDAFDKDPPDLLSKKKCLENLAALRHAKWFQARANGLQSCVIIIRVLRDLCQRVPTWGKVPSWALELLVEKAISSAAGPLSPGEAMRRVLECISTGVLLPDAPGLLDPCEKEQTDALKGVNLQAREDITASAQHALRLLAFRQIHKVLGMESLP--ASKASARNRKRR 990          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Medaka
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:101166968])

HSP 1 Score: 415.231 bits (1066), Expect = 5.011e-129
Identity = 258/571 (45.18%), Postives = 346/571 (60.60%), Query Frame = 1
Query:  979 PKINYI--HKVAYKALTENPIDE------KPPAPAEEQTEKI----AEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHR---------------------ED-FWRR-RDMQARMREMQRLE---YXXXXXXXXXXXXXXXXXXINHGM--RYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREEST-EGVATV----QPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKE 2556
            PKIN++  +K+   A  E    E      KP AP     +K     A     L +LQ  ++ PVG +Y+E  +N+ GKVI+F CKLC C FNDP+AKEMHLKGRRHRLQYKKKV+P L V+ K  + R  ++QE+K+R++  +                     ED +WRR  + Q    + +RL    Y     G                M  R  D+ DD++V+ KH+ IYP+E+EL+++  +V + E+AL+ +S+II E       E  + E  + +  +R+L GVMRVG LA  LLL GD  V+LVLLCS+ PT TL+  +++ LP +L    P +K+++  + +E  I++T   +P M+  I LTS V+REE+  EG  T      P D LDR++CLDALA+LRH KWFQA+   LQ C+I+IRILRDLCQRV TW+P   W +EL+VEK ISS    LSPG +LRR FEC+ASGILLPGGPGL DPCEK+  D  S L +Q RED+T+SAQ ALRL+AFRQIHKVL M+PL       NS  R+R +SD      G  KKDKK+
Sbjct:  499 PKINFVGGNKLQTTAKAEESRSEVKVDTCKPVAPPSGCLDKADVCDALSPSALVALQS-DVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYKKKVNPDLQVEVKP-SIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEEDMYWRRMEEEQHHWDDRRRLPDGGYPQGPPGLLGVRPGMPGLQPQGPMPPRRPDSSDDRYVMTKHAAIYPSEDELQSIQKIVSITERALKLVSDIITEQ------EGVQEEDKEAQAKDRALKGVMRVGVLAKGLLLRGDKDVNLVLLCSEKPTKTLLSSILEHLPKQLTVVTP-EKYEVKGSIQEAAIILTSCSDPKMQVTITLTSPVIREEAGREGDVTSGLVKDPADVLDRQKCLDALAALRHAKWFQARANGLQSCVIIIRILRDLCQRVSTWSPFPRWAMELLVEKAISSASAPLSPGDALRRVFECIASGILLPGGPGLMDPCEKKPVDTLSSLGEQQREDITSSAQFALRLLAFRQIHKVLGMDPLPQINPRFNSRKRRRDNSDGTDSFEGEGKKDKKD 1060          

HSP 2 Score: 134.42 bits (337), Expect = 1.297e-31
Identity = 68/117 (58.12%), Postives = 83/117 (70.94%), Query Frame = 1
Query:  574 YQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXX-------XXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVI 903
            +QN+ LR ++     Q+ YCDVCKISCAGPQTYKEHL+GQKHKKK +        +      + +S Q QLRCELCDV+CTGADAY AHIRG KHQK  KLH +LGKPIP  +P ++
Sbjct:  303 FQNKQLRPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKVSQSSSSTGGGAMARSAQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPSIV 419          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Medaka
Match: ilf3b (interleukin enhancer binding factor 3 [Source:NCBI gene;Acc:101166227])

HSP 1 Score: 259.225 bits (661), Expect = 1.174e-74
Identity = 158/324 (48.77%), Postives = 212/324 (65.43%), Query Frame = 1
Query: 1522 DDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEII-----FEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE-----STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSS 2463
            DD+HV+AKHS IYPT+EEL+ V ++V   E+AL+ +S+ +         P  +  + + E + K+   R+L GVMRVG +A  LLL GDL + LVLLC + PT  L+RKV + L  +LK  +  +K+ ++ + +E  I++   +EP +   I LTS +VREE     + E ++ + P D LDR++CL ALASLRH KWFQA+   L+ C+I+IRILRDLC RV  W PL  W LELI EK I +    +  G +LRR  ECL+SGILL  GPG+ DPCEKE  DA   L+ Q RED+TASAQHALRL AF Q+HKVL M+ L S
