G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30005583
Length (bp)1499
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30005583) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30005583) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30005583) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30005583) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-7 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q94219])

HSP 1 Score: 78.5666 bits (192), Expect = 1.934e-15
Identity = 93/367 (25.34%), Postives = 166/367 (45.23%), Query Frame = 1
Query:  250 LYIAQVLLHASRLHVSIGISYSRTYLRVGFIGNIISITVLIMESHASQSPSI--ILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEI-PALIHQFLAVFVTSTSHDSPMIYT-VSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRLCRRSTQSKI 1338
            LY  Q+L H       +   ++  ++  G I N++S+++ + +  A  +P+I   L  L +  T  L   F   S  +++    +LV     Y YL PY+++ A T      W+V+ +T++RY AL  P   +       ++ + I+  A+AV+F+IPRF+E  VI    D      V   D + L +N +Y  +Y  +   V V + P   +  L + +   ++SA                    +R  +  P   +     S   S+ Y      K+   N +++L+++ F++ +I P +I     V   S    SP+    V +SN L+ L  SSNF ++ + GK+F    RR CR+  +S +
Sbjct:   22 LYFIQMLSHL------LNGYFTAFFVFTGIILNLLSVSIFLRKERAG-TPAIQYYLVTLTLWQTALLANAFLLYSFPNLW--WGHLVS-QGTYVYLYPYVYTFANTTHTGSVWIVLTLTIDRYLALCQPLKHRAIGKKRRVRRLMIVVSAMAVMFSIPRFFEVHVI-LICDEDQLSCVATIDRTELFDNRLYWTIYHVILAMVFVTLLPCLILFALTLRITIALRSA------------------IAKRKSLCAPNSDIDTRCKSIK-SSRYNS--SRKDHKSNIMLVLVIAKFLVSDILPTVIDVLEHVVGQSAFMRSPLASLFVDISNFLIVLNCSSNFWVFFVWGKRF----RRSCRKCIKSTL 352          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-9 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:C7FZU1])

HSP 1 Score: 71.2478 bits (173), Expect = 5.987e-13
Identity = 71/283 (25.09%), Postives = 134/283 (47.35%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMT-SYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPC----FNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRN--QVNGPTYQL---------FQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIIC 1134
            GFI N+I++ V           +  L +L +SD + L+  FF      +  M+ SYL+  HD YP  + + + + ++ Q    +L VLV+V RY  + HPF AK++ +   +K   I SI  ++V N+  + E D     I PC    FN  +     + LR+ + Y+++ + + Y +++ I P   ++ +N  ++  +K +     +RN  +    + S    N   + G  Y           F P  + S+    G  +  ++RSV  +++ +V++F+ C
Sbjct:   41 GFITNVINVIVFCDPEMRCSLVNHFLLVLSISDLVLLVCNFFMLIFPVIASMSNSYLL--HDYYPVFLWFAYPVGLSTQTCGVYLTVLVSVHRYLGVCHPFRAKRWVSGKPVKWAIIGSIIFSIVINLHTWLELD-----IRPCYSINFNAPISSIILTSLRQKSSYNLITKCIMYTLIMFIIPFITLIIVNCRIVVALKESTR---MRNGQSMKKSTQSRIMNNFRMLKGAKYSELFGRFGRLNFNPLKTPSLLKTNGNSL--RDRSVTLMLLAIVAIFLCC 311          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-9 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:C7FZU1])

HSP 1 Score: 68.9366 bits (167), Expect = 2.970e-12
Identity = 73/289 (25.26%), Postives = 135/289 (46.71%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMT-SYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPC----FNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSA-----GNNLIIRNVSANTSISHSSRQRNQ---VNGPTYQL---------FQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIIC 1134
            GFI N+I++ V           +  L +L +SD + L+  FF      +  M+ SYL+  HD YP  + + + + ++ Q    +L VLV+V RY  + HPF AK++ +   +K   I SI  ++V N+  + E D     I PC    FN  +     + LR+ + Y+++ + + Y +++ I P   ++ +N  ++  +K +     G ++     S  T  S   R  N    + G  Y           F P  + S+    G  +  ++RSV  +++ +V++F+ C
Sbjct:   41 GFITNVINVIVFCDPEMRCSLVNHFLLVLSISDLVLLVCNFFMLIFPVIASMSNSYLL--HDYYPVFLWFAYPVGLSTQTCGVYLTVLVSVHRYLGVCHPFRAKRWVSGKPVKWAIIGSIIFSIVINLHTWLELD-----IRPCYSINFNAPISSIILTSLRQKSSYNLITKCIMYTLIMFIIPFITLIIVNCRIVVALKESTRMRNGQSMKKSTQSRFTWKSLDKRIMNNFRMLKGAKYSELFGRFGRLNFNPLKTPSLLKTNGNSL--RDRSVTLMLLAIVAIFLCC 320          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-19 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:U4PC84])

