Delta-1-pyrroline-5-carboxylate synthase

Overview
NameDelta-1-pyrroline-5-carboxylate synthase
Smed IDSMED30005571
Length (bp)2389
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Delta-1-pyrroline-5-carboxylate synthase (SMED30005571) t-SNE clustered cells

Violin plots show distribution of expression levels for Delta-1-pyrroline-5-carboxylate synthase (SMED30005571) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Delta-1-pyrroline-5-carboxylate synthase (SMED30005571) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Delta-1-pyrroline-5-carboxylate synthase (SMED30005571) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005571

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005571SMESG000045474.1 Contig6462newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005571SMESG000045474.1 Contig6462uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parapharyngeal regionSMED30005571SMESG000045474.1 SMED30005571smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005571SMESG000045474.1 SMED30005571smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30005571SMESG000045474.1 SMED30005571smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nu neoblastSMED30005571SMESG000045474.1 SMED30005571smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005571SMESG000045474.1 dd_Smed_v4_1060_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005571SMESG000045474.1 dd_Smed_v4_1060_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005571SMESG000045474.1 dd_Smed_v4_1060_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005571SMESG000045474.1 dd_Smed_v4_1060_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005571SMESG000045474.1 dd_Smed_v4_1060_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig35696newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig35696uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig49861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig49861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig6462newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig6462uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig22513uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig22513newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig18337newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig18337uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig27721newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005571SMESG000045474.1 Contig27721uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Human
Match: ALDH18A1 (aldehyde dehydrogenase 18 family member A1 [Source:HGNC Symbol;Acc:HGNC:9722])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 416/731 (56.91%), Postives = 547/731 (74.83%), Query Frame = 2
Query:  149 GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF+++Q R NL GTL+ELL +NI+PI+NTNDAV PP + +SDLQGVIS+KDNDSLAAR+A EM  DLLI++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR     L      QRA  I  LADLL + +++IL+AN +D   A+  L   +L RL L++SKL +LAIGL QIA S  + + RVLR+T +A +L LE++T+PIGVLLVIFESRPDCLPQVA+LAIASGNG+LLKGG EA +SN+ L  L ++AL   G+  +AV LV+ RE+++ L +L+K IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CH++VD  A+++   R+V+DSKC+YPAACNA+ETLLIH+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L   +EVVDNV DAIDHI  +GS HTD I+TE+++TA  FLQ+VDSACVF NASTRF+DGYRFGLGAEVGISTSRIHARGPVG++GLLT+KW+LRGK H V DFS+ G   + H++L
Sbjct:   58 GKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVK-EAVQLVNTREEVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTEDENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENL 785          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Human
Match: ALDH18A1 (aldehyde dehydrogenase 18 family member A1 [Source:HGNC Symbol;Acc:HGNC:9722])

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 416/733 (56.75%), Postives = 547/733 (74.62%), Query Frame = 2
Query:  149 GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF+++Q R NL GTL+ELL +NI+PI+NTNDAV PP + +SDLQGV  IS+KDNDSLAAR+A EM  DLLI++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR     L      QRA  I  LADLL + +++IL+AN +D   A+  L   +L RL L++SKL +LAIGL QIA S  + + RVLR+T +A +L LE++T+PIGVLLVIFESRPDCLPQVA+LAIASGNG+LLKGG EA +SN+ L  L ++AL   G+  +AV LV+ RE+++ L +L+K IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CH++VD  A+++   R+V+DSKC+YPAACNA+ETLLIH+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L   +EVVDNV DAIDHI  +GS HTD I+TE+++TA  FLQ+VDSACVF NASTRF+DGYRFGLGAEVGISTSRIHARGPVG++GLLT+KW+LRGK H V DFS+ G   + H++L
Sbjct:   58 GKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVK-EAVQLVNTREEVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTEDENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENL 787          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Celegans
Match: alh-13 (Probable delta-1-pyrroline-5-carboxylate synthase Glutamate 5-kinase Gamma-glutamyl phosphate reductase [Source:UniProtKB/Swiss-Prot;Acc:P54889])

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 410/744 (55.11%), Postives = 535/744 (71.91%), Query Frame = 2
Query:  101 SPASVHNKNFNTSNILGR-VASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTP-QEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS-LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLN-SDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSL 2320
            +P  V N N+ T       + ++R+DLK ++R+VVKLGSAVITR DECGLALGRLASIVEQ+SE+ Q G+++++V+SGAVAFG+QKL  +  M+MS++QTL+    ++      D RACAA+GM GLMSLYEQLFQQYG+  A++LLTKPD  +DQ R NL+ T+  LL LNIIPI+N NDAVAP P L+      + I DNDSLAAR++AE+  +LLII+S+V+G+Y+ PP+ EGS L+ TY  +  S  + FG  S+ GTGGMESK  A   AL  G++ VI  G  ++A+ + V GKK+GT F  T   E   +E  AE  R A  +L   ++ +R   +R LA LL++ +  I+ AN  D   AK + LD  +L+RLK+T  K+Q L  GLN IADS + L+ RVL+K +++  L LE++T+PIG L+VIFESRPDCLPQVASLA+ASGN +LLKGG EA  SNK L  LV++AL + G    DAV LV  RED+  LLQL   IDL+IPRGSS ++  ++  SK IPVLGH+EGVCHV++D+  + + A++IV+DSKCDYP+ACNA ET+LIHK L    FF+ L  M     V++ +GPKLA  LKF     A  M  EYGSL CT+EVVDNV +A+ HI  +GS HT++IITEN +TA  FL++VDSAC FHNASTRFADGYRFGLGAEVGIST RIHARGPVGV+GLLT+KW+LRG+GH V+DF  GK+S+ H++L
Sbjct:   50 TPVGVGNGNYCTKTRQKHPLINTRNDLKKAQRVVVKLGSAVITREDECGLALGRLASIVEQVSELQQSGRQMLIVSSGAVAFGRQKLRQELVMSMSMRQTLRGPSGMT-----ADKRACAASGMPGLMSLYEQLFQQYGITVAQVLLTKPDIDDDQRRKNLQATIESLLSLNIIPIVNANDAVAPDPKLN------MHISDNDSLAARLSAEIEAELLIILSNVNGVYTGPPDLEGSRLLYTYVPSENS-GVTFGANSKFGTGGMESKVTACVNALNNGVTTVITNGLAQDAITDAVAGKKIGTMFCNTKGYEGPPIEEVAEKCRDAGRQLAALSNKERGAMVRHLAALLVDKEKYIIEANQTDLANAKSAGLDPQLLNRLKMTPEKIQDLHAGLNTIADSAETLVGRVLKKVKISEGLFLEQVTVPIGSLMVIFESRPDCLPQVASLAMASGNALLLKGGKEAEESNKALHALVQEALGTHGFEMRDAVTLVRSREDVADLLQLKDLIDLIIPRGSSDLVRSMQEKSKGIPVLGHAEGVCHVYIDKDCDEQKAIQIVRDSKCDYPSACNAAETILIHKDLATAPFFDSLCSMFKAEGVKLHAGPKLAALLKFAPPP-AESMSFEYGSLECTLEVVDNVEEAVAHIIRYGSGHTESIITENTNTAEHFLKHVDSACAFHNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWLLRGEGHLVEDFKNGKYSYLHENL 780          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Celegans
Match: alh-13 (Probable delta-1-pyrroline-5-carboxylate synthase Glutamate 5-kinase Gamma-glutamyl phosphate reductase [Source:UniProtKB/Swiss-Prot;Acc:P54889])

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 410/746 (54.96%), Postives = 536/746 (71.85%), Query Frame = 2
Query:  101 SPASVHNKNFNTSNILGR---VASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTP-QEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS-LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLN-SDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSL 2320
            +P  V N N+  S    +   + ++R+DLK ++R+VVKLGSAVITR DECGLALGRLASIVEQ+SE+ Q G+++++V+SGAVAFG+QKL  +  M+MS++QTL+    ++      D RACAA+GM GLMSLYEQLFQQYG+  A++LLTKPD  +DQ R NL+ T+  LL LNIIPI+N NDAVAP P L+      + I DNDSLAAR++AE+  +LLII+S+V+G+Y+ PP+ EGS L+ TY  +  S  + FG  S+ GTGGMESK  A   AL  G++ VI  G  ++A+ + V GKK+GT F  T   E   +E  AE  R A  +L   ++ +R   +R LA LL++ +  I+ AN  D   AK + LD  +L+RLK+T  K+Q L  GLN IADS + L+ RVL+K +++  L LE++T+PIG L+VIFESRPDCLPQVASLA+ASGN +LLKGG EA  SNK L  LV++AL + G    DAV LV  RED+  LLQL   IDL+IPRGSS ++  ++  SK IPVLGH+EGVCHV++D+  + + A++IV+DSKCDYP+ACNA ET+LIHK L    FF+ L  M     V++ +GPKLA  LKF     A  M  EYGSL CT+EVVDNV +A+ HI  +GS HT++IITEN +TA  FL++VDSAC FHNASTRFADGYRFGLGAEVGIST RIHARGPVGV+GLLT+KW+LRG+GH V+DF  GK+S+ H++L
Sbjct:   50 TPVGVGNGNYCYSTKTRQKHPLINTRNDLKKAQRVVVKLGSAVITREDECGLALGRLASIVEQVSELQQSGRQMLIVSSGAVAFGRQKLRQELVMSMSMRQTLRGPSGMT-----ADKRACAASGMPGLMSLYEQLFQQYGITVAQVLLTKPDIDDDQRRKNLQATIESLLSLNIIPIVNANDAVAPDPKLN------MHISDNDSLAARLSAEIEAELLIILSNVNGVYTGPPDLEGSRLLYTYVPSENS-GVTFGANSKFGTGGMESKVTACVNALNNGVTTVITNGLAQDAITDAVAGKKIGTMFCNTKGYEGPPIEEVAEKCRDAGRQLAALSNKERGAMVRHLAALLVDKEKYIIEANQTDLANAKSAGLDPQLLNRLKMTPEKIQDLHAGLNTIADSAETLVGRVLKKVKISEGLFLEQVTVPIGSLMVIFESRPDCLPQVASLAMASGNALLLKGGKEAEESNKALHALVQEALGTHGFEMRDAVTLVRSREDVADLLQLKDLIDLIIPRGSSDLVRSMQEKSKGIPVLGHAEGVCHVYIDKDCDEQKAIQIVRDSKCDYPSACNAAETILIHKDLATAPFFDSLCSMFKAEGVKLHAGPKLAALLKFAPPP-AESMSFEYGSLECTLEVVDNVEEAVAHIIRYGSGHTESIITENTNTAEHFLKHVDSACAFHNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWLLRGEGHLVEDFKNGKYSYLHENL 782          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Fly
Match: CG7470 (gene:FBgn0037146 transcript:FBtr0309869)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 408/729 (55.97%), Postives = 541/729 (74.21%), Query Frame = 2
Query:  161 SSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSD-----LQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQV--ELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS-LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            + RS LK ++R+VVKLGSAVITR D  GLALGRLASIVEQ++E   +G+E+++VTSGAVAFGKQKL  +  M++S+++TL            ++PRA AA G SGLMSLY+ +F QYG++ A++L+TKPDFYN++TR NL  TL+EL+ LNI+PIINTNDAV+PP  +  D      +  I IKDNDSL+A +AAE+  DLLI+MSDVDG+Y++PP E+G+ L+ TY T+  S ++EFG KS+VGTGGM+SK KAA WAL +G+SVVIC G  E A+  I+ G+KVGTFFT   +  N V  E+ AE AR  S ++   T  QRA+++  LADLL+  +  IL AN +D   A+ S L + +LSRL L  +KL+ L++GL QIA+     + RVLR+T LA  L L+++T+PIGVLLVIFESRPD LPQVA+LA+AS NG+LLKGG EA +SNK L +LVK+AL + G    AV+LVS RE+I  LL +  +IDL+IPRGSS ++  I+  S  IPVLGH+EGVCHV++D  A+LE ALRI +D+KCDYPAACNAMETLLIH+ L+    F  + +ML +  V+I++GP+L + L F     A  +K EYG+L C +EVV ++++AI+HI  +GS HTD I+TEND+ A  FL +VDSACVFHNAS+RFADG+RFGLGAEVGIST+RIHARGPVGV+GLLT+KWIL G+ H   DF++ G  ++ H++L
Sbjct:   48 TERSQLKYARRLVVKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLMSLSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYNEETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAMLAAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTY-TSDDSNSIEFGKKSKVGTGGMDSKVKAATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATESANAVPVEVMAENARTGSRQMQALTPAQRASAVNTLADLLVSREKFILDANAKDLAEAQKSGLAKPLLSRLSLNPAKLKNLSVGLKQIAEDSHKNVGRVLRRTRLADQLELKQVTVPIGVLLVIFESRPDSLPQVAALAMASANGLLLKGGKEAAHSNKALMELVKEALATVGAEH-AVSLVSTREEISDLLSMENHIDLIIPRGSSDLVRSIQQQSLHIPVLGHAEGVCHVYIDRDADLEKALRIARDAKCDYPAACNAMETLLIHEDLMSGAIFGDVCNMLKREGVKIYAGPRLNQQLTF-GPPAAKSLKHEYGALECCIEVVPSLDEAINHIHTYGSSHTDVIVTENDAAARQFLGSVDSACVFHNASSRFADGFRFGLGAEVGISTARIHARGPVGVEGLLTTKWILEGQDHAAADFAEGGGRTWLHETL 773          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Fly
Match: CG7470 (gene:FBgn0037146 transcript:FBtr0078477)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 408/729 (55.97%), Postives = 541/729 (74.21%), Query Frame = 2
Query:  161 SSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSD-----LQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQV--ELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS-LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            + RS LK ++R+VVKLGSAVITR D  GLALGRLASIVEQ++E   +G+E+++VTSGAVAFGKQKL  +  M++S+++TL            ++PRA AA G SGLMSLY+ +F QYG++ A++L+TKPDFYN++TR NL  TL+EL+ LNI+PIINTNDAV+PP  +  D      +  I IKDNDSL+A +AAE+  DLLI+MSDVDG+Y++PP E+G+ L+ TY T+  S ++EFG KS+VGTGGM+SK KAA WAL +G+SVVIC G  E A+  I+ G+KVGTFFT   +  N V  E+ AE AR  S ++   T  QRA+++  LADLL+  +  IL AN +D   A+ S L + +LSRL L  +KL+ L++GL QIA+     + RVLR+T LA  L L+++T+PIGVLLVIFESRPD LPQVA+LA+AS NG+LLKGG EA +SNK L +LVK+AL + G    AV+LVS RE+I  LL +  +IDL+IPRGSS ++  I+  S  IPVLGH+EGVCHV++D  A+LE ALRI +D+KCDYPAACNAMETLLIH+ L+    F  + +ML +  V+I++GP+L + L F     A  +K EYG+L C +EVV ++++AI+HI  +GS HTD I+TEND+ A  FL +VDSACVFHNAS+RFADG+RFGLGAEVGIST+RIHARGPVGV+GLLT+KWIL G+ H   DF++ G  ++ H++L
Sbjct:   48 TERSQLKYARRLVVKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLMSLSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYNEETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAMLAAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTY-TSDDSNSIEFGKKSKVGTGGMDSKVKAATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATESANAVPVEVMAENARTGSRQMQALTPAQRASAVNTLADLLVSREKFILDANAKDLAEAQKSGLAKPLLSRLSLNPAKLKNLSVGLKQIAEDSHKNVGRVLRRTRLADQLELKQVTVPIGVLLVIFESRPDSLPQVAALAMASANGLLLKGGKEAAHSNKALMELVKEALATVGAEH-AVSLVSTREEISDLLSMENHIDLIIPRGSSDLVRSIQQQSLHIPVLGHAEGVCHVYIDRDADLEKALRIARDAKCDYPAACNAMETLLIHEDLMSGAIFGDVCNMLKREGVKIYAGPRLNQQLTF-GPPAAKSLKHEYGALECCIEVVPSLDEAINHIHTYGSSHTDVIVTENDAAARQFLGSVDSACVFHNASSRFADGFRFGLGAEVGISTARIHARGPVGVEGLLTTKWILEGQDHAAADFAEGGGRTWLHETL 773          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Zebrafish
Match: aldh18a1 (aldehyde dehydrogenase 18 family, member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-5602])