Sbjct:   16 DDRHVMAKHSAIYPTQEELENVQNMVSHTERALKAVSDWLDRQEKGTSKPDSDAADAEKEIDSKDPATRTLRGVMRVGLVAKGLLLKGDLDLELVLLCREKPTTDLLRKVAENLSAQLK-LITEEKYVVTQDIQEASIVIQNTKEPPLTLTIHLTSPLVREEMEKTTAGETLSVIDPPDVLDRQKCLTALASLRHAKWFQARANGLRSCVIVIRILRDLCARVSMWAPLRGWPLELICEKAIGTGNRPMGAGEALRRVLECLSSGILLSEGPGISDPCEKEPTDAVGHLNSQQREDITASAQHALRLSAFGQLHKVLGMDSLPS 338          
BLAST of Zinc finger RNA-binding protein vs. Ensembl Medaka
Match: ilf3b (interleukin enhancer binding factor 3 [Source:NCBI gene;Acc:101166227])

HSP 1 Score: 260.766 bits (665), Expect = 6.522e-74
Identity = 158/324 (48.77%), Postives = 212/324 (65.43%), Query Frame = 1
Query: 1522 DDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEII-----FEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREE-----STEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSS 2463
            DD+HV+AKHS IYPT+EEL+ V ++V   E+AL+ +S+ +         P  +  + + E + K+   R+L GVMRVG +A  LLL GDL + LVLLC + PT  L+RKV + L  +LK  +  +K+ ++ + +E  I++   +EP +   I LTS +VREE     + E ++ + P D LDR++CL ALASLRH KWFQA+   L+ C+I+IRILRDLC RV  W PL  W LELI EK I +    +  G +LRR  ECL+SGILL  GPG+ DPCEKE  DA   L+ Q RED+TASAQHALRL AF Q+HKVL M+ L S
Sbjct:   16 DDRHVMAKHSAIYPTQEELENVQNMVSHTERALKAVSDWLDRQEKGTSKPDSDAADAEKEIDSKDPATRTLRGVMRVGLVAKGLLLKGDLDLELVLLCREKPTTDLLRKVAENLSAQLK-LITEEKYVVTQDIQEASIVIQNTKEPPLTLTIHLTSPLVREEMEKTTAGETLSVIDPPDVLDRQKCLTALASLRHAKWFQARANGLRSCVIVIRILRDLCARVSMWAPLRGWPLELICEKAIGTGNRPMGAGEALRRVLECLSSGILLSEGPGISDPCEKEPTDAVGHLNSQQREDITASAQHALRLSAFGQLHKVLGMDSLPS 338          
BLAST of Zinc finger RNA-binding protein vs. Planmine SMEST
Match: SMESG000022723.1 (SMESG000022723.1)

HSP 1 Score: 1463.36 bits (3787), Expect = 0.000e+0
Identity = 836/837 (99.88%), Postives = 837/837 (100.00%), Query Frame = 1
Query:  103 ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYXXXXXXXXXXXXXXXXXXXXIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGRRNIYDIRYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGXXXXXXXXXXVDCKGNSQ 2613
            ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYPTNATVIAPPVAVVPSQQATIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGAQIQQQNIAQAAAVAAAQHAAVAAANSARGRRNIYDIRYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHKKKASGTKVVVSTVTKSNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYSNVASGN+NNNYRSGSQSINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMPVKEEEEEKSESNKKEVPERSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCLILIRILRDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGENEESNENSSVDCKGNSQ
Sbjct:   23 ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYPTNATVIAPPVAVVPSQQATIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGAQIQQQNIAQAAAVAAAQHAAVAAANSARGRRNIYDIRYQNQFLRKRRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHKKKASGTKVVVSTVTKSNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYSNVASGNSNNNYRSGSQSINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMPVKEEEEEKSESNKKEVPERSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCLILIRILRDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGENEESNENSSVDCKGNSQ 859          
BLAST of Zinc finger RNA-binding protein vs. Planmine SMEST