HSP 1 Score: 65.4698 bits (158), Expect = 2.597e-11
Identity = 80/340 (23.53%), Postives = 145/340 (42.65%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSL-RHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYT--VSLSNALVTLKSSSNFLIYCLGGKKFRFTLRR--LCRRSTQSKI 1338
            G + N+ S+ +      +  S +  L +L  SDTL L + FF  SL R    +T +   Y  I   + P ++ L MT Q    ++ V V+V RY  + HP+ + ++     +    I  +  +V+FN  RF+E  + N       +Y +     + LR N +Y  ++    Y +++ + P   ++ LN  ++  ++                    SR+ + V+       Q  A    S  + +  + K R  + ++I +V +FI C   A +   +    T  +     IY   V+ +N LV + +S N  +Y L   K+R  LR    C  S Q ++
Sbjct:   77 GILANVTSMRIFTHRIMSGSSINWYLAVLSASDTLILFSAFFVLSLPRFGEYLTWWRANY--ISYSVTPCMYGLMMTAQTCSVFMTVGVSVHRYIGVCHPYKSVEWLPKKRVTTFIIGLLTFSVIFNTTRFFEVHISNVCYRENIDYYMPSLQPTALRMNDLYRQIFFGWAYTIVMYVVPFTLLIALNSMVLSAVR-------------------RSRRMHMVS-------QCGAE---SEEFSKKAERKERQTSIMLISIVLLFIACNTLAFVCNIMENMGTEGA-----IYQTLVTFNNLLVIINASCNICVYMLFSGKYRMLLRYYLFCDWSRQGEL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-19 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:U4PC84])

HSP 1 Score: 65.0846 bits (157), Expect = 3.696e-11
Identity = 80/340 (23.53%), Postives = 145/340 (42.65%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSL-RHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYT--VSLSNALVTLKSSSNFLIYCLGGKKFRFTLRR--LCRRSTQSKI 1338
            G + N+ S+ +      +  S +  L +L  SDTL L + FF  SL R    +T +   Y  I   + P ++ L MT Q    ++ V V+V RY  + HP+ + ++     +    I  +  +V+FN  RF+E  + N       +Y +     + LR N +Y  ++    Y +++ + P   ++ LN  ++  ++                    SR+ + V+       Q  A    S  + +  + K R  + ++I +V +FI C   A +   +    T  +     IY   V+ +N LV + +S N  +Y L   K+R  LR    C  S Q ++
Sbjct:   77 GILANVTSMRIFTHRIMSGSSINWYLAVLSASDTLILFSAFFVLSLPRFGEYLTWWRANY--ISYSVTPCMYGLMMTAQTCSVFMTVGVSVHRYIGVCHPYKSVEWLPKKRVTTFIIGLLTFSVIFNTTRFFEVHISNVCYRENIDYYMPSLQPTALRMNDLYRQIFFGWAYTIVMYVVPFTLLIALNSMVLSAVR-------------------RSRRMHMVS-------QCGAE---SEEFSKKAERKERQTSIMLISIVLLFIACNTLAFVCNIMENMGTEGA-----IYQTLVTFNNLLVIINASCNICVYMLFSGKYRMLLRYYLFCDWSRQGEL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0340706)

HSP 1 Score: 82.8037 bits (203), Expect = 1.565e-16
Identity = 81/336 (24.11%), Postives = 149/336 (44.35%), Query Frame = 1
Query:  331 VGFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHD-IYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFR------FTLRRLCR 1317
            +G +GNIIS+ +L        S + +L  L   DT+ +IT      +  +YP T +   Y++ +YP++ P ++ + M  Q    ++   VT+ERY A+ HP  A+   T G  K+  I+ +  ++ +N+PRF+E   + +  +P  +  +     S LR +  Y  +Y    Y ++  I P   +  LN  + + +K A                  +R+R +++                       +++   +  +++ +V VF +     L+      F ++  H         +SN L+T+ SS NFLIY + G+KF+      F  RRL R
Sbjct:  126 LGILGNIISMIIL-SRPQMRSSINYLLTGLARCDTVLIITSILLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYP-EPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRA------------------NRERQRLSRS---------------------EKREIGLATMLLCVVIVFFMLNFLPLVLNISEAFYSTIDHK-----ITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRLSR 415          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0332085)