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 420/737 (56.99%), Postives = 549/737 (74.49%), Query Frame = 2
Query:  149 GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKT----LHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS--LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            G+  + RS+L+ +KRIVVKLGSAV+TR DECGLALGRLASIVEQ++ +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +    L D+S   P ++ RACAAAG SGLM+LYE +F QY   TA+IL+T  DF+++Q R NL  TL ELL +NI+PIINTNDAV PPP+ +SDLQGV  ISIKDNDSLAAR+A EM  DLLI +SDV+GLY  PP  + + L+DT+       ++ +G KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR A   L      QR++ I  LADLL E + +IL AN +D   A  +  L   ML RL L+SSKL +L+IGL QIA S  + + RVLR+T +A +L LE+IT+PIGVLLVIFESRPDCLPQV++LAIASGN +LLKGG EA N+N+ L +L ++AL   G+  DA+ LVS RE+++ L +L K IDL+IPRGSSQ++  I+  +K IPVLGHSEG+CHV+VD  A+++ A++I++DSKCDYPAACNAMETLL+H+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L C +EVVD++ +AIDHI  +GS HTD I+TEN++TA  FLQ +DSACVF NAS+RFADGYRFGLGAEVGIST+RIHARGPVG++GLLT+KW+LRG+GH V DFS+ G  ++ H++L
Sbjct:   38 GKSFAHRSELRQAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVAMLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMS--LPVLEARACAAAGQSGLMALYEAMFTQYSTCTAQILVTNLDFHDEQKRRNLNSTLYELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMRADLLIALSDVEGLYDSPPGSDDAKLLDTFYPGD-QQSITYGTKSRVGIGGMEAKVKAALWALQGGTSVVIANGTHPKVTGHVITDIVEGKKVGTFFSEVKPAGPTVEQQTEMARSAGRTLASLEPEQRSDIICALADLLTERKEEILSANKKDMENAVNTGRLSPAMLKRLSLSSSKLNSLSIGLRQIAVSSQDSVGRVLRRTRVANNLELEQITVPIGVLLVIFESRPDCLPQVSALAIASGNALLLKGGKEAANTNRILHELAQEALSIHGVK-DAIQLVSTREEVEDLCRLEKMIDLIIPRGSSQLVRDIQRAAKGIPVLGHSEGICHVYVDHEASIDKAIKIIRDSKCDYPAACNAMETLLVHRDLLRTPVFDQIIDMLRTEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLECCIEVVDSMQEAIDHIHKYGSSHTDVIVTENENTAEQFLQQLDSACVFWNASSRFADGYRFGLGAEVGISTARIHARGPVGLEGLLTTKWVLRGEGHTVADFSEHGSMTYLHENL 769          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Zebrafish
Match: aldh18a1 (aldehyde dehydrogenase 18 family, member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-5602])

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 420/737 (56.99%), Postives = 549/737 (74.49%), Query Frame = 2
Query:  149 GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKT----LHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS--LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            G+  + RS+L+ +KRIVVKLGSAV+TR DECGLALGRLASIVEQ++ +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +    L D+S   P ++ RACAAAG SGLM+LYE +F QY   TA+IL+T  DF+++Q R NL  TL ELL +NI+PIINTNDAV PPP+ +SDLQGV  ISIKDNDSLAAR+A EM  DLLI +SDV+GLY  PP  + + L+DT+       ++ +G KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR A   L      QR++ I  LADLL E + +IL AN +D   A  +  L   ML RL L+SSKL +L+IGL QIA S  + + RVLR+T +A +L LE+IT+PIGVLLVIFESRPDCLPQV++LAIASGN +LLKGG EA N+N+ L +L ++AL   G+  DA+ LVS RE+++ L +L K IDL+IPRGSSQ++  I+  +K IPVLGHSEG+CHV+VD  A+++ A++I++DSKCDYPAACNAMETLL+H+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L C +EVVD++ +AIDHI  +GS HTD I+TEN++TA  FLQ +DSACVF NAS+RFADGYRFGLGAEVGIST+RIHARGPVG++GLLT+KW+LRG+GH V DFS+ G  ++ H++L
Sbjct:   38 GKSFAHRSELRQAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVAMLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMS--LPVLEARACAAAGQSGLMALYEAMFTQYSTCTAQILVTNLDFHDEQKRRNLNSTLYELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMRADLLIALSDVEGLYDSPPGSDDAKLLDTFYPGD-QQSITYGTKSRVGIGGMEAKVKAALWALQGGTSVVIANGTHPKVTGHVITDIVEGKKVGTFFSEVKPAGPTVEQQTEMARSAGRTLASLEPEQRSDIICALADLLTERKEEILSANKKDMENAVNTGRLSPAMLKRLSLSSSKLNSLSIGLRQIAVSSQDSVGRVLRRTRVANNLELEQITVPIGVLLVIFESRPDCLPQVSALAIASGNALLLKGGKEAANTNRILHELAQEALSIHGVK-DAIQLVSTREEVEDLCRLEKMIDLIIPRGSSQLVRDIQRAAKGIPVLGHSEGICHVYVDHEASIDKAIKIIRDSKCDYPAACNAMETLLVHRDLLRTPVFDQIIDMLRTEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLECCIEVVDSMQEAIDHIHKYGSSHTDVIVTENENTAEQFLQQLDSACVFWNASSRFADGYRFGLGAEVGISTARIHARGPVGLEGLLTTKWVLRGEGHTVADFSEHGSMTYLHENL 769          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Xenopus
Match: aldh18a1 (aldehyde dehydrogenase 18 family member A1 [Source:NCBI gene;Acc:550060])