Match: SMESG000022723.1 (SMESG000022723.1)

HSP 1 Score: 1459.12 bits (3776), Expect = 0.000e+0
Identity = 836/838 (99.76%), Postives = 837/838 (99.88%), Query Frame = 1
Query:  103 ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYXXXXXXXXXXXXXXXXXXXXIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGRRNIYDIRYQNQFLRKR-RNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGXXXXXXXXXXVDCKGNSQ 2613
            ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYPTNATVIAPPVAVVPSQQATIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGAQIQQQNIAQAAAVAAAQHAAVAAANSARGRRNIYDIRYQNQFLRKR RNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHKKKASGTKVVVSTVTKSNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYSNVASGN+NNNYRSGSQSINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMPVKEEEEEKSESNKKEVPERSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCLILIRILRDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGENEESNENSSVDCKGNSQ
Sbjct:   23 ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYPTNATVIAPPVAVVPSQQATIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGAQIQQQNIAQAAAVAAAQHAAVAAANSARGRRNIYDIRYQNQFLRKRGRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHKKKASGTKVVVSTVTKSNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYSNVASGNSNNNYRSGSQSINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMPVKEEEEEKSESNKKEVPERSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCLILIRILRDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGENEESNENSSVDCKGNSQ 860          
BLAST of Zinc finger RNA-binding protein vs. Planmine SMEST
Match: SMESG000022723.1 (SMESG000022723.1)

HSP 1 Score: 1451.03 bits (3755), Expect = 0.000e+0
Identity = 833/840 (99.17%), Postives = 834/840 (99.29%), Query Frame = 1
Query:  103 ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYXXXXXXXXXXXXXXXXXXXXIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGRRNIYDIRYQNQFLRKR-RNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHXXXXX--XXXXXXXXXXXXNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYXXXXXXXXXXXXXXXXXXINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMXXXXXXXXXXXXXXXXXXXRSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGXXXXXXXXXXVDCKGNSQ 2613
            ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYPTNATVIAPPVAVVPSQQATIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGAQIQQQNIAQAAAVAAAQHAAVAAANSARGRRNIYDIRYQNQFLRKR RNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHKKKAS     VVVSTVTKSNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYSNVASGN+NNNYRSGSQSINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMPVKEEEEEKSESNKKEVPERSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCLILIRILRDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGENEESNENSSVDCKGNSQ
Sbjct:   23 ANNLYTGAVAQPLTTGYTAASTGRTAVGTAYTVSGTQISSAHRSQAPVSYTYPTNATVIAPPVAVVPSQQATIVAPPLPSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGAQIQQQNIAQAAAVAAAQHAAVAAANSARGRRNIYDIRYQNQFLRKRGRNSIDSQMFYCDVCKISCAGPQTYKEHLDGQKHKKKASGTKVSVVVSTVTKSNQRQLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWRRRDMQARMREMQRLEYSNVASGNSNNNYRSGSQSINHGMRYFDTLDDKHVLAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMPVKEEEEEKSESNKKEVPERSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKVIDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVREESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCLILIRILRDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGENEESNENSSVDCKGNSQ 862          
BLAST of Zinc finger RNA-binding protein vs. Planmine SMEST
Match: SMESG000004225.1 (SMESG000004225.1)

HSP 1 Score: 67.781 bits (164), Expect = 1.557e-11
Identity = 43/143 (30.07%), Postives = 79/143 (55.24%), Query Frame = 1
Query: 2020 PEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCXXXXXXXXDLCQRVPTWNPLTDWTLELIVEKVISSDPIK--LSPGSSLRRFFECLASGILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHKVL 2442
            P+  LD K    +LA++RH +WF+    +     +LIR+L+DL QR   +  L+ W ++L+    I ++P    L    + +R F+ L+SG+ LPG  G+ DPCE+      + +S + ++++  +AQ  LR++      ++L
Sbjct:  201 PQLHLDTKVIQGSLAAVRHIRWFEDNAGHTS-IKLLIRLLKDLKQRYEGFEALSPWIIDLLAHYAILNNPTNNALPINQAFKRVFQLLSSGLFLPGSAGIIDPCEQGRVRLHTSMSLEQQDEVCCTAQTLLRVLCHGGYKEIL 342          
BLAST of Zinc finger RNA-binding protein vs. Planmine SMEST
Match: SMESG000067725.1 (SMESG000067725.1)

HSP 1 Score: 51.2174 bits (121), Expect = 2.231e-6
Identity = 58/238 (24.37%), Postives = 91/238 (38.24%), Query Frame = 1
Query:  631 CDVCKISCAGPQTYKEHLDGQKHXXXXXXXXXXXXXXXXXNQR-----------------------QLRCELCDVTCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTVEIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAEEHVDLNSLQEKNIAPVGSEYIETTKN-----ESGKVIQFFCKLCNCKFNDPHAKEMHLKGRRH 1260
            CDVC I+C+   TY  H+ G+KH K  S   +  +  T SN +                        L CE+CDV C   +  + H+ G++H+K  KL+ R  +     DP V      S  N   +       K          HK    A  ++   EK    A+  T     EH     +  KN +   + Y +T K+        +  + +C +C   F +    ++HL G +H
Sbjct:   63 CDVCNITCSSQTTYDFHIKGKKHTKALSRKDLFENGKTASNAKVEGNDCMDPVEYSDQQGQILSKSNLMCEICDVNCLRPEQLERHLEGSRHRKKLKLN-RYIELRNNKDPSVFCDICESFMNEESMNMHRASGK----------HKRKSSAEVKDEPAEKKARSADIPT---TVEHCGYCHMSLKNASDAIAHY-QTQKHALNMTNRSRNFELWCDVCQISFTNQSFLDLHLTGFKH 285          
The following BLAST results are available for this feature:
BLAST of Zinc finger RNA-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZFR9.805e-16542.33zinc finger RNA binding protein [Source:HGNC Symbo... [more]
ZFR21.022e-14541.26zinc finger RNA binding protein 2 [Source:HGNC Sym... [more]
STRBP6.813e-7846.93spermatid perinuclear RNA binding protein [Source:... [more]
STRBP6.813e-7846.93spermatid perinuclear RNA binding protein [Source:... [more]
ILF35.609e-7647.70interleukin enhancer binding factor 3 [Source:HGNC... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y95B8A.89.912e-9032.45pep chromosome:WBcel235:I:853451:872103:1 gene:WBG... [more]
R11H6.54.283e-1327.42pep chromosome:WBcel235:V:14610734:14612222:-1 gen... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zn72D3.002e-14542.49gene:FBgn0263603 transcript:FBtr0333294[more]
Zn72D3.002e-14542.49gene:FBgn0263603 transcript:FBtr0310582[more]
Zn72D3.002e-14542.49gene:FBgn0263603 transcript:FBtr0310581[more]
Zn72D3.002e-14542.49gene:FBgn0263603 transcript:FBtr0075494[more]
Zn72D1.550e-8539.31gene:FBgn0263603 transcript:FBtr0075493[more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfr21.737e-16644.20zinc finger RNA binding protein 2 [Source:ZFIN;Acc... [more]