HSP 1 Score: 82.8037 bits (203), Expect = 1.565e-16
Identity = 81/336 (24.11%), Postives = 149/336 (44.35%), Query Frame = 1
Query:  331 VGFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHD-IYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFR------FTLRRLCR 1317
            +G +GNIIS+ +L        S + +L  L   DT+ +IT      +  +YP T +   Y++ +YP++ P ++ + M  Q    ++   VT+ERY A+ HP  A+   T G  K+  I+ +  ++ +N+PRF+E   + +  +P  +  +     S LR +  Y  +Y    Y ++  I P   +  LN  + + +K A                  +R+R +++                       +++   +  +++ +V VF +     L+      F ++  H         +SN L+T+ SS NFLIY + G+KF+      F  RRL R
Sbjct:  126 LGILGNIISMIIL-SRPQMRSSINYLLTGLARCDTVLIITSILLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYP-EPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRA------------------NRERQRLSRS---------------------EKREIGLATMLLCVVIVFFMLNFLPLVLNISEAFYSTIDHK-----ITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRLSR 415          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0072980)

HSP 1 Score: 82.8037 bits (203), Expect = 1.565e-16
Identity = 81/336 (24.11%), Postives = 149/336 (44.35%), Query Frame = 1
Query:  331 VGFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHD-IYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFR------FTLRRLCR 1317
            +G +GNIIS+ +L        S + +L  L   DT+ +IT      +  +YP T +   Y++ +YP++ P ++ + M  Q    ++   VT+ERY A+ HP  A+   T G  K+  I+ +  ++ +N+PRF+E   + +  +P  +  +     S LR +  Y  +Y    Y ++  I P   +  LN  + + +K A                  +R+R +++                       +++   +  +++ +V VF +     L+      F ++  H         +SN L+T+ SS NFLIY + G+KF+      F  RRL R
Sbjct:  126 LGILGNIISMIIL-SRPQMRSSINYLLTGLARCDTVLIITSILLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYP-EPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRA------------------NRERQRLSRS---------------------EKREIGLATMLLCVVIVFFMLNFLPLVLNISEAFYSTIDHK-----ITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRLSR 415          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VZW5|FMAR_DROME (FMRFamide receptor OS=Drosophila melanogaster OX=7227 GN=FMRFaR PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.569e-15
Identity = 81/336 (24.11%), Postives = 149/336 (44.35%), Query Frame = 1
Query:  331 VGFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHD-IYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFR------FTLRRLCR 1317
            +G +GNIIS+ +L        S + +L  L   DT+ +IT      +  +YP T +   Y++ +YP++ P ++ + M  Q    ++   VT+ERY A+ HP  A+   T G  K+  I+ +  ++ +N+PRF+E   + +  +P  +  +     S LR +  Y  +Y    Y ++  I P   +  LN  + + +K A                  +R+R +++                       +++   +  +++ +V VF +     L+      F ++  H         +SN L+T+ SS NFLIY + G+KF+      F  RRL R
Sbjct:  126 LGILGNIISMIIL-SRPQMRSSINYLLTGLARCDTVLIITSILLFGIPSIYPYTGHFFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYP-EPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRA------------------NRERQRLSRS---------------------EKREIGLATMLLCVVIVFFMLNFLPLVLNISEAFYSTIDHK-----ITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRLSR 415          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q18321|DAF37_CAEEL (G-protein coupled receptor daf-37 OS=Caenorhabditis elegans OX=6239 GN=daf-37 PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 5.598e-8
Identity = 85/339 (25.07%), Postives = 141/339 (41.59%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPS-IILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQY---HDIYPYLVPYL---WSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDV-INFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLN----VSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICE----IPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTL 1302
            G  GN  + T LI+   + ++P+ + L  L V D+  LIT FF      +Y M  Y+++Y    D+Y   + YL   ++L+   Q    ++ V VT+ERY A+ HP  +K     G      +     AVVFN  +F+E  V +N       N+       S +  N IY  +Y                 LW+     V    L     N +I   +  +        Q++ V   +  +  P     IS+     ++EK+R    +++++V +F+ C     +  L+ + +        H     ++    N L  + SS NF+IY L GK FR  L
Sbjct:   47 GLFGN--ATTALILTRPSMRNPNNLFLTALAVFDSCLLITAFF------IYAM-EYIIEYTAAFDLYVAWLTYLRFAFALSHISQTGSVYITVAVTIERYLAVCHPKSSKNMCGPGGAAWTILGVTTFAVVFNCTKFFELQVTVNPSCPDGSNWQSYILLPSAMASNPIYQQVYS----------------LWVTNFVMVFFPFLTLLLFNAIIAYTIRQSLEKYDFHNQKSVVAALSASVNLPRNIAGISSR--NELKEKSREATLVLVIIVFIFLGCNFWGFVLTLLERIMGQETLMVEHHIFYTFSREAINFLAIINSSINFVIYLLFGKDFRKEL 358          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUB8 (GCR091 OS=Schmidtea mediterranea OX=79327 GN=gcr091 PE=2 SV=1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 380/380 (100.00%), Postives = 380/380 (100.00%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRLCRRSTQSKIPRIFLAAAWKRINQTNTKSSLKRPAKQYELVLNRRPCIDLGAHIY 1473
            GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKLISILSIALAVVFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRLCRRSTQSKIPRIFLAAAWKRINQTNTKSSLKRPAKQYELVLNRRPCIDLGAHIY
Sbjct:   85 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKLISILSIALAVVFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRLCRRSTQSKIPRIFLAAAWKRINQTNTKSSLKRPAKQYELVLNRRPCIDLGAHIY 464          