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 429/762 (56.30%), Postives = 553/762 (72.57%), Query Frame = 2
Query:  104 PASVHNKNFNTSNIL----------GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKT----LHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLA--KYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFS-QGKFSFTHKSL 2320
            P S H    + SNI           G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +    L D+    P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF+++Q R NL GTL+ELL +NI+PIINTNDAV PPP+ +SDLQGV  ISIKDNDSLAAR+A EM  DL+I++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE QAE+AR     L      QRA  I  LADLL +H+ +IL AN +D   A  K  L   +L RL L+++KL +L+IGL QIA S  + + RVLR+T +A DL LEE+T+PIGVLLVIFESRPDCLPQV++LAIASGNG+LLKGG EA N+N+ L++L ++AL   G+  DAV LV+ RE+++ L +LNK IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CHV+VD  A+++   RIV+DSKC+YPAACNAMETLLIH+ ++ T  F+++ DML   QV+I +GP+ A  L F  +++ + ++ EYG L C +EVVD V DAI+HI  +GS HTD IITEN+ TA  FLQ+VDSACVF N STRF+DGYRFGLGAEVGIST+RIHARGPVG++GLLT+KWILRG+ H V DFS QG   + H+ L
Sbjct:   34 PGSTHQTARHWSNIPFITVPHMRSHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMQV--PVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMKADLIIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVKPAGPTVEQQAEMARTGGRSLATLLPEQRAEIIFHLADLLTDHREEILSANKKDMDEAEDKGRLAAPLLKRLSLSTAKLNSLSIGLRQIAASSQDSVGRVLRRTRIAKDLELEEVTVPIGVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAANTNQILYRLTQEALSLHGVR-DAVQLVNTREEVEDLCRLNKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHVYVDSDASVDKVTRIVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRVEQVKIHAGPRFASYLTFSPSEVKS-LRTEYGDLECCLEVVDGVQDAIEHIHKYGSSHTDAIITENEQTAEYFLQHVDSACVFWNTSTRFSDGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWILRGENHVVSDFSEQGSKKYLHEKL 790          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Xenopus
Match: aldh18a1 (aldehyde dehydrogenase 18 family member A1 [Source:NCBI gene;Acc:550060])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 414/756 (54.76%), Postives = 535/756 (70.77%), Query Frame = 2
Query:  104 PASVHNKNFNTSNIL----------GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLA--KYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFS-QGKFSFTHKSL 2320
            P S H    + SNI           G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +  +  +  P +  R C    M         L   Y     +IL+T  DF+++Q R NL GTL+ELL +NI+PIINTNDAV PPP+ +SDLQGVISIKDNDSLAAR+A EM  DL+I++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE QAE+AR     L      QRA  I  LADLL +H+ +IL AN +D   A  K  L   +L RL L+++KL +L+IGL QIA S  + + RVLR+T +A DL LEE+T+PIGVLLVIFESRPDCLPQV++LAIASGNG+LLKGG EA N+N+ L++L ++AL   G+  DAV LV+ RE+++ L +LNK IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CHV+VD  A+++   RIV+DSKC+YPAACNAMETLLIH+ ++ T  F+++ DML   QV+I +GP+ A  L F  +++ + ++ EYG L C +EVVD V DAI+HI  +GS HTD IITEN+ TA  FLQ+VDSACVF N STRF+DGYRFGLGAEVGIST+RIHARGPVG++GLLT+KWILRG+ H V DFS QG   + H+ L
Sbjct:   44 PGSTHQTARHWSNIPFITVPHMRSHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMPTIYVRNCIPCTMC--------LPDSYLFWCFQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVISIKDNDSLAARLAVEMKADLIIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVKPAGPTVEQQAEMARTGGRSLATLLPEQRAEIIFHLADLLTDHREEILSANKKDMDEAEDKGRLAAPLLKRLSLSTAKLNSLSIGLRQIAASSQDSVGRVLRRTRIAKDLELEEVTVPIGVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAANTNQILYRLTQEALSLHGVR-DAVQLVNTREEVEDLCRLNKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHVYVDSDASVDKVTRIVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRVEQVKIHAGPRFASYLTFSPSEVKS-LRTEYGDLECCLEVVDGVQDAIEHIHKYGSSHTDAIITENEQTAEYFLQHVDSACVFWNTSTRFSDGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWILRGENHVVSDFSEQGSKKYLHEKL 788          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Xenopus
Match: aldh18a1 (aldehyde dehydrogenase 18 family member A1 [Source:NCBI gene;Acc:550060])

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 417/765 (54.51%), Postives = 538/765 (70.33%), Query Frame = 2
Query:   83 RFLNRISPASVHNKNFNTSNIL----------GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLA--KYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFS-QGKFSFTHKSL 2320
            RF N   P S H    + SNI           G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +  +  +  P +  R C    M         L   Y     +IL+T  DF+++Q R NL GTL+ELL +NI+PIINTNDAV PPP+ +SDLQGV  ISIKDNDSLAAR+A EM  DL+I++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE QAE+AR     L      QRA  I  LADLL +H+ +IL AN +D   A  K  L   +L RL L+++KL +L+IGL QIA S  + + RVLR+T +A DL LEE+T+PIGVLLVIFESRPDCLPQV++LAIASGNG+LLKGG EA N+N+ L++L ++AL   G+  DAV LV+ RE+++ L +LNK IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CHV+VD  A+++   RIV+DSKC+YPAACNAMETLLIH+ ++ T  F+++ DML   QV+I +GP+ A  L F  +++ + ++ EYG L C +EVVD V DAI+HI  +GS HTD IITEN+ TA  FLQ+VDSACVF N STRF+DGYRFGLGAEVGIST+RIHARGPVG++GLLT+KWILRG+ H V DFS QG   + H+ L
Sbjct:    7 RFGN--FPGSTHQTARHWSNIPFITVPHMRSHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMPTIYVRNCIPCTMC--------LPDSYLFWCFQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMKADLIIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVKPAGPTVEQQAEMARTGGRSLATLLPEQRAEIIFHLADLLTDHREEILSANKKDMDEAEDKGRLAAPLLKRLSLSTAKLNSLSIGLRQIAASSQDSVGRVLRRTRIAKDLELEEVTVPIGVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAANTNQILYRLTQEALSLHGVR-DAVQLVNTREEVEDLCRLNKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHVYVDSDASVDKVTRIVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRVEQVKIHAGPRFASYLTFSPSEVKS-LRTEYGDLECCLEVVDGVQDAIEHIHKYGSSHTDAIITENEQTAEYFLQHVDSACVFWNTSTRFSDGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWILRGENHVVSDFSEQGSKKYLHEKL 758          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Xenopus
Match: aldh18a1 (aldehyde dehydrogenase 18 family member A1 [Source:NCBI gene;Acc:550060])

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 414/758 (54.62%), Postives = 535/758 (70.58%), Query Frame = 2
Query:  104 PASVHNKNFNTSNIL----------GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLA--KYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFS-QGKFSFTHKSL 2320
            P S H    + SNI           G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +  +  +  P +  R C    M         L   Y     +IL+T  DF+++Q R NL GTL+ELL +NI+PIINTNDAV PPP+ +SDLQGV  ISIKDNDSLAAR+A EM  DL+I++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE QAE+AR     L      QRA  I  LADLL +H+ +IL AN +D   A  K  L   +L RL L+++KL +L+IGL QIA S  + + RVLR+T +A DL LEE+T+PIGVLLVIFESRPDCLPQV++LAIASGNG+LLKGG EA N+N+ L++L ++AL   G+  DAV LV+ RE+++ L +LNK IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CHV+VD  A+++   RIV+DSKC+YPAACNAMETLLIH+ ++ T  F+++ DML   QV+I +GP+ A  L F  +++ + ++ EYG L C +EVVD V DAI+HI  +GS HTD IITEN+ TA  FLQ+VDSACVF N STRF+DGYRFGLGAEVGIST+RIHARGPVG++GLLT+KWILRG+ H V DFS QG   + H+ L
Sbjct:   31 PGSTHQTARHWSNIPFITVPHMRSHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMPTIYVRNCIPCTMC--------LPDSYLFWCFQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMKADLIIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVKPAGPTVEQQAEMARTGGRSLATLLPEQRAEIIFHLADLLTDHREEILSANKKDMDEAEDKGRLAAPLLKRLSLSTAKLNSLSIGLRQIAASSQDSVGRVLRRTRIAKDLELEEVTVPIGVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAANTNQILYRLTQEALSLHGVR-DAVQLVNTREEVEDLCRLNKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHVYVDSDASVDKVTRIVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRVEQVKIHAGPRFASYLTFSPSEVKS-LRTEYGDLECCLEVVDGVQDAIEHIHKYGSSHTDAIITENEQTAEYFLQHVDSACVFWNTSTRFSDGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWILRGENHVVSDFSEQGSKKYLHEKL 777          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Xenopus
Match: aldh18a1 (aldehyde dehydrogenase 18 family member A1 [Source:NCBI gene;Acc:550060])

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 414/758 (54.62%), Postives = 535/758 (70.58%), Query Frame = 2
Query:  104 PASVHNKNFNTSNIL----------GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLA--KYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFS-QGKFSFTHKSL 2320
            P S H    + SNI           G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +  +  +  P +  R C    M         L   Y     +IL+T  DF+++Q R NL GTL+ELL +NI+PIINTNDAV PPP+ +SDLQGV  ISIKDNDSLAAR+A EM  DL+I++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE QAE+AR     L      QRA  I  LADLL +H+ +IL AN +D   A  K  L   +L RL L+++KL +L+IGL QIA S  + + RVLR+T +A DL LEE+T+PIGVLLVIFESRPDCLPQV++LAIASGNG+LLKGG EA N+N+ L++L ++AL   G+  DAV LV+ RE+++ L +LNK IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CHV+VD  A+++   RIV+DSKC+YPAACNAMETLLIH+ ++ T  F+++ DML   QV+I +GP+ A  L F  +++ + ++ EYG L C +EVVD V DAI+HI  +GS HTD IITEN+ TA  FLQ+VDSACVF N STRF+DGYRFGLGAEVGIST+RIHARGPVG++GLLT+KWILRG+ H V DFS QG   + H+ L
Sbjct:   35 PGSTHQTARHWSNIPFITVPHMRSHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMPTIYVRNCIPCTMC--------LPDSYLFWCFQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMKADLIIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSEVKPAGPTVEQQAEMARTGGRSLATLLPEQRAEIIFHLADLLTDHREEILSANKKDMDEAEDKGRLAAPLLKRLSLSTAKLNSLSIGLRQIAASSQDSVGRVLRRTRIAKDLELEEVTVPIGVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAANTNQILYRLTQEALSLHGVR-DAVQLVNTREEVEDLCRLNKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHVYVDSDASVDKVTRIVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRVEQVKIHAGPRFASYLTFSPSEVKS-LRTEYGDLECCLEVVDGVQDAIEHIHKYGSSHTDAIITENEQTAEYFLQHVDSACVFWNTSTRFSDGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWILRGENHVVSDFSEQGSKKYLHEKL 781          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Mouse
Match: Aldh18a1 (aldehyde dehydrogenase 18 family, member A1 [Source:MGI Symbol;Acc:MGI:1888908])

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 418/759 (55.07%), Postives = 557/759 (73.39%), Query Frame = 2
Query:   92 NRISPASV-HNKNFNT--------SNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            NR+ P+++ H ++++         S   G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF+++Q R NL GTL+ELL +NI+PI+NTNDAV PP + +SDLQGVIS+KDNDSLAAR+A EM  DLLI++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR     L      QRA  I  LADLL + + +IL+AN +D   A+  L   +L RL L++SKL +LAIGL QIA S    + RVLR+T +A +L LE++T+PIGVLLVIFESRPDCLPQVA+LAIASGNG+LLKGG EA +SN+ L  L ++AL   G+  +A+ LV+ RE+++ L +L+K IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CH++VD  A+++   R+V+DSKC+YPAACNA+ETLLIH+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L   +EVVD+V +AIDHI  +GS HTD I+TEN+ TA  FLQ+VDSACVF NASTRF+DGYRFGLGAEVGISTSRIHARGPVG++GLLT+KW+LRG+ H V DFS+ G   + H++L
Sbjct:   30 NRVQPSAIRHVRSWSNIPFITVPLSRAHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGLGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIINHLADLLTDQREEILLANKKDLEEAEGRLASPLLKRLSLSTSKLNSLAIGLRQIAASSQESVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVK-EAIQLVNTREEVEDLCRLDKIIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENL 785          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Mouse
Match: Aldh18a1 (aldehyde dehydrogenase 18 family, member A1 [Source:MGI Symbol;Acc:MGI:1888908])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 418/761 (54.93%), Postives = 557/761 (73.19%), Query Frame = 2
Query:   92 NRISPASV-HNKNFNT--------SNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            NR+ P+++ H ++++         S   G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF+++Q R NL GTL+ELL +NI+PI+NTNDAV PP + +SDLQGV  IS+KDNDSLAAR+A EM  DLLI++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR     L      QRA  I  LADLL + + +IL+AN +D   A+  L   +L RL L++SKL +LAIGL QIA S    + RVLR+T +A +L LE++T+PIGVLLVIFESRPDCLPQVA+LAIASGNG+LLKGG EA +SN+ L  L ++AL   G+  +A+ LV+ RE+++ L +L+K IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CH++VD  A+++   R+V+DSKC+YPAACNA+ETLLIH+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L   +EVVD+V +AIDHI  +GS HTD I+TEN+ TA  FLQ+VDSACVF NASTRF+DGYRFGLGAEVGISTSRIHARGPVG++GLLT+KW+LRG+ H V DFS+ G   + H++L
Sbjct:   30 NRVQPSAIRHVRSWSNIPFITVPLSRAHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGLGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIINHLADLLTDQREEILLANKKDLEEAEGRLASPLLKRLSLSTSKLNSLAIGLRQIAASSQESVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVK-EAIQLVNTREEVEDLCRLDKIIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENL 787          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Mouse
Match: Aldh18a1 (aldehyde dehydrogenase 18 family, member A1 [Source:MGI Symbol;Acc:MGI:1888908])