zfr3.103e-12444.32zinc finger RNA binding protein [Source:NCBI gene;... [more]
zfr6.840e-12444.32zinc finger RNA binding protein [Source:NCBI gene;... [more]
zfr22.483e-12146.79zinc finger RNA binding protein 2 [Source:ZFIN;Acc... [more]
zfr7.987e-9438.26zinc finger RNA binding protein [Source:NCBI gene;... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca126.647e-16343.13carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
ca121.293e-16142.35carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
ca121.482e-16142.35carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
ca122.728e-16142.35carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
ca123.908e-16142.35carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfr9.903e-16342.46zinc finger RNA binding protein [Source:MGI Symbol... [more]
Zfr27.958e-14539.53zinc finger RNA binding protein 2 [Source:MGI Symb... [more]
Strbp1.556e-7846.93spermatid perinuclear RNA binding protein [Source:... [more]
Zfr4.606e-7850.17zinc finger RNA binding protein [Source:MGI Symbol... [more]
Strbp5.281e-7846.93spermatid perinuclear RNA binding protein [Source:... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96KR1|ZFR_HUMAN4.709e-16442.33Zinc finger RNA-binding protein OS=Homo sapiens OX... [more]
sp|Q5REX3|ZFR_PONAB7.045e-16442.33Zinc finger RNA-binding protein OS=Pongo abelii OX... [more]
sp|O88532|ZFR_MOUSE6.927e-16242.46Zinc finger RNA-binding protein OS=Mus musculus OX... [more]
sp|Q5U231|ZFR_XENTR1.445e-16042.35Zinc finger RNA-binding protein OS=Xenopus tropica... [more]
sp|Q6GPM1|ZFR_XENLA4.842e-15843.18Zinc finger RNA-binding protein OS=Xenopus laevis ... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K2A40.000e+046.59DZF domain-containing protein OS=Biomphalaria glab... [more]
A0A2C9K2B70.000e+046.59DZF domain-containing protein OS=Biomphalaria glab... [more]
A0A2C9K2B00.000e+046.59DZF domain-containing protein OS=Biomphalaria glab... [more]
A0A2C9K2990.000e+046.59DZF domain-containing protein OS=Biomphalaria glab... [more]
A0A433U0U10.000e+047.86DZF domain-containing protein OS=Elysia chlorotica... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfr27.746e-16843.40zinc finger RNA-binding protein-like [Source:NCBI ... [more]
zfr6.623e-15941.29zinc finger RNA binding protein [Source:NCBI gene;... [more]
ilf3b5.926e-7648.80interleukin enhancer binding factor 3 [Source:NCBI... [more]
ilf3b1.207e-7548.80interleukin enhancer binding factor 3 [Source:NCBI... [more]
strbp2.400e-7344.64spermatid perinuclear RNA binding protein [Source:... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ilf3a2.900e-6542.56interleukin enhancer binding factor 3a [Source:ZFI... [more]
ENSPMAT00000004510.13.622e-2554.35pep scaffold:Pmarinus_7.0:GL483741:8977:15999:1 ge... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO421072.000e-9249.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351243.081e-1432.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfr9.087e-17244.91zinc finger RNA binding protein [Source:NCBI gene;... [more]
zfr21.171e-16442.41zinc finger RNA-binding protein [Source:NCBI gene;... [more]