HSP 2 Score: 176.792 bits (447), Expect = 5.282e-46
Identity = 84/90 (93.33%), Postives = 85/90 (94.44%), Query Frame = 2
Query:   83 MVLMNINGLFSELQIPNTLIRVHNSEMHLFLSTNESEWSPICRDLIKTDHQEFYRYCILLKYSFTPHVFMFLLESVILGLICVLDSSGTL 352
            MVLMNINGLFSELQIPNTLIRVHNSEMHLFLSTNESEWSPICRDLIKTDHQEFYRYCILLKYSFTPHVFMFLLESVILGLICV    G +
Sbjct:    1 MVLMNINGLFSELQIPNTLIRVHNSEMHLFLSTNESEWSPICRDLIKTDHQEFYRYCILLKYSFTPHVFMFLLESVILGLICVFGFIGNI 90          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8JS69 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.354e-58
Identity = 132/332 (39.76%), Postives = 199/332 (59.94%), Query Frame = 1
Query:  331 VGFIGNIISITVLIME-SHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRID----PCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNL--IIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQE-KNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHD--SPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRF 1296
            VG +GN+++  VL  + SH   +   +LR LC +D++FL   F YSSLR VYP+T +L  Y+  +PY++ +LW  AMT QM VNW VVLVT ERY  +  PF A  + +   ++L++  ++A  V+FN+PR++EW V    +     PCFNY+   A +S LR+N  YSI+YRS+ Y   V + P+A +++LN+ LI  +K+A      +   V +N+    S+   +  N    Q    AA     +   +CI E ++RS+   I+++ SVFIICE P ++H  LA    S +    S  +YTV++SNAL+  KSSSNF+IYC  G+KFR+
Sbjct:  542 VGLLGNLLTFVVLSNDRSHMGTN--FLLRCLCAADSVFLTECFLYSSLRSVYPITGWLKAYYHYFPYIIQWLWGAAMTTQMLVNWFVVLVTAERYTVVCRPFQASTWCSQRRVRLLAAGTLAYCVLFNLPRYFEWTVQPSSMGLLSVPCFNYTRYSAQDSWLRQNLAYSIVYRSLLYTTQVVVLPIAAIVFLNIRLISTLKAARRERYEMQSPVRSNSRSLLSAAHCSGAN----QHGVAAAHAMPESPQLKCITEGQHRSITLTIVVICSVFIICETPGMVHNILASHHRSETMASWSVFVYTVTISNALMVAKSSSNFVIYCCCGRKFRY 867          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7T428 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_209780 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 5.683e-28
Identity = 95/343 (27.70%), Postives = 161/343 (46.94%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPA------LIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRR-LCRRSTQSKIP 1341
            G  GNII+I VL  +    ++   +L+ L ++D L+LIT  FY +L  +   T ++      +PY+ PY+W  A   QM+  WLVV+VT +RY A+  P  A ++ T   ++    +   ++V++N+PRF+E   ++   D   N +V ++  + LR+N +Y  +Y++  +  +  + P++ + + N  LI+ IK               S     R R+      Y L                           ++++V VF ICE P       ++H++L   V   +    +  T   SN  +T+ S  NF+IYC  G+KFR  L+R LC RS     P
Sbjct:   37 GITGNIITILVLGKDCSIRRTTGFLLQTLALTDCLYLITCLFYQTLNTIQAFTDWISGLKTFWPYVEPYVWPCASIAQMSAVWLVVVVTADRYVAICRPLHAPQYSTMSRIRRAVAVVCVVSVLYNLPRFFERTTLH-EWDSALNRTVAKSSRTWLRDNYLYVSIYKTFLFIGVRFLAPLSLLAFFNTRLIQAIKE--------------SYRLQERNRDTFKKERYTL--------------------------TLVVVVIVFAICETPDFCLRLIMLHRYLPGVVYPRNTLKAINVT---SNLCLTINSCINFVIYCFLGQKFRRILKRMLCGRSRPRDHP 335          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4S2LUZ5 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004673 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.555e-27