HSP 1 Score: 139.813 bits (351), Expect = 1.117e-37
Identity = 75/144 (52.08%), Postives = 106/144 (73.61%), Query Frame = 2
Query:   92 NRISPASV-HNKNFNT--------SNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLY 490
            NR+ P+++ H ++++         S   G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LY
Sbjct:   30 NRVQPSAIRHVRSWSNIPFITVPLSRAHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALY 173          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Mouse
Match: Aldh18a1 (aldehyde dehydrogenase 18 family, member A1 [Source:MGI Symbol;Acc:MGI:1888908])

HSP 1 Score: 110.153 bits (274), Expect = 3.124e-28
Identity = 49/73 (67.12%), Postives = 59/73 (80.82%), Query Frame = 2
Query: 1952 MKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLG 2170
            ++ EYG L   +EVVD+V +AIDHI  +GS HTD I+TEN+ TA  FLQ+VDSACVF NASTRF+DGYRFGLG
Sbjct:   11 LRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVFWNASTRFSDGYRFGLG 83          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Mouse
Match: Aldh18a1 (aldehyde dehydrogenase 18 family, member A1 [Source:MGI Symbol;Acc:MGI:1888908])

HSP 1 Score: 82.8037 bits (203), Expect = 6.422e-19
Identity = 42/83 (50.60%), Postives = 61/83 (73.49%), Query Frame = 2
Query:  311 LILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDF 553
            ++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF
Sbjct:    1 MMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDF 83          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. UniProt/SwissProt
Match: sp|Q5R4M8|P5CS_PONAB (Delta-1-pyrroline-5-carboxylate synthase OS=Pongo abelii OX=9601 GN=ALDH18A1 PE=2 SV=1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 417/733 (56.89%), Postives = 547/733 (74.62%), Query Frame = 2
Query:  149 GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF+++Q R NL GTL+ELL +NI+PI+NTNDAV PP + +SDLQGV  IS+KDNDSLAAR+A EM  DLLI++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR     L      QRA  I  LADLL + +++IL+AN +D   A+  L   +L RL L++SKL +LAIGL QIA S  + + RVLR+T +A +L LE++T+PIGVLLVIFESRPDCLPQVA+LAIASGNG+LLKGG EA +SN+ L  L ++AL   G+  +AV LV+ RE+++ L +L+K IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CH++VD  A+++   R+V+DSKC+YPAACNA+ETLLIH+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L   +EVVDNV DAIDHI  +GS HTD I+TEN++TA  FLQ+VDSACVF NASTRF+DGYRFGLGAEVGISTSRIHARGPVG++GLLT+KW+LRGK H V DFS+ G   + H++L
Sbjct:   58 GKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAPPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVK-EAVQLVNTREEVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTENENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENL 787          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. UniProt/SwissProt
Match: sp|Q9Z110|P5CS_MOUSE (Delta-1-pyrroline-5-carboxylate synthase OS=Mus musculus OX=10090 GN=Aldh18a1 PE=1 SV=2)

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 418/761 (54.93%), Postives = 557/761 (73.19%), Query Frame = 2
Query:   92 NRISPASV-HNKNFNT--------SNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            NR+ P+++ H ++++         S   G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF+++Q R NL GTL+ELL +NI+PI+NTNDAV PP + +SDLQGV  IS+KDNDSLAAR+A EM  DLLI++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR     L      QRA  I  LADLL + + +IL+AN +D   A+  L   +L RL L++SKL +LAIGL QIA S    + RVLR+T +A +L LE++T+PIGVLLVIFESRPDCLPQVA+LAIASGNG+LLKGG EA +SN+ L  L ++AL   G+  +A+ LV+ RE+++ L +L+K IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CH++VD  A+++   R+V+DSKC+YPAACNA+ETLLIH+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L   +EVVD+V +AIDHI  +GS HTD I+TEN+ TA  FLQ+VDSACVF NASTRF+DGYRFGLGAEVGISTSRIHARGPVG++GLLT+KW+LRG+ H V DFS+ G   + H++L
Sbjct:   30 NRVQPSAIRHVRSWSNIPFITVPLSRAHGKPFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGLGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIINHLADLLTDQREEILLANKKDLEEAEGRLASPLLKRLSLSTSKLNSLAIGLRQIAASSQESVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVK-EAIQLVNTREEVEDLCRLDKIIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENL 787          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. UniProt/SwissProt
Match: sp|P54886|P5CS_HUMAN (Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 416/733 (56.75%), Postives = 547/733 (74.62%), Query Frame = 2
Query:  149 GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ+S +  QG+E++LVTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY +  A+IL+T  DF+++Q R NL GTL+ELL +NI+PI+NTNDAV PP + +SDLQGV  IS+KDNDSLAAR+A EM  DLLI++SDV+GL+  PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR     L      QRA  I  LADLL + +++IL+AN +D   A+  L   +L RL L++SKL +LAIGL QIA S  + + RVLR+T +A +L LE++T+PIGVLLVIFESRPDCLPQVA+LAIASGNG+LLKGG EA +SN+ L  L ++AL   G+  +AV LV+ RE+++ L +L+K IDL+IPRGSSQ++  I+  +K IPV+GHSEG+CH++VD  A+++   R+V+DSKC+YPAACNA+ETLLIH+ L+ T  F+++ DML   QV+I +GPK A  L F  +++ + ++ EYG L   +EVVDNV DAIDHI  +GS HTD I+TE+++TA  FLQ+VDSACVF NASTRF+DGYRFGLGAEVGISTSRIHARGPVG++GLLT+KW+LRGK H V DFS+ G   + H++L
Sbjct:   58 GKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGD-QQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVK-EAVQLVNTREEVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS-LRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTEDENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENL 787          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. UniProt/SwissProt
Match: sp|P54889|ALH13_CAEEL (Probable delta-1-pyrroline-5-carboxylate synthase OS=Caenorhabditis elegans OX=6239 GN=alh-13 PE=3 SV=2)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 410/746 (54.96%), Postives = 536/746 (71.85%), Query Frame = 2
Query:  101 SPASVHNKNFNTSNILGR---VASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTP-QEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS-LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLN-SDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSL 2320
            +P  V N N+  S    +   + ++R+DLK ++R+VVKLGSAVITR DECGLALGRLASIVEQ+SE+ Q G+++++V+SGAVAFG+QKL  +  M+MS++QTL+    ++      D RACAA+GM GLMSLYEQLFQQYG+  A++LLTKPD  +DQ R NL+ T+  LL LNIIPI+N NDAVAP P L+      + I DNDSLAAR++AE+  +LLII+S+V+G+Y+ PP+ EGS L+ TY  +  S  + FG  S+ GTGGMESK  A   AL  G++ VI  G  ++A+ + V GKK+GT F  T   E   +E  AE  R A  +L   ++ +R   +R LA LL++ +  I+ AN  D   AK + LD  +L+RLK+T  K+Q L  GLN IADS + L+ RVL+K +++  L LE++T+PIG L+VIFESRPDCLPQVASLA+ASGN +LLKGG EA  SNK L  LV++AL + G    DAV LV  RED+  LLQL   IDL+IPRGSS ++  ++  SK IPVLGH+EGVCHV++D+  + + A++IV+DSKCDYP+ACNA ET+LIHK L    FF+ L  M     V++ +GPKLA  LKF     A  M  EYGSL CT+EVVDNV +A+ HI  +GS HT++IITEN +TA  FL++VDSAC FHNASTRFADGYRFGLGAEVGIST RIHARGPVGV+GLLT+KW+LRG+GH V+DF  GK+S+ H++L
Sbjct:   50 TPVGVGNGNYCYSTKTRQKHPLINTRNDLKKAQRVVVKLGSAVITREDECGLALGRLASIVEQVSELQQSGRQMLIVSSGAVAFGRQKLRQELVMSMSMRQTLRGPSGMT-----ADKRACAASGMPGLMSLYEQLFQQYGITVAQVLLTKPDIDDDQRRKNLQATIESLLSLNIIPIVNANDAVAPDPKLN------MHISDNDSLAARLSAEIEAELLIILSNVNGVYTGPPDLEGSRLLYTYVPSENS-GVTFGANSKFGTGGMESKVTACVNALNNGVTTVITNGLAQDAITDAVAGKKIGTMFCNTKGYEGPPIEEVAEKCRDAGRQLAALSNKERGAMVRHLAALLVDKEKYIIEANQTDLANAKSAGLDPQLLNRLKMTPEKIQDLHAGLNTIADSAETLVGRVLKKVKISEGLFLEQVTVPIGSLMVIFESRPDCLPQVASLAMASGNALLLKGGKEAEESNKALHALVQEALGTHGFEMRDAVTLVRSREDVADLLQLKDLIDLIIPRGSSDLVRSMQEKSKGIPVLGHAEGVCHVYIDKDCDEQKAIQIVRDSKCDYPSACNAAETILIHKDLATAPFFDSLCSMFKAEGVKLHAGPKLAALLKFAPPP-AESMSFEYGSLECTLEVVDNVEEAVAHIIRYGSGHTESIITENTNTAEHFLKHVDSACAFHNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWLLRGEGHLVEDFKNGKYSYLHENL 782          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. UniProt/SwissProt
Match: sp|O04226|P5CS1_ORYSJ (Delta-1-pyrroline-5-carboxylate synthase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=P5CS1 PE=2 SV=2)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 331/731 (45.28%), Postives = 470/731 (64.30%), Query Frame = 2
Query:  146 LGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFF-----TLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS-LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSL 2320
            +  V  SRS ++D KR+++K+G+AV++R D   LALGR+ ++ EQ+ E++  G E+ILVTSGAV  G+Q+L ++       K    +  D+ +    +D +ACAA G SGLM+LY+ LF Q  + ++++L+T  DF N + R  L  T+  LL L +IPI N NDA++       D  G+    DNDSLA  +A E+  DLLI++SDVDGLYS PP+E  S +I TY        + FG KSRVG GGM +K KAA  A   G  VVI  G    ++L+++HG+K+GT F          +D      A  AR  S  L   +S +R   +  +AD L  +++ I   N+ D   A+ +  ++ +++RL +   K+ +LA  +  +A+  D + N++L+KTE+A DL+LE+ + P+GVLL++FESRPD L Q+ASLAI SGNG+LLKGG EA  SN  L K++  A+  + +    + LV+ R++I  LL+L+  IDLVIPRGS++++++IK  +K IPVLGH++G+CHV++D+ A+++ A  IV D+K DYPAACNAMETLL+HK L+ +   + +   L    V I+ GP   K+L F  A        EY S++CT+E VD+V  AIDHI  +GS HTD I+T +D  A TFL+ VDSA VFHNASTRF+DG RFGLGAEVGIST RIHARGPVGV+GLLT++WILRG+G  V         +THKSL
Sbjct:    1 MASVDPSRSFVRDVKRVIIKVGTAVVSRQD-GRLALGRVGALCEQVKELNSLGYEVILVTSGAVGVGRQRLRYR-------KLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFNQLDVSSSQLLVTDSDFENPKFREQLTETVESLLDLKVIPIFNENDAISTRKAPYEDSSGIFW--DNDSLAGLLALELKADLLILLSDVDGLYSGPPSEPSSKIIHTYIKEKHQQEITFGDKSRVGRGGMTAKVKAAVLASNSGTPVVITSGFENRSILKVLHGEKIGTLFHKNANLWESSKDVSTREMAVAARDCSRHLQNLSSEERKKILLDVADALEANEDLIRSENEADVAAAQVAGYEKPLVARLTIKPGKIASLAKSIRTLANMEDPI-NQILKKTEVADDLVLEKTSCPLGVLLIVFESRPDALVQIASLAIRSGNGLLLKGGKEAIRSNTILHKVITDAI-PRNVGEKLIGLVTTRDEIADLLKLDDVIDLVIPRGSNKLVSQIKASTK-IPVLGHADGICHVYIDKSADMDMAKHIVMDAKIDYPAACNAMETLLVHKDLMKSPGLDDILVALKTEGVNIYGGPIAHKALGFPKA---VSFHHEYSSMACTVEFVDDVQSAIDHIHRYGSAHTDCIVTTDDKVAETFLRRVDSAAVFHNASTRFSDGARFGLGAEVGISTGRIHARGPVGVEGLLTTRWILRGRGQVVN--GDKDVVYTHKSL 713          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. TrEMBL
Match: A0A267FVY1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000463g3 PE=3 SV=1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 449/725 (61.93%), Postives = 557/725 (76.83%), Query Frame = 2
Query:  164 SRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISE----IHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLA 2326
            SR DLK ++ +VVKLGSAVITR DECGLALGRLASIVEQIS++  QG+  +LVTSGAVAFGKQKL  Q  M+MSI +TL    D++         +DPRACAA GMSGLM+LYE LF QYG+QTAEILLTKPDF +  +RANLR TL ELL LNI+PI+NTNDAVAPPP  DSDLQGV+SI+DNDSLAAR+A E+N DLLIIMSDV GLY+ PP+ E S L+ T+        L+FG KSRVGTGGMESK KAA+WA+ +G SVVIC+GT EN +  ++ GKKVGTFFTL P E   VE QA  AR AS +L    ++ RA+ IRKLADLLIE Q DIL+AN++D   A   L  ++L+RLKLT  KLQ LA GL QIADSC  LL RVLR+T+LA  L LE++T+PIGVLLVIFESRPDCLPQVA+L+IASGNG+LLKGGSEA+ +N  L +LV++A+ + GL+   V LV  RE +  LL + +++DLVIPRGS+QMI  I+  S  IPVLGHS+GVCHV++DE A+ E ALR+V DSKCDYPAACNAMET+L+H+  + + FF++L+D L    V++ +GP+LAK ++F     A  ++ EY SL C +E+V  V +A+DHI  +GS HTD+I++EN+++ +TFL NVDSAC FHN STRF+DGYRFGLGAEVGISTSRIHARGPVGV+GLLT+KW+L G G  V DF+ G   F H++LL+
Sbjct:   53 SRQDLKYAEHVVVKLGSAVITRADECGLALGRLASIVEQISDLCLQGRHCVLVTSGAVAFGKQKLRQQQMMSMSIGETLSA--DVNSRRKAFQSQIDPRACAATGMSGLMALYEALFMQYGIQTAEILLTKPDFEDANSRANLRSTLAELLRLNIVPIVNTNDAVAPPPSQDSDLQGVLSIQDNDSLAARLAVEVNADLLIIMSDVKGLYTSPPDREDSRLLHTFNPDFDGARLQFGSKSRVGTGGMESKVKAAQWAVRKGTSVVICEGTEENVIPSVLEGKKVGTFFTLAPPEGVGVEQQAWEARCASHQLQAMPADVRASVIRKLADLLIEQQADILLANNQDLSSAA-GLSPHLLARLKLTPEKLQVLADGLRQIADSCPGLLGRVLRRTKLAEGLKLEQVTVPIGVLLVIFESRPDCLPQVAALSIASGNGLLLKGGSEAHQTNGALHRLVEEAVRAHGLSPRLVGLVGGREQVSDLLAMGEHVDLVIPRGSAQMIRDIQRQSVGIPVLGHSDGVCHVYIDELADKEKALRVVLDSKCDYPAACNAMETVLLHESHLKSGFFDELFDALRSRDVKVNTGPRLAKKIRF-GPSPAVSLRTEYSSLECCIEIVSGVAEAVDHINTYGSHHTDSIVSENETSFNTFLANVDSACAFHNCSTRFSDGYRFGLGAEVGISTSRIHARGPVGVEGLLTTKWLLHGSGDTVSDFADGTKKFVHENLLS 773          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. TrEMBL
Match: A0A1I8GG97 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 449/725 (61.93%), Postives = 557/725 (76.83%), Query Frame = 2
Query:  164 SRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISE----IHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLA 2326
            SR DLK ++ +VVKLGSAVITR DECGLALGRLASIVEQIS++  QG+  +LVTSGAVAFGKQKL  Q  M+MSI +TL    D++         +DPRACAA GMSGLM+LYE LF QYG+QTAEILLTKPDF +  +RANLR TL ELL LNI+PI+NTNDAVAPPP  DSDLQGV+SI+DNDSLAAR+A E+N DLLIIMSDV GLY+ PP+ E S L+ T+        L+FG KSRVGTGGMESK KAA+WA+ +G SVVIC+GT EN +  ++ GKKVGTFFTL P E   VE QA  AR AS +L    ++ RA+ IRKLADLLIE Q DIL+AN++D   A   L  ++L+RLKLT  KLQ LA GL QIADSC  LL RVLR+T+LA  L LE++T+PIGVLLVIFESRPDCLPQVA+L+IASGNG+LLKGGSEA+ +N  L +LV++A+ + GL+   V LV  RE +  LL + +++DLVIPRGS+QMI  I+  S  IPVLGHS+GVCHV++DE A+ E ALR+V DSKCDYPAACNAMET+L+H+  + + FF++L+D L    V++ +GP+LAK ++F     A  ++ EY SL C +E+V  V +A+DHI  +GS HTD+I++EN+++ +TFL NVDSAC FHN STRF+DGYRFGLGAEVGISTSRIHARGPVGV+GLLT+KW+L G G  V DF+ G   F H++LL+
Sbjct:  880 SRQDLKYAEHVVVKLGSAVITRADECGLALGRLASIVEQISDLCLQGRHCVLVTSGAVAFGKQKLRQQQMMSMSIGETLSA--DVNSRRKAFQSQIDPRACAATGMSGLMALYEALFMQYGIQTAEILLTKPDFEDANSRANLRSTLAELLRLNIVPIVNTNDAVAPPPSQDSDLQGVLSIQDNDSLAARLAVEVNADLLIIMSDVKGLYTSPPDREDSRLLHTFNPDFDGARLQFGSKSRVGTGGMESKVKAAQWAVRKGTSVVICEGTEENVIPSVLEGKKVGTFFTLAPPEGVGVEQQAWEARCASHQLQAMPADVRASVIRKLADLLIEQQADILLANNQDLSSAA-GLSPHLLARLKLTPEKLQVLADGLRQIADSCPGLLGRVLRRTKLAEGLKLEQVTVPIGVLLVIFESRPDCLPQVAALSIASGNGLLLKGGSEAHQTNGALHRLVEEAVRAHGLSPRLVGLVGGREQVSDLLAMGEHVDLVIPRGSAQMIRDIQRQSVGIPVLGHSDGVCHVYIDELADKEKALRVVLDSKCDYPAACNAMETVLLHESHLKSGFFDELFDALRSRDVKVNTGPRLAKKIRF-GPSPAVSLRTEYSSLECCIEIVSGVAEAVDHINTYGSHHTDSIVSENETSFNTFLANVDSACAFHNCSTRFSDGYRFGLGAEVGISTSRIHARGPVGVEGLLTTKWLLHGSGDTVSDFADGTKKFVHENLLS 1600          