zfr5.011e-12945.18zinc finger RNA binding protein [Source:NCBI gene;... [more]
ilf3b1.174e-7448.77interleukin enhancer binding factor 3 [Source:NCBI... [more]
ilf3b6.522e-7448.77interleukin enhancer binding factor 3 [Source:NCBI... [more]
back to top
BLAST of Zinc finger RNA-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022723.10.000e+099.88SMESG000022723.1[more]
SMESG000022723.10.000e+099.76SMESG000022723.1[more]
SMESG000022723.10.000e+099.17SMESG000022723.1[more]
SMESG000004225.11.557e-1130.07SMESG000004225.1[more]
SMESG000067725.12.231e-624.37SMESG000067725.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005588 ID=SMED30005588|Name=Zinc finger RNA-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2712bp
ATTGCCTTAAACTAGAGGCATTTTAATTTATTCAATATGAGTCAACAATA
TTATTATAATGGTACACAATATACAACCCCAACCACTTATTCTGCACAGA
CAGCTAACAACTTATATACGGGTGCAGTTGCCCAACCTTTGACCACTGGT
TATACAGCCGCTTCAACTGGCCGAACTGCTGTAGGAACTGCATATACAGT
TTCAGGTACTCAAATTTCGAGTGCTCATAGATCTCAAGCACCAGTTTCTT
ACACCTATCCTACTAATGCTACAGTAATTGCACCACCAGTAGCTGTAGTA
CCATCTCAACAAGCTACAATAGTAGCTCCACCGCTTCCTTCGGGTAAGGT
TGCAACTGGAGGTACTAGTTACGTAATTGCAAACGGTCCAACATCTACTA
TTAATACTAATGGAGCCTATACAGTTACTACAAGTTATTTTCAACAAATG
CCAACTGGAGCACAAATACAACAGCAAAATATAGCTCAAGCAGCAGCAGT
AGCGGCAGCTCAGCACGCAGCTGTTGCTGCTGCTAATTCAGCACGTGGAA
GACGGAATATTTATGACATTCGGTATCAGAATCAATTTCTACGGAAAAGA
CGGAATAGTATTGATTCTCAAATGTTTTATTGTGATGTTTGCAAAATTAG
TTGTGCTGGTCCTCAAACATACAAAGAACATTTAGACGGTCAAAAGCATA
AGAAAAAAGCATCTGGCACAAAAGTTGTTGTTAGTACAGTAACAAAAAGC
AATCAACGACAACTGCGCTGTGAATTATGTGATGTTACATGCACAGGAGC
GGATGCCTATCAAGCCCATATCCGCGGAACGAAACACCAAAAAACATTCA
AATTGCATCAGCGCCTAGGCAAACCAATTCCTTGTGCTGACCCGTTAGTT
ATAAAATCAACAACAGCCTCCACAGAAAATACCGTTGAAATTGGTGGTGG
AACAACTGTATCAAAAATCACAGCTGCACCAAAGATAAATTATATTCACA
AAGTTGCTTACAAAGCCCTTACAGAAAACCCAATAGATGAAAAGCCTCCT
GCCCCAGCTGAAGAACAAACTGAAAAGATCGCCGAAGAGCACGTGGATTT
AAATAGCTTGCAAGAAAAGAATATAGCTCCAGTTGGCAGTGAATATATTG
AAACGACTAAAAATGAAAGTGGAAAAGTTATTCAATTCTTTTGCAAATTA
TGTAATTGCAAATTTAATGATCCACATGCAAAAGAAATGCATTTAAAAGG
AAGACGTCATCGATTGCAATATAAGAAAAAAGTAGATCCAAGTTTAGTAG
TCGATGCAAAAACCGGAAATCCTAGAAATTGGAGATTGCAGGAGGATAAA
ATAAGACAGAAACAACACAGAGAAGACTTTTGGCGAAGGCGTGACATGCA
AGCTCGAATGAGAGAGATGCAACGATTGGAATACTCGAATGTTGCTAGTG
GTAATAATAACAATAATTACCGTAGTGGATCACAATCAATAAATCACGGA
ATGCGATATTTCGATACGCTGGACGACAAACATGTATTGGCAAAGCATTC
CGTCATTTATCCTACCGAAGAAGAATTAAAAACAGTGCATTCAGTTGTGG
TGGTGTGTGAGAAAGCTCTGCGACAAATCAGTGAAATTATATTCGAAGAT
ATGCCCGTTAAAGAGGAGGAGGAGGAAAAATCAGAAAGCAATAAAAAAGA
AGTTCCAGAACGTTCTCTCAGTGGTGTAATGCGTGTCGGAGCTTTGGCCA
ATTGTCTATTGTTACATGGCGATTTGGTTGTTTCTTTGGTTCTTTTATGT
TCTAAATGGCCGACATTTACCCTGATGCGGAAGGTTATTGATAAACTCCC
CGATAAATTAAAGGAGTTTCTACCGAATGATAAATTCGACATCAGTTTAA
ACGATGAGGAAAAATGCATTCTTGTAACTCGAAAACAAGAGCCACTAATG
GAATGCTACATACGGCTGACGTCATCTGTGGTGCGTGAAGAGTCGACTGA
AGGAGTTGCTACTGTTCAACCTGAAGACGGTTTGGATAGAAAAAGATGTT
TGGACGCATTAGCATCTTTACGACATACAAAATGGTTCCAGGCTAAAGTT
ACAAATCTTCAACCGTGCTTAATATTGATTCGGATTTTACGGGATTTATG
TCAGCGTGTTCCAACGTGGAATCCTTTGACCGATTGGACTTTGGAATTAA
TTGTCGAAAAAGTCATTTCTTCTGACCCGATAAAACTTTCACCGGGAAGT
TCTTTACGGCGATTTTTTGAATGCTTGGCTAGTGGGATCTTACTGCCAGG
AGGGCCGGGTTTAAAAGATCCATGCGAGAAAGAATTAAAAGATGCAAGCT
CCATTTTATCAGATCAAGATCGTGAAGATTTAACAGCAAGTGCACAACAT
GCCTTGCGACTTATTGCATTTCGTCAAATACATAAAGTTCTTGATATGGA