Identity = 124/422 (29.38%), Postives = 190/422 (45.02%), Query Frame = 1
Query:  325 LRVGFIGNIISITVLIME-SHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSH--------------------------LRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAG---NNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRS----VNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLR----RLCRRSTQSKIPRIFLAAAWKRINQTNT-KSSL--------KRPAKQYELVLNRRPC 1449
            L  G  GNI+S  VLI + SH + S  +IL  L VSDTLFLI   F+  LR  + +    + Y + Y ++  +L+   MT++M  NW+VVLVT ER+ A+  P  A    T G  ++  I    L  ++NIP F   + +     P F Y     ++ H                          +REN  + + YR + Y VL+   P   +  LN+ LI+ IK A      ++ R   AN  +   SR   Q +     + +       +  Y   +++  RS    VNRL + ++ +++ICE+PA+ +Q + +      H   +  T  ++NALV L S  NF IY   G++FR  L+    RLC R  ++        A   RI  +N   SSL        ++   Q  LV  R PC
Sbjct:   75 LLAGITGNILSCFVLIRDRSHGTTS--LILTCLAVSDTLFLIGCMFFQFLR-TFSVFILWINYMNFYAHVSKFLYGAGMTVRMVRNWMVVLVTTERWVAVCKPLHAPTICTRGKARIAIICLCILCALYNIPHFLLVEAV-----PLFCYGSKSTEHVHQKETLSILDDKIPRGVLIYHSLLRKWVRENYPFRLFYRLIGYTVLIVALPTVIIGILNILLIRGIKYANARRAQIVARIDCANRQLDQCSRTCTQSDDRPNMISRLTPENFENHTYFVRVEKSTRSRSGEVNRLCVGVIVIYLICELPAVGYQVIHLL----QHRGAIDITKPVTNALVCLNSGVNFFIYVFLGRRFRSQLKDMLQRLCCRWNRTH------GAEHGRIVHSNAYHSSLGVFGGLPNQKGGDQLGLV-ERPPC 477          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: H2KUB9 (FMRFamide receptor OS=Clonorchis sinensis OX=79923 GN=FR PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.105e-27
Identity = 109/370 (29.46%), Postives = 175/370 (47.30%), Query Frame = 1
Query:  334 GFIGNIISITVLIME-SHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSH--------------------------LRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAG---NNLIIRNVSANTSISHSSRQRNQVNG-PTYQLFQPAASTSIS--TAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLR----RLCRRSTQS 1332
            G  GNI+S  VLI + SH + S  +IL  L +SDTLFLI   F+  LR  + +    + Y ++Y ++  +L+   MT++M  NW+VVLVT ER+ A+  P  A    T G  ++  I    L  ++NIP F   + +     P F Y     ++ H                          ++EN  + +LYR + Y VL+   P   +  LN+ LI+ IK A      ++ R   AN  +   SR   Q +  P      P    + +      +  + ++  VNRL + ++ +++ICE+PA+ +Q + +      H   +  T  ++NALV L S  NF IY   G++FR  L+    RLC R T++
Sbjct:   93 GITGNILSCFVLIRDRSHGTTS--LILTCLAISDTLFLIGCMFFQFLR-TFSVFILWINYMNLYAHVSKFLYGAGMTVRMVRNWMVVLVTTERWVAVCKPLHAPTICTRGKARVAIICLCILCALYNIPHFLLVEAV-----PLFCYGSKSTEHVHQKETVSLLDDKIPRGVLIYHSLLRKWVKENYPFRLLYRLIGYTVLIVALPTVIIGILNILLIRGIKYANARRAQIVARIDCANRQLDQCSRTCTQSDDRPNISRLTPENCENHTYFVRVEKSTRSRSGEVNRLCVGVIVIYLICELPAVGYQVIHLL----QHRGAIDITKPVTNALVCLNSGVNFFIYVFLGRRFRSQLKDMLQRLCCRWTRT 450          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000059705.1 (SMESG000059705.1)