HSP 2 Score: 887.486 bits (2292), Expect = 0.000e+0
Identity = 447/758 (58.97%), Postives = 557/758 (73.48%), Query Frame = 2
Query:  164 SRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISE----IHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDV---------------------------------DGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLA 2326
            +R DLK ++ +VVKLGSAVITR DECGLALGRLASIVEQIS++  QGK  +LVTSGAVAFGKQKL  Q  M+MSI +TL    D++         +DPRACAA GMSGLM+LYE LF QYG+QTAEILLTKPDF +  +RANLR TL ELL LNI+PI+NTNDAVAPPP  DSD+QGV+ I+DNDSLAAR+A E+N +LLIIMSDV                                  GLY+ PP+ E S L+ T+     S  L+FG KS VGTGGMESK KAA+WA+ +G SVVIC+GT  N +  +++GKKVGTFFTL P E   VE QA  AR AS +L    +N RA+ IRKLADLLIE Q DIL+AN  D   A   L  ++L+RLKLT  KLQ LA GL QIADSC  LL RVLR+T+LA  L LE++T+PIGVLLVIFESRPDCLPQVA+L+IASGNG+LLKGGSEA+ +N  L +LV++A+ + GL+   V LV  RE +  LL + +++DLVIPRGS+QMI  I+  S  IPVLGHS+GVCHV++DE A+ + A+RIV DSKCDYPAACNAMET+L+H+  + + FF++L+D L    V++ +GP+LAK ++F     AT ++ EY SL C +E+V  V +A+DHI  +GS HTD+I++EN+++ +TFL NVDSACVFHN STRF+DGYRFGLGAEVGISTSRIHARGPVGV+GLLT+KW+L G G  V DF++G   F H++LL+
Sbjct:   55 TRQDLKYAENVVVKLGSAVITRADECGLALGRLASIVEQISDMCLQGKHCVLVTSGAVAFGKQKLRQQQMMSMSIGETLSA--DVNSRRKAFQSQIDPRACAATGMSGLMALYEALFMQYGIQTAEILLTKPDFEDANSRANLRSTLAELLQLNIVPIVNTNDAVAPPPRHDSDMQGVLRIQDNDSLAARLAVEVNAELLIIMSDVKVSLGVQAEHGWSQIQILFFSLSFSPCRYPPIRQGLYTSPPDREDSRLLHTFNPDFDSAMLQFGSKSSVGTGGMESKVKAAQWAVRKGTSVVICEGTAANVIPSVLNGKKVGTFFTLAPPEGVGVEQQAWEARSASQQLQAMPANDRASVIRKLADLLIERQADILLANSLDLGNAT-GLSPHLLARLKLTPEKLQVLADGLRQIADSCPGLLGRVLRRTKLAEGLKLEQVTVPIGVLLVIFESRPDCLPQVAALSIASGNGLLLKGGSEAHQTNGALHRLVEEAVRAHGLSPRLVGLVGGREQVSDLLAMGEHVDLVIPRGSAQMIRDIQRQSVGIPVLGHSDGVCHVYIDELADRDRAIRIVLDSKCDYPAACNAMETVLLHESHLKSGFFDELFDALRSRDVKVNTGPRLAKKIRF-GPSPATSLRTEYSSLECCIEIVSGVAEAVDHINTYGSHHTDSIVSENETSVNTFLTNVDSACVFHNCSTRFSDGYRFGLGAEVGISTSRIHARGPVGVEGLLTTKWLLHGSGDTVSDFAEGTKKFVHENLLS 808          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. TrEMBL
Match: A0A267FTM0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000463g2 PE=3 SV=1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 447/725 (61.66%), Postives = 557/725 (76.83%), Query Frame = 2
Query:  164 SRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISE----IHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLA 2326
            +R DLK ++ +VVKLGSAVITR DECGLALGRLASIVEQIS++  QGK  +LVTSGAVAFGKQKL  Q  M+MSI +TL    D++         +DPRACAA GMSGLM+LYE LF QYG+QTAEILLTKPDF +  +RANLR TL ELL LNI+PI+NTNDAVAPPP  DSD+QGV+ I+DNDSLAAR+A E+N +LLIIMSDV GLY+ PP+ E S L+ T+     S  L+FG KS VGTGGMESK KAA+WA+ +G SVVIC+GT  N +  +++GKKVGTFFTL P E   VE QA  AR AS +L    +N RA+ IRKLADLLIE Q DIL+AN  D   A   L  ++L+RLKLT  KLQ LA GL QIADSC  LL RVLR+T+LA  L LE++T+PIGVLLVIFESRPDCLPQVA+L+IASGNG+LLKGGSEA+ +N  L +LV++A+ + GL+   V LV  RE +  LL + +++DLVIPRGS+QMI  I+  S  IPVLGHS+GVCHV++DE A+ + A+RIV DSKCDYPAACNAMET+L+H+  + + FF++L+D L    V++ +GP+LAK ++F     AT ++ EY SL C +E+V  V +A+DHI  +GS HTD+I++EN+++ +TFL NVDSACVFHN STRF+DGYRFGLGAEVGISTSRIHARGPVGV+GLLT+KW+L G G  V DF++G   F H++LL+
Sbjct:   46 TRQDLKYAENVVVKLGSAVITRADECGLALGRLASIVEQISDMCLQGKHCVLVTSGAVAFGKQKLRQQQMMSMSIGETLSA--DVNSRRKAFQSQIDPRACAATGMSGLMALYEALFMQYGIQTAEILLTKPDFEDANSRANLRSTLAELLQLNIVPIVNTNDAVAPPPRHDSDMQGVLRIQDNDSLAARLAVEVNAELLIIMSDVKGLYTSPPDREDSRLLHTFNPDFDSAMLQFGSKSSVGTGGMESKVKAAQWAVRKGTSVVICEGTAANVIPSVLNGKKVGTFFTLAPPEGVGVEQQAWEARSASQQLQAMPANDRASVIRKLADLLIERQADILLANSLDLGNAT-GLSPHLLARLKLTPEKLQVLADGLRQIADSCPGLLGRVLRRTKLAEGLKLEQVTVPIGVLLVIFESRPDCLPQVAALSIASGNGLLLKGGSEAHQTNGALHRLVEEAVRAHGLSPRLVGLVGGREQVSDLLAMGEHVDLVIPRGSAQMIRDIQRQSVGIPVLGHSDGVCHVYIDELADRDRAIRIVLDSKCDYPAACNAMETVLLHESHLKSGFFDELFDALRSRDVKVNTGPRLAKKIRF-GPSPATSLRTEYSSLECCIEIVSGVAEAVDHINTYGSHHTDSIVSENETSVNTFLTNVDSACVFHNCSTRFSDGYRFGLGAEVGISTSRIHARGPVGVEGLLTTKWLLHGSGDTVSDFAEGTKKFVHENLLS 766          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. TrEMBL
Match: A0A1I8G6V3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 449/724 (62.02%), Postives = 554/724 (76.52%), Query Frame = 2
Query:  164 SRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISE----IHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLL 2323
            SR DLK ++ +VVKLGSAVITR DECGLALGRLASIVEQIS++  QG+  +LVTSGAVAFGKQKL  Q  M+MSI +TL    D++         +DPRACAA GMSGLM+LYE LF QYG+QTAEILLTKPDF +  +RANLR TL ELL LNI+PI+NTNDAVAPPP  DSDLQGV+SI+DNDSLAAR+A E+N DLLIIMSDV GLY+ PP+ E S L+ T+        L+FG KSRVGTGGMESK KAA+WA+ +G SVVIC+GT EN +  ++ GKKVGTFFTL P E   VE QA  AR AS +L    ++ RA+ IRKLADLLIE Q DIL+AN++D   A   L  ++L+RLKLT  KLQ LA GL QIADSC  LL RVLR+T+LA  L LE++T+PIGVLLVIFESRPDCLPQVA+L+IASGNG+LLKGGSEA  +N  L +LV++A+ + GL+   V LV  RE +  LL + +++DLVIPRGS+QMI  I+  S  IPVLGHS+GVCHV++DE A+ E ALR+V DSKCDYPAACNAMET+L+H+  + + FF++L+D L    V++ +GP+LAK ++F     A  ++ EY SL C +E+V  V +A+DHI  +GS HTD+I++EN+ + +TFL NVDSAC FHN STRF+DGYRFGLGAEVGISTSRIHARGPVGV+GLLT+KW+L G G  V DF+ G   F H++LL
Sbjct:  895 SRQDLKYAEHVVVKLGSAVITRADECGLALGRLASIVEQISDLCLQGRHCVLVTSGAVAFGKQKLRQQQMMSMSIGETLSA--DVNSRRKAFQSQIDPRACAATGMSGLMALYEALFMQYGIQTAEILLTKPDFEDANSRANLRSTLAELLRLNIVPIVNTNDAVAPPPSQDSDLQGVLSIQDNDSLAARLAVEVNADLLIIMSDVKGLYTSPPDREDSRLLYTFNPDFDGARLQFGSKSRVGTGGMESKVKAAQWAVRKGTSVVICEGTEENVIPSVLEGKKVGTFFTLAPPEGVGVEQQAWEARCASHQLQAMPADVRASIIRKLADLLIEQQADILLANNQDLSSAA-DLSPHLLARLKLTPEKLQVLADGLRQIADSCPGLLGRVLRRTKLAEGLKLEQVTVPIGVLLVIFESRPDCLPQVAALSIASGNGLLLKGGSEAQQTNGALHRLVEEAVRAHGLSPRLVGLVGGREQVSDLLAMGEHVDLVIPRGSAQMIRDIQRQSVGIPVLGHSDGVCHVYIDELADKEKALRVVLDSKCDYPAACNAMETVLLHESHLKSGFFDELFDALRSRDVKVNTGPRLAKKIRF-GPSPAVSLRTEYSSLECCIEIVSGVAEAVDHINTYGSHHTDSIVSENEPSVNTFLANVDSACAFHNCSTRFSDGYRFGLGAEVGISTSRIHARGPVGVEGLLTTKWLLHGSGDTVSDFADGTKKFVHENLL 1614          