GCCGCTTTCGTCTGCTGCTGAGGATAAAAACTCAAATGGACGTAAACGAC
GTCACAGTGACGAAGAAGTTGTAATTGTTGGAAATCAAAAGAAAGATAAA
AAGGAAGGCGAAAATGAAGAATCGAATGAAAATTCTTCAGTTGACTGTAA
AGGAAATTCCCAATAATTTTATATTTTTAGTTTTCCATTTGTATTTACTC
CAAATAAATTTAAAATATAAAAATGTTGGTTTTTTGAAATTCTGTAGTTT
AGTTTTTAGCAG
back to top

protein sequence of SMED30005588-orf-1

>SMED30005588-orf-1 ID=SMED30005588-orf-1|Name=SMED30005588-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=860bp
MSQQYYYNGTQYTTPTTYSAQTANNLYTGAVAQPLTTGYTAASTGRTAVG
TAYTVSGTQISSAHRSQAPVSYTYPTNATVIAPPVAVVPSQQATIVAPPL
PSGKVATGGTSYVIANGPTSTINTNGAYTVTTSYFQQMPTGAQIQQQNIA
QAAAVAAAQHAAVAAANSARGRRNIYDIRYQNQFLRKRRNSIDSQMFYCD
VCKISCAGPQTYKEHLDGQKHKKKASGTKVVVSTVTKSNQRQLRCELCDV
TCTGADAYQAHIRGTKHQKTFKLHQRLGKPIPCADPLVIKSTTASTENTV
EIGGGTTVSKITAAPKINYIHKVAYKALTENPIDEKPPAPAEEQTEKIAE
EHVDLNSLQEKNIAPVGSEYIETTKNESGKVIQFFCKLCNCKFNDPHAKE
MHLKGRRHRLQYKKKVDPSLVVDAKTGNPRNWRLQEDKIRQKQHREDFWR
RRDMQARMREMQRLEYSNVASGNNNNNYRSGSQSINHGMRYFDTLDDKHV
LAKHSVIYPTEEELKTVHSVVVVCEKALRQISEIIFEDMPVKEEEEEKSE
SNKKEVPERSLSGVMRVGALANCLLLHGDLVVSLVLLCSKWPTFTLMRKV
IDKLPDKLKEFLPNDKFDISLNDEEKCILVTRKQEPLMECYIRLTSSVVR
EESTEGVATVQPEDGLDRKRCLDALASLRHTKWFQAKVTNLQPCLILIRI
LRDLCQRVPTWNPLTDWTLELIVEKVISSDPIKLSPGSSLRRFFECLASG
ILLPGGPGLKDPCEKELKDASSILSDQDREDLTASAQHALRLIAFRQIHK
VLDMEPLSSAAEDKNSNGRKRRHSDEEVVIVGNQKKDKKEGENEESNENS
SVDCKGNSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR036236Znf_C2H2_sf
IPR007087Znf_C2H2
IPR006561DZF_dom
IPR015880Znf_C2H2-like
IPR003604Matrin/U1-like-C_Znf_C2H2
IPR022755Znf_C2H2_jaz
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 341..361
NoneNo IPR availableGENE3DG3DSA:1.10.1410.40coord: 496..807
e-value: 3.2E-114
score: 383.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 183..231
e-value: 3.3E-11
score: 44.5
coord: 370..416
e-value: 6.3E-8
score: 34.0
coord: 232..280
e-value: 3.0E-11
score: 44.7
NoneNo IPR availablePFAMPF12874zf-metcoord: 197..221
e-value: 2.0E-7
score: 31.1
coord: 244..267
e-value: 2.6E-6
score: 27.6
coord: 384..408
e-value: 6.7E-6
score: 26.3
NoneNo IPR availableGENE3DG3DSA:3.30.460.10coord: 507..690
e-value: 3.2E-114
score: 383.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 814..849
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 809..859
NoneNo IPR availablePANTHERPTHR45762:SF5ZINC-FINGER PROTEIN AT 72D, ISOFORM Bcoord: 5..851
NoneNo IPR availablePANTHERPTHR45762FAMILY NOT NAMEDcoord: 5..851
IPR006561DZF domainSMARTSM00572rich3coord: 560..810
e-value: 2.5E-110
score: 382.5
IPR006561DZF domainPFAMPF07528DZFcoord: 566..809
e-value: 1.6E-60
score: 204.8
IPR006561DZF domainPROSITEPS51703DZFcoord: 490..847
score: 91.977
IPR003604Matrin/U1-C-like, C2H2-type zinc fingerSMARTSM00451ZnF_U1_5coord: 381..415
e-value: 1.2E-7
score: 41.4
coord: 240..274
e-value: 3.8E-6
score: 36.4
coord: 194..228
e-value: 3.5E-5
score: 33.2
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 197..221
e-value: 4.2
score: 16.3
coord: 243..267
e-value: 0.12
score: 21.5
coord: 384..408
e-value: 5.3
score: 15.7
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 386..408
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 236..275
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 193..228
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 363..415