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 380/380 (100.00%), Postives = 380/380 (100.00%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRLCRRSTQSKIPRIFLAAAWKRINQTNTKSSLKRPAKQYELVLNRRPCIDLGAHIY 1473
            GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKLISILSIALAVVFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRLCRRSTQSKIPRIFLAAAWKRINQTNTKSSLKRPAKQYELVLNRRPCIDLGAHIY
Sbjct:   82 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKLISILSIALAVVFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRLCRRSTQSKIPRIFLAAAWKRINQTNTKSSLKRPAKQYELVLNRRPCIDLGAHIY 461          

HSP 2 Score: 172.17 bits (435), Expect = 8.368e-48
Identity = 81/87 (93.10%), Postives = 82/87 (94.25%), Query Frame = 2
Query:   92 MNINGLFSELQIPNTLIRVHNSEMHLFLSTNESEWSPICRDLIKTDHQEFYRYCILLKYSFTPHVFMFLLESVILGLICVLDSSGTL 352
            MNINGLFSELQIPNTLIRVHNSEMHLFLSTNESEWSPICRDLIKTDHQEFYRYCILLKYSFTPHVFMFLLESVILGLICV    G +
Sbjct:    1 MNINGLFSELQIPNTLIRVHNSEMHLFLSTNESEWSPICRDLIKTDHQEFYRYCILLKYSFTPHVFMFLLESVILGLICVFGFIGNI 87          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000051173.1 (SMESG000051173.1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.973e-18
Identity = 86/325 (26.46%), Postives = 156/325 (48.00%), Query Frame = 1
Query:  331 VGFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICE-IPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTL 1302
            +GFIGNI+++TVL   +    + SI L  L + D L LI +F    L   +PM     +  ++  YL   L+ L +  Q +  +++V  T+ER+  +++P +     +      I ++ +  ++++NIPR  E       I  C N +   +    L+++ +Y  +Y +  Y +++ I P   +L LN  L+  IK +  N        N+++S SS Q             P    +I T+       K  ++N +I+ +V  F+IC+ +P + +  +  +    + +  + YT+S  +  V L S+ NFL+YC  GKKFR  L
Sbjct:   30 LGFIGNILTLTVLGNSAMRRLNSSIYLIALAICDILILIGFF----LTFTFPMLKPGFRRQELNDYL---LYPLCLVSQTSAIYIIVGFTIERFIVIRYP-LKNLSLSVKKSVRIVVIIVISSIIYNIPRMIE----QVEIKICINMT---SKKIMLKDHILYKKIYFTYLYPIVMFILPFIVLLILNSCLLHTIKKSWKNHFHNTKGINSNLSTSSSQ-------------PNRRVTIQTS-------KETNLNVMIVGVVFTFLICQFLPMIDNIIIHYYGYPHTLEYYIFYTIS--SLFVVLNSAVNFLLYCFIGKKFRHVL 317          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000046941.1 (SMESG000046941.1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.265e-17
Identity = 89/337 (26.41%), Postives = 144/337 (42.73%), Query Frame = 1
Query:  331 VGFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYL--------WSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIR-ADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSL-IKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRL 1311
            VG +GNIISI VL     +  S S++L  L + D LFLI   +Y     +       V   + +   + YL        W L    +   NW+ V+V ++R+  +  PF A         KL S+    LA+ +NIPR +EW  I  +       S+IR   N  L +   Y ++Y S+ +A+   IGP+  ++  N  L I +IK++      R V  N  I  S R R                                   +++++++ VFI+ E P+   Q +   +  +     ++   S  + L  L SS NF IYC+ G +FR  L+++
Sbjct:   39 VGIVGNIISIIVL-NRDWSRSSMSVLLSGLGMYDILFLILSIYY-----IIVYDGIKVIADEDFKSKILYLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTK-------SIIRLIPNPDLGQT--YHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKR----RQVLINNQIGSSRRTRE---------------------------------TKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSIL---SFVDILTVLNSSLNFFIYCICGLRFRQNLQKV 320          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000002928.1 (SMESG000002928.1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.309e-14