HSP 2 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 447/757 (59.05%), Postives = 555/757 (73.32%), Query Frame = 2
Query:  164 SRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISE----IHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDV---------------------------------DGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLL 2323
            +R DLK ++ +VVKLGSAVITR DECGLALGRLASIVEQIS++  QGK  +LVTSGAVAFGKQKL  Q  M+MSI +TL    D++         +DPRACAA GMSGLM+LYE LF QYG+QTAEILLTKPDF +  +RANLR TL ELL LNI+PI+NTNDAVAPPP  DSD+QGV+ I+DNDSLAAR+A E+N +LLIIMSDV                                  GLY+ PP+ E S L+ T+     S  L+FG KS VGTGGMESK KAA+WA+ +G SVVIC+GT  N +  +++GKKVGTFFTL P E   VE QA  AR AS +L    +N RA+ IRKLADLLIE Q DIL+AN  D   A   L  ++L+RLKLT  KLQ LA GL QIADSC  LL RVLR+T+LA  L LE++T+PIGVLLVIFESRPDCLPQVA+L+IASGNG+LLKGGSEA+ +N  L +LV++A+ + GL+   V LV  RE +  LL + +++DLVIPRGS+QMI  I+  S  IPVLGHS+GVCHV++DE A+ + A+RIV DSKCDYPAACNAMET+L+H+  + + FF++L+D L    V++ +GP+LAK ++F     AT ++ EY SL C +E+V  V +A+DHI  +GS HTD+I++EN+++ +TFL NVDSACVFHN STRF+DGYRFGLGAEVGISTSRIHARGPVGV+GLLT+KW+L G G  V DF+ G   F H++LL
Sbjct:   55 TRQDLKYAENVVVKLGSAVITRADECGLALGRLASIVEQISDMCLQGKHCVLVTSGAVAFGKQKLRQQQMMSMSIGETLSA--DVNSRRKAFQSQIDPRACAATGMSGLMALYEALFMQYGIQTAEILLTKPDFEDANSRANLRSTLAELLQLNIVPIVNTNDAVAPPPRHDSDMQGVLRIQDNDSLAARLAVEVNAELLIIMSDVKVSLGVQAEHGWSQIQILFFSLSFSPCRYPPIRQGLYTSPPDREDSRLLHTFNPDFDSAMLQFGSKSSVGTGGMESKVKAAQWAVRKGTSVVICEGTAANVIPSVLNGKKVGTFFTLAPPEGVGVEQQAWEARSASQQLQAMPANDRASVIRKLADLLIERQADILLANSLDLGNAT-GLSPHLLARLKLTPEKLQVLADGLRQIADSCPGLLGRVLRRTKLAEGLKLEQVTVPIGVLLVIFESRPDCLPQVAALSIASGNGLLLKGGSEAHQTNGALHRLVEEAVRAHGLSPRLVGLVGGREQVSDLLAMGEHVDLVIPRGSAQMIRDIQRQSVGIPVLGHSDGVCHVYIDELADRDRAIRIVLDSKCDYPAACNAMETVLLHESHLKSGFFDELFDALRSRDVKVNTGPRLAKKIRF-GPSPATSLRTEYSSLECCIEIVSGVAEAVDHINTYGSHHTDSIVSENETSVNTFLTNVDSACVFHNCSTRFSDGYRFGLGAEVGISTSRIHARGPVGVEGLLTTKWLLHGSGDTVSDFADGTKKFVHENLL 807          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. TrEMBL
Match: A0A267FXW8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027999g2 PE=3 SV=1)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 447/725 (61.66%), Postives = 556/725 (76.69%), Query Frame = 2
Query:  164 SRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISE----IHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLA 2326
            +R DLK ++ +VVKLGSAVITR DECGLALGRLASIVEQIS++  QGK  +LVTSGAVAFGKQKL  Q  M+MSI +TL    D++         +DPRACAA GMSGLM+LYE LF QYG+QTAEILLTKPDF +  +RANLR TL ELL LNI+PI+NTNDAVAPPP  DSD+QGV+ I+DNDSLAAR+A E+N +LLIIMSDV GLY+ PP+ E S L+ T+     S  L+FG KS VGTGGMESK KAA+WA+ +G SVVIC+GT  N +  +++GKKVGTFFTL P E   VE QA  AR AS +L    +N RA+ IRKLADLLIE Q DIL+AN  D   A   L  ++L+RLKLT  KLQ LA GL QIADSC  LL RVLR+T+LA  L LE++T+PIGVLLVIFESRPDCLPQVA+L+IASGNG+LLKGGSEA+ +N  L +LV++A+ + GL+   V LV  RE +  LL + +++DLVIPRGS+QMI  I+  S  IPVLGHS+GVCHV++DE A+ + A+RIV DSKCDYPAACNAMET+L+H+  + + FF++L+D L    V++ +GP+LAK ++F     AT ++ EY SL C +E+V  V +A+DHI  +GS HTD+I++EN+++ +TFL NVDSACVFHN STRF+DGYRFGLGAEVGISTSRIHARGPVGV+GLLT+KW+L G G  V DF+ G   F H++LL+
Sbjct:   47 TRQDLKYAENVVVKLGSAVITRADECGLALGRLASIVEQISDMCLQGKHCVLVTSGAVAFGKQKLRQQQMMSMSIGETLSA--DVNSRRKAFQSQIDPRACAATGMSGLMALYEALFMQYGIQTAEILLTKPDFEDANSRANLRSTLAELLQLNIVPIVNTNDAVAPPPRHDSDMQGVLRIQDNDSLAARLAVEVNAELLIIMSDVKGLYTSPPDREDSRLLHTFNPDFDSAMLQFGSKSSVGTGGMESKVKAAQWAVRKGTSVVICEGTAANVIPSVLNGKKVGTFFTLAPPEGVGVEQQAWEARSASQQLQAMPANDRASVIRKLADLLIERQADILLANSLDLGNAT-GLSPHLLARLKLTPEKLQVLADGLRQIADSCPGLLGRVLRRTKLAEGLKLEQVTVPIGVLLVIFESRPDCLPQVAALSIASGNGLLLKGGSEAHQTNGALHRLVEEAVRAHGLSPRLVGLVGGREQVSDLLAMGEHVDLVIPRGSAQMIRDIQRQSVGIPVLGHSDGVCHVYIDELADRDRAIRIVLDSKCDYPAACNAMETVLLHESHLKSGFFDELFDALRSRDVKVNTGPRLAKKIRF-GPSPATSLRTEYSSLECCIEIVSGVAEAVDHINTYGSHHTDSIVSENETSVNTFLTNVDSACVFHNCSTRFSDGYRFGLGAEVGISTSRIHARGPVGVEGLLTTKWLLHGSGDTVSDFADGTKKFVHENLLS 767          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Cavefish
Match: aldh18a1 (aldehyde dehydrogenase 18 family member A1 [Source:NCBI gene;Acc:103029980])