Identity = 94/392 (23.98%), Postives = 171/392 (43.62%), Query Frame = 1
Query:  319 TYLRVGFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYH---------DIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFR---IDPCFNYSVIRADNSHLRENAIY---SILYRSVF--------------YAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRLCRR----STQSKIPRI-FLAAAWKRINQTNTK 1392
            T+  +G IGNI+ + VL  +     + +  L  L +SD+L L++    + ++   P  S  +++          D++    P+    A+  Q+T  WL V+ +++RY  + HPF+A++  T    K + I++  L+  +N+PRF+E    N++   + P FN S+      HL+    Y   S++  +VF              + + V I P+  ++++N+ LI  ++ +   L         S+ H               F PA S  I+              N ++I ++ +F+IC+IP+ I   L         D P+     + N L+ L S+ N + Y    ++FR +L  L +      TQS +  I + AA       TN K
Sbjct:   25 TFSTIGIIGNILCLLVLSQKQMRCSTTNWYLMALSISDSLVLVSTIL-TVIKETIPFDSTKMRWQSWQKYPITLDLFIIFHPF----AILFQVTSIWLTVVFSLDRYFMICHPFMAQRICTVKRSKHVIIITYILSTCYNVPRFFE----NYKHQMMLP-FNVSLPNVTYDHLKPIQEYPQISMIDTTVFGSSWQFKVYYHLWSWIIFVIIIPLMLIIYMNIYLIFEVRKSIKRL--------NSMGH---------------FLPACSEEITRI----------DTNVMLIGVIVIFLICQIPSAISHILWAL------DFPLFIYNEIGNFLIILNSALNIVPYYFFSRRFRSSLINLIKTMLCIKTQSSVTYISYRAAGANSYKMTNQK 367          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000013112.1 (SMESG000013112.1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.256e-12
Identity = 87/323 (26.93%), Postives = 139/323 (43.03%), Query Frame = 1
Query:  334 GFIGNIISITVLIMESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIYPYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKXXXXXXXXXXXXFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTL 1302
            G IGN +S+ VL  +   S S SI L  L + DT+ LI   F   L          +++ ++        +  A+  Q    W+ V +T ERY A+  P  A+ F +        IL    ++ +N+PR+ E       I    N S     N H      +   Y S  Y V++   P+  +  +N  LI+ +K++   L + N +  + IS  SR+                           I+  N +V R+I+++VS+FI C+ PALI+     F    ++D        + N LV L S+ NF++YC  G+KFR T 
Sbjct:   19 GIIGNFLSVIVLKNKVMRS-SVSIYLLALTLWDTVLLICALFIGPL----------MRFENLRVIFFKIFYPPALVAQTATIWITVGLTCERYFAVCFPLKAQFFISMKKSFWCVILISLFSIFYNVPRWLE------EIPMSINNSEHTFVN-HSDSTIGFHKFYYSYAYIVIMFFIPLLVLSSMNYMLIRELKNS--QLYVLNDTNKSLISSKSRR---------------------------IRSDN-NVTRMIVVVVSIFIFCQFPALIYN--IKFGIQPANDISWEIISEIRNFLVILNSAVNFILYCAFGQKFRRTF 291          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frpr-71.934e-1525.34FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-95.987e-1325.09FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-92.970e-1225.26FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-192.597e-1123.53FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-193.696e-1123.53FMRFamide Peptide Receptor family [Source:UniProt... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FMRFaR1.565e-1624.11gene:FBgn0035385 transcript:FBtr0340706[more]
FMRFaR1.565e-1624.11gene:FBgn0035385 transcript:FBtr0332085[more]
FMRFaR1.565e-1624.11gene:FBgn0035385 transcript:FBtr0072980[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9VZW5|FMAR_DROME1.569e-1524.11FMRFamide receptor OS=Drosophila melanogaster OX=7... [more]