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 423/751 (56.32%), Postives = 547/751 (72.84%), Query Frame = 2
Query:  107 ASVHNKNFNTSNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKT----LHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS--LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFS-QGKFSFTHKSL 2320
            A  H K+F          + RS+L+ +KRIVVKLGSAV+TR DECGLALGRLASIVEQ++ +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +    L D+S   P ++ RACAAAG SGLM+LYE +F QY   TA+IL+T  DF++DQ R NL  TL+ELL +NI+PIINTNDAV PPP+ +SDLQGV  ISIKDNDSLAAR+A EM  DLLI +SDV+GLY  PP  + + L+DT+       ++ +G KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR A   L      QR+  I  +ADLL E + +IL AN +D  LA  S  +   ML RL L+SSKL +LAIGL QIA S  + + RVLR+T +A +L LE+IT+PIGVLLVIFESRPDCLPQV++LAIASGN +LLKGG EA N+N+ L ++ ++AL   G+  DA+ LVS RE+++ L +L K IDL+IPRGSSQ++  I+  +K IPVLGHSEG+CHV+VD  A+++  ++IV+DSKCDYPAACNAMETLL+H+ ++ T  F+++ DML   QV+I +GP+ A  L F  +++ + ++ EYG L C +EVVD++ +A+DHI  +GS HTD IITEN+ TA  FLQ VDSACVF NAS+RFADGYRFGLGAEVGIST+RIHARGPVG++GLLT+KW+LRG G    DFS QG   F H++L
Sbjct:   32 ARAHGKSF----------AHRSELRQAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVAMLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMS--LPVLEARACAAAGQSGLMALYEAMFTQYSTCTAQILVTNLDFHDDQKRRNLNSTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMRVDLLIALSDVEGLYDSPPGTDDAKLLDTFYPGD-QQSITYGTKSRVGIGGMEAKVKAALWALQGGTSVVIANGTHPKVTGHVITDIVEGKKVGTFFSEVKPAGPTVEQQTEMARTAGRTLASLLPEQRSEIIYAMADLLTEKREEILSANKKDMELALNSGRMPAVMLKRLSLSSSKLNSLAIGLRQIAVSSQDSVGRVLRRTRVANNLELEQITVPIGVLLVIFESRPDCLPQVSALAIASGNALLLKGGKEAANTNRILHEVAQEALSMHGVK-DAIQLVSTREEVEDLCRLEKMIDLIIPRGSSQLVRDIQRAAKGIPVLGHSEGICHVYVDHEASIDKVIKIVRDSKCDYPAACNAMETLLVHRDVLRTPLFDQIIDMLRTEQVKIHAGPRFASYLTFSPSEVKS-LRTEYGDLECCIEVVDSMQEAVDHIHKYGSSHTDVIITENEETAEQFLQLVDSACVFWNASSRFADGYRFGLGAEVGISTARIHARGPVGLEGLLTTKWVLRGDGQTAADFSEQGSMKFLHENL 767          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Cavefish
Match: aldh18a1 (aldehyde dehydrogenase 18 family member A1 [Source:NCBI gene;Acc:103029980])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 386/686 (56.27%), Postives = 503/686 (73.32%), Query Frame = 2
Query:  149 GRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKT----LHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS--LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLG 2170
            G+  + RS+L+ +KRIVVKLGSAV+TR DECGLALGRLASIVEQ++ +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +    L D+S   P ++ RACAAAG SGLM+LYE +F QY   TA+IL+T  DF++DQ R NL  TL+ELL +NI+PIINTNDAV PPP+ +SDLQGV  ISIKDNDSLAAR+A EM  DLLI +SDV+GLY  PP  + + L+DT+       ++ +G KSRVG GGME+K KAA WAL  G SVVI  GTH     + + +IV GKKVGTFF+        VE Q E+AR A   L      QR+  I  +ADLL E + +IL AN +D  LA  S  +   ML RL L+SSKL +LAIGL QIA S  + + RVLR+T +A +L LE+IT+PIGVLLVIFESRPDCLPQV++LAIASGN +LLKGG EA N+N+ L ++ ++AL   G+  DA+ LVS RE+++ L +L K IDL+IPRGSSQ++  I+  +K IPVLGHSEG+CHV+VD  A+++  ++IV+DSKCDYPAACNAMETLL+H+ ++ T  F+++ DML   QV+I +GP+ A  L F  +++ + ++ EYG L C +EVVD++ +A+DHI  +GS HTD IITEN+ TA  FLQ VDSACVF NAS+RFADGYRFGLG
Sbjct:   36 GKSFAHRSELRQAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVAMLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMS--LPVLEARACAAAGQSGLMALYEAMFTQYSTCTAQILVTNLDFHDDQKRRNLNSTLHELLRMNIVPIINTNDAVVPPPEPNSDLQGVNVISIKDNDSLAARLAVEMRVDLLIALSDVEGLYDSPPGTDDAKLLDTFYPGD-QQSITYGTKSRVGIGGMEAKVKAALWALQGGTSVVIANGTHPKVTGHVITDIVEGKKVGTFFSEVKPAGPTVEQQTEMARTAGRTLASLLPEQRSEIIYAMADLLTEKREEILSANKKDMELALNSGRMPAVMLKRLSLSSSKLNSLAIGLRQIAVSSQDSVGRVLRRTRVANNLELEQITVPIGVLLVIFESRPDCLPQVSALAIASGNALLLKGGKEAANTNRILHEVAQEALSMHGVK-DAIQLVSTREEVEDLCRLEKMIDLIIPRGSSQLVRDIQRAAKGIPVLGHSEGICHVYVDHEASIDKVIKIVRDSKCDYPAACNAMETLLVHRDVLRTPLFDQIIDMLRTEQVKIHAGPRFASYLTFSPSEVKS-LRTEYGDLECCIEVVDSMQEAVDHIHKYGSSHTDVIITENEETAEQFLQLVDSACVFWNASSRFADGYRFGLG 716          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Yeast
Match: PRO2 (Gamma-glutamyl phosphate reductase; catalyzes the second step in proline biosynthesis [Source:SGD;Acc:S000005850])

HSP 1 Score: 305.064 bits (780), Expect = 6.931e-96
Identity = 177/447 (39.60%), Postives = 270/447 (60.40%), Query Frame = 2
Query: 1055 AELARKASLELFQSTSNQ-RANSIRKLADLLIEHQNDILIANDEDFRLAKYS-LDENMLSRLKL-TSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQAL----ESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKL----------------AKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDF--SQGKFSFTHKSL 2320
            A+ ARKA   + ++ SN+ R++ + K+ D L  + + I  AN  D  +AK + L +++L RL L    K + +  G+  +A+  ++ + +V    EL   L L ++T P+GVLLVIFESRP+ +  + +L+I SGN  +LKGG E+ N+ + + K+V   +       G+   +V L+  R+D+  LL  ++YIDLV+PRGS+ ++ KIK  +K IPVLGH++G+C +++DE A+L  A RI  D+K +YPA CNAMETLLI+ K   ++++E L ++  +  V I +   L                A   K  +A       KE+ SL    + V +   AI HI    S+HTD I+TEN + A  F++ VDS+ V+ NASTRFADG+R+G GAEVGISTS+IHARGPVG+DGL++ ++ +RG G    D+  + G  +F HK L
Sbjct:    8 AKNARKAG-NILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLADSLLKRLDLFKGDKFEVMLQGIKDVAE-LEDPVGKVKMARELDDGLTLYQVTAPVGVLLVIFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSVQLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTK-IPVLGHADGICSIYLDEDADLIKAKRISLDAKTNYPAGCNAMETLLINPKF--SKWWEVLENLTLEGGVTIHATKDLKTAYFDKLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIVTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSYQYQIRGDGQVASDYLGAGGNKAFVHKDL 449          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Yeast
Match: YHR033W_mRNA (Putative protein of unknown function; epitope-tagged protein localizes to the cytoplasm; YHR033W has a paralog, PRO1, that arose from the whole genome duplication [Source:SGD;Acc:S000001075])

HSP 1 Score: 123.25 bits (308), Expect = 1.794e-30
Identity = 88/269 (32.71%), Postives = 132/269 (49.07%), Query Frame = 2
Query:  194 IVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYS-RP---PNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIV 988
            IV+KLGS+ +         L  +  IVE ++ + + G ++I+V+SG +A G   L        +I    K L ++         +A AA G   L++ +  LF QYG QTA+ILLT+ D        N R T+NELL + +IPI+N ND ++            I   DND+L+A  AA +  D L +++DVD LY+  P   P+    VL+      +       G  S VGTGGM +K  AA+ A   GI  ++ K      + +IV
Sbjct:    7 IVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDAL--------NIPHKPKQLSEV---------QAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNTINELLAMGVIPIVNENDTLS---------ISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDARPIVLVPELSEGLPGVNTSSGSGSEVGTGGMRTKLIAADLASNAGIETIVMKSDRPEYVPKIV 249          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Yeast
Match: PRO1 (Gamma-glutamyl kinase; catalyzes the first step in proline biosynthesis; required for nitrogen starvation-induced ribophagy but not for nonselective autophagy; PRO1 has a paralog, YHR033W, that arose from the whole genome duplication [Source:SGD;Acc:S000002708])

HSP 1 Score: 112.849 bits (281), Expect = 5.877e-27
Identity = 85/268 (31.72%), Postives = 137/268 (51.12%), Query Frame = 2
Query:  185 SKRIVVKLGSA--VITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALE---------FGGKSRVGTGGMESKFKAAEWALTQGISVVICK 955
            S  IV+KLGS+  V  +  E  LA+  ++ IVE + ++ + G ++I+V+SG +A G +        TM + +  K L ++         +A AA G   L+  ++ LF Q+  + A+ILLT+ D  +     N + T+NELL++ +IPI+N ND ++            I   DND+L+A  +A ++ D L +++DVD LY+  P      +       +V P L           G  S VGTGGME+K  AA+ A   G+  +I K
Sbjct:    9 SYTIVIKLGSSSLVDEKTKEPKLAI--MSLIVETVVKLRRMGHKVIIVSSGGIAVGLR--------TMRMNKRPKHLAEV---------QAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNTINELLNMGVIPIVNENDTLSVRE---------IKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRTNPDAM-----PILVVPDLSKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTLIMK 243          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Nematostella
Match: EDO38923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBH3])