sp|Q18321|DAF37_CAEEL5.598e-825.07G-protein coupled receptor daf-37 OS=Caenorhabditi... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUB85.282e-46100.00GCR091 OS=Schmidtea mediterranea OX=79327 GN=gcr09... [more]
A0A1I8JS691.354e-5839.76G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
R7T4285.683e-2827.70G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A4S2LUZ53.555e-2729.38G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
H2KUB94.105e-2729.46FMRFamide receptor OS=Clonorchis sinensis OX=79923... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059705.18.368e-48100.00SMESG000059705.1[more]
SMESG000051173.12.973e-1826.46SMESG000051173.1[more]
SMESG000046941.17.265e-1726.41SMESG000046941.1[more]
SMESG000002928.12.309e-1423.98SMESG000002928.1[more]
SMESG000013112.14.256e-1226.93SMESG000013112.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005583 ID=SMED30005583|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1499bp
ATTTTTCCAGTAATTTCACATTTGGAATTTTCAGCTGATTTTCGACCGGC
CTATTAATGAGAGGATATTTGGAAGCTTAATTATGGTATTAATGAATATA
AATGGCCTGTTTTCTGAACTTCAAATACCAAACACTCTGATTCGAGTTCA
CAATTCAGAAATGCATCTCTTTCTATCTACTAATGAATCCGAATGGTCAC
CAATATGTCGAGATCTGATCAAAACTGATCATCAAGAATTTTACCGTTAT
TGTATATTGCTCAAGTACTCCTTCACGCCTCACGTCTTCATGTTTCTATT
GGAATCAGTTATTCTCGGACTTATTTGCGTGTTGGATTCATCGGGAACAT
TATCTCCATTACTGTACTCATCATGGAAAGCCATGCCAGTCAAAGTCCGA
GTATTATTTTAAGGCTTTTATGCGTTTCAGATACGTTATTTCTGATTACT
TACTTTTTCTATTCGAGTCTGAGACATGTTTATCCGATGACATCGTACTT
AGTACAATATCATGATATTTATCCGTATTTAGTTCCATATTTGTGGTCTT
TGGCCATGACGATTCAAATGACAGTAAATTGGCTAGTAGTCTTAGTTACA
GTGGAAAGATATTGTGCTCTAAAGCACCCTTTCATAGCAAAGAAATTCTT
TACAAATGGCAACCTAAAACTGATTTCTATTCTTTCAATTGCTTTGGCTG
TTGTTTTTAATATTCCTCGGTTTTACGAATGGGATGTTATTAATTTTCGA
ATCGATCCTTGTTTTAATTATAGTGTCATTAGAGCGGATAATTCACATCT
ACGAGAAAATGCAATTTATTCCATTCTATATAGATCAGTGTTTTATGCAG
TTCTAGTAGCAATCGGTCCGGTTGCTTGCGTTTTATGGTTAAATGTTAGT
TTAATTAAATTAATTAAATCCGCGGGAAACAATCTCATCATCCGAAATGT
ATCCGCAAACACATCAATCAGCCATTCGTCAAGACAGAGGAATCAAGTCA
ATGGTCCAACGTACCAACTATTCCAACCAGCCGCAAGTACAAGCATTTCT
ACCGCTTACGGACAATGCATCCAGGAAAAGAATCGAAGCGTTAATAGACT
GATTATACTTCTTGTCAGTGTTTTTATAATTTGTGAAATCCCGGCTTTGA
TTCACCAATTTCTCGCCGTATTTGTCACATCAACCAGCCATGACAGTCCA
ATGATCTATACAGTCAGTCTCAGCAATGCCTTAGTAACGTTGAAATCATC
GAGTAACTTCCTCATCTATTGTCTTGGTGGTAAGAAGTTTAGATTTACAC
TACGACGGCTATGTCGTCGAAGTACTCAAAGTAAAATACCGAGAATATTT
CTAGCTGCTGCGTGGAAACGAATTAATCAAACCAATACAAAATCATCTTT
GAAACGACCGGCGAAACAATATGAGTTGGTTCTCAACCGAAGACCTTGCA
TAGATCTGGGGGCCCATATTTATTAATATTAAATGCATTAATATTTCAT
back to top

protein sequence of SMED30005583-orf-1

>SMED30005583-orf-1 ID=SMED30005583-orf-1|Name=SMED30005583-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=368bp
MESHASQSPSIILRLLCVSDTLFLITYFFYSSLRHVYPMTSYLVQYHDIY
PYLVPYLWSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKL
ISILSIALAVVFNIPRFYEWDVINFRIDPCFNYSVIRADNSHLRENAIYS
ILYRSVFYAVLVAIGPVACVLWLNVSLIKLIKSAGNNLIIRNVSANTSIS
HSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSV
FIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYC
LGGKKFRFTLRRLCRRSTQSKIPRIFLAAAWKRINQTNTKSSLKRPAKQY
ELVLNRRPCIDLGAHIY*
back to top

protein sequence of SMED30005583-orf-2

>SMED30005583-orf-2 ID=SMED30005583-orf-2|Name=SMED30005583-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MVLMNINGLFSELQIPNTLIRVHNSEMHLFLSTNESEWSPICRDLIKTDH
QEFYRYCILLKYSFTPHVFMFLLESVILGLICVLDSSGTLSPLLYSSWKA
MPVKVRVLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 76..98