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 414/748 (55.35%), Postives = 533/748 (71.26%), Query Frame = 2
Query:  134 TSNILGRVASSRSDLKDS-----------KRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKT---LHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHEN--ALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS--LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQ-GKFSFTHKSL 2320
            +S +  R  SS  D KDS           KR++VKLGSAVITR DECG+ALGRL+SIVEQ++E+   G+E++LVTSGAVAFGKQKL H+  ++ S++QTLK    L+ + ++  +  PRACAA G  GLMSLYE +F QYGL   +ILLT+PD  +   R NLR T+  L+ +  IPIIN NDAVAPPP LD DL GVIS+KDNDSLAA +A E+  DLLI++SDV+G+Y  PP+   S ++ T+        + FG KSRVG GGMESK ++A WAL +G SVVI  GT E+   + +I++G+ VGTFFT   Q    +E QA  AR     L   ++ QR   I KLADLLIE + DIL AN  D   A+    L   M++RL LT SKL+ LA GL QIAD     + RVLRKT +A DL+L++ T+PIGVL+VIFESRPD L QVASLAI++ NG+LLKGG EAY+SNKCL  LV++ALE    + +AV+L+S R+ +  LL+L   IDLVIPRGS +MI +I+  SK IPVLGHS+G+CHV++D++A+ E A+ IV DSKCDYPAACN+METLL+H+ L+GT   +K+   L +  V+I++GP+L K L       A+ M  EYG L C +E+V+NV DAI HI  FGS HT++IIT +D TA+ FL++VDSACVFHNASTRFADGYRFGLGAEVGIST RIHARGPVGV+GLLT+KW LRG+GH V DF+  G +++ H++L
Sbjct:    3 SSRVAARSLSSGYDSKDSVYHRAELKKKAKRVIVKLGSAVITRGDECGVALGRLSSIVEQLAELQNSGREMLLVTSGAVAFGKQKLRHENLLSQSVRQTLKPQDGLNKVGKLKSY--PRACAAVGQGGLMSLYEAMFAQYGLTCGQILLTRPDLRDAYARENLRSTVEALISMKCIPIINENDAVAPPPGLDQDLAGVISLKDNDSLAALLAVEIRADLLILLSDVNGIYDGPPDNPQSQIMHTFHPDNFKD-VTFGSKSRVGRGGMESKVRSAVWALERGTSVVIANGTGEDYHVVRDIINGRNVGTFFTTAEQIGPSIEDQATKARDGGRALQALSAEQRKQIIYKLADLLIERKTDILDANTMDLEAARQEGKLPAPMMARLLLTPSKLEQLAQGLRQIADGSHKNIGRVLRKTRVAKDLVLQQETVPIGVLMVIFESRPDALVQVASLAISTANGLLLKGGKEAYHSNKCLHSLVQEALELHA-SPEAVSLISTRDQVGDLLKLEGLIDLVIPRGSPEMIRQIQQDSKGIPVLGHSDGICHVYMDKYADFEMAVDIVVDSKCDYPAACNSMETLLVHRDLLGTSALDKVLKALRERGVKIYAGPRLVKELPL-GPLPASSMSIEYGGLECAVEIVENVEDAIAHIHKFGSSHTESIITNDDETANKFLKSVDSACVFHNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWTLRGEGHTVADFADGGTYTYLHEAL 745          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Medaka
Match: ALDH18A1 (delta-1-pyrroline-5-carboxylate synthase [Source:NCBI gene;Acc:101173087])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 419/743 (56.39%), Postives = 547/743 (73.62%), Query Frame = 2
Query:  125 NFNTSNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHD-ISEIH-PHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS--LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFS-QGKFSFTHKSL 2320
             F+     G+  + RS+LK +KRIVVKLGSAV+TR DECGLALGRLASIVEQ++ +  QG+E+++VTSGAVAFGKQ+L H+  ++ S++Q L +  + + E+  P ++ RACAAAG SGLM+LYE +F QY + TA+IL+T  DF+++Q R NL  TL+ELL +NI+PIINTNDAV PPP  +SDLQGV  ISIKDNDSLAAR+A EM  DLLI +SDV GLY  PP  + + LID +       ++ +G KSRVG GGME+K KAA WAL  G SVVI  GT      + + +IV GKKVGTFF+        VE Q E+AR A   L      QR   I  LA+LL E + +IL AN +D  LA  +  L + +++RL L++SKL +LAIGL Q+A +  + + RVLR+T +A +L LE+IT+PIGVLLVIFESRPDCLPQV++LAIASGN +LLKGG EA N+NK L +L ++AL   G+ SDA+ LVS RE+++ L +L+K IDL+IPRGSSQ++  I+  +K IPVLGHSEGVCHV++D  A+++ AL IV+DSKCDYPAACNAMETLLIH+ L+ T  F+++ DML Q  V+I +GP+ A  L F  +++ + ++ EYG L C +EVVD + DA+DHI  +GS HTD I+TEN+ TA  FLQ VDSACVF NAS+RFADGYRFGLGAEVGIST+RIHARGPVG++GLLT+KW+LRG+G  V DFS QG   + H+++
Sbjct:   35 KFSLPRPHGKSFAHRSELKQAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVAVLQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMSVPVLEARACAAAGQSGLMALYEAMFTQYSICTAQILVTNLDFHDEQKRRNLNSTLHELLRMNIVPIINTNDAVVPPPVPNSDLQGVNVISIKDNDSLAARLAVEMKADLLIALSDVQGLYDSPPGTDDAKLIDIFYPGD-QQSVTYGTKSRVGIGGMEAKVKAALWALQGGTSVVIANGTDPKVTGHVITDIVEGKKVGTFFSEVKPAGPTVEQQTEMARHAGRTLASLLPEQREEIICCLAELLTERKEEILTANRKDMELASATGFLPQPLINRLSLSTSKLNSLAIGLRQLAVASRDSVGRVLRRTRVANNLELEQITVPIGVLLVIFESRPDCLPQVSALAIASGNALLLKGGKEASNTNKILHQLTQEALSIHGV-SDAIQLVSTREEVEDLCRLDKMIDLIIPRGSSQLVRDIQRAAKGIPVLGHSEGVCHVYIDADASIDKALDIVKDSKCDYPAACNAMETLLIHRDLLRTPMFDQIIDMLRQEHVKIHAGPRFASYLTFSPSEVKS-LRTEYGDLECCIEVVDGMQDAVDHIHKYGSSHTDVIVTENEETAEQFLQQVDSACVFWNASSRFADGYRFGLGAEVGISTARIHARGPVGLEGLLTTKWVLRGEGQTVSDFSEQGSMKYLHENI 774          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Medaka
Match: aldh18a1 (delta-1-pyrroline-5-carboxylate synthase [Source:NCBI gene;Acc:101169240])

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 408/729 (55.97%), Postives = 532/729 (72.98%), Query Frame = 2
Query:  176 LKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLH----DISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGV--ISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE----NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFS-QGKFSFTHKSLLAE 2329
            L+ +KRIVVKLGSAV+TR DECGLALGRLASIVEQ++ +   G+E+++VTSGAVAFGKQ+L H+  ++ S++Q L++ H    D+S   P ++ RACAAAG SGLM+LYE +F QY   TA++L+T  DF++D+ R NL  TL ELL +NI+PIINTNDAV PPP+ +SDL GV  ISIKDNDSLAAR+A EM  DLLI +SDV+GLY+ PP  + + LID +       ++ FG KSRVG GGME+K KAA WAL  G SVVI  GT+     + + +IV GKKVGTFF+ T      VE Q E+AR +   L    + +R+  I +LADLL E   +IL AN  D  +A   L   ML RL L+ +K+ +L+IGL QIA S  N   RVLR+T +A +L LE+IT+PIGV+LVIFE+RPDCLPQV++LAIASGN +LLKGG EA N+N  L +L ++AL   GL  +AV +VS RE+++ L +L+K IDL+IPRGS Q++  IK  +K IPVLGHSEGVCHV+VD  A+ +  + IV+DSKC+YPAACNAMETLLIH+ ++ T  F+++ DML   +V+I +GP+ A  L F  ++ A  ++ EY  L C +EVVD++ +A++HI  +GS HTD IITEN  TA  FLQ +DSACVF NAS+RFADGYRFGLGAEVGIST+RIHARGPVG++GLLT+KW+LRG GH V DFS QG  ++ H++L  E
Sbjct:    1 LRQAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVAMLQNHGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALQSGHNQPKDMS--LPALEARACAAAGQSGLMALYEAMFSQYSTCTAQVLVTNLDFHDDEKRQNLHSTLQELLRMNIVPIINTNDAVVPPPEPNSDLHGVNVISIKDNDSLAARLAVEMKADLLIALSDVEGLYNSPPGTDDAKLIDIFYPGD-QHSITFGTKSRVGLGGMEAKVKAALWALQGGTSVVIANGTNPKVTGHVITDIVEGKKVGTFFSETKPAGPSVEEQTEMARSSGRILASLQAEKRSEIICRLADLLTEKTEEILAANKLDLEVASSRLPSAMLKRLSLSVAKINSLSIGLRQIATSAQNSAGRVLRRTRVAHNLELEQITVPIGVVLVIFEARPDCLPQVSALAIASGNALLLKGGKEAANTNHVLLQLTQEALSMHGLR-EAVQMVSTREEVEGLCRLDKMIDLIIPRGSFQLVQDIKKAAKGIPVLGHSEGVCHVYVDADASADKVIGIVRDSKCEYPAACNAMETLLIHRDILRTPLFDQIIDMLRTERVRIHAGPRFASYLTFSPSE-AKSLRTEYNDLECCVEVVDSMQEAVEHIHKYGSSHTDVIITENAKTAEQFLQQLDSACVFWNASSRFADGYRFGLGAEVGISTARIHARGPVGIEGLLTTKWVLRGDGHTVADFSEQGTQTYLHENLPLE 724          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Planmine SMEST
Match: SMESG000045474.1 (SMESG000045474.1)

HSP 1 Score: 1551.18 bits (4015), Expect = 0.000e+0
Identity = 754/754 (100.00%), Postives = 754/754 (100.00%), Query Frame = 2
Query:   68 MLKISRFLNRISPASVHNKNFNTSNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLAE 2329
            MLKISRFLNRISPASVHNKNFNTSNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLAE
Sbjct:    1 MLKISRFLNRISPASVHNKNFNTSNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLAE 754          
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Planmine SMEST
Match: SMESG000045474.1 (SMESG000045474.1)

HSP 1 Score: 1546.56 bits (4003), Expect = 0.000e+0
Identity = 754/755 (99.87%), Postives = 754/755 (99.87%), Query Frame = 2
Query:   68 MLKISRFLNRISPASVHNKNFNTSNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS-LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLAE 2329
            MLKISRFLNRISPASVHNKNFNTSNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYS LDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLAE
Sbjct:    1 MLKISRFLNRISPASVHNKNFNTSNILGRVASSRSDLKDSKRIVVKLGSAVITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQAKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGLQTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLDSDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLIDTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHENALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRANSIRKLADLLIEHQNDILIANDEDFRLAKYSGLDENMLSRLKLTSSKLQTLAIGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCLPQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLVSKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHVFVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDMLGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAIDHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGLGAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKSLLAE 755          
The following BLAST results are available for this feature:
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ALDH18A10.000e+056.91aldehyde dehydrogenase 18 family member A1 [Source... [more]
ALDH18A10.000e+056.75aldehyde dehydrogenase 18 family member A1 [Source... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
alh-130.000e+055.11Probable delta-1-pyrroline-5-carboxylate synthase ... [more]
alh-130.000e+054.96Probable delta-1-pyrroline-5-carboxylate synthase ... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG74700.000e+055.97gene:FBgn0037146 transcript:FBtr0309869[more]
CG74700.000e+055.97gene:FBgn0037146 transcript:FBtr0078477[more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aldh18a10.000e+056.99aldehyde dehydrogenase 18 family, member A1 [Sourc... [more]
aldh18a10.000e+056.99aldehyde dehydrogenase 18 family, member A1 [Sourc... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh18a10.000e+056.30aldehyde dehydrogenase 18 family member A1 [Source... [more]
aldh18a10.000e+054.76aldehyde dehydrogenase 18 family member A1 [Source... [more]
aldh18a10.000e+054.51aldehyde dehydrogenase 18 family member A1 [Source... [more]
aldh18a10.000e+054.62aldehyde dehydrogenase 18 family member A1 [Source... [more]
aldh18a10.000e+054.62aldehyde dehydrogenase 18 family member A1 [Source... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldh18a10.000e+055.07aldehyde dehydrogenase 18 family, member A1 [Sourc... [more]
Aldh18a10.000e+054.93aldehyde dehydrogenase 18 family, member A1 [Sourc... [more]
Aldh18a11.117e-3752.08aldehyde dehydrogenase 18 family, member A1 [Sourc... [more]
Aldh18a13.124e-2867.12aldehyde dehydrogenase 18 family, member A1 [Sourc... [more]
Aldh18a16.422e-1950.60aldehyde dehydrogenase 18 family, member A1 [Sourc... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R4M8|P5CS_PONAB0.000e+056.89Delta-1-pyrroline-5-carboxylate synthase OS=Pongo ... [more]
sp|Q9Z110|P5CS_MOUSE0.000e+054.93Delta-1-pyrroline-5-carboxylate synthase OS=Mus mu... [more]
sp|P54886|P5CS_HUMAN0.000e+056.75Delta-1-pyrroline-5-carboxylate synthase OS=Homo s... [more]
sp|P54889|ALH13_CAEEL0.000e+054.96Probable delta-1-pyrroline-5-carboxylate synthase ... [more]
sp|O04226|P5CS1_ORYSJ0.000e+045.28Delta-1-pyrroline-5-carboxylate synthase 1 OS=Oryz... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FVY10.000e+061.93Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GG970.000e+061.93Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FTM00.000e+061.66Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8G6V30.000e+062.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FXW80.000e+061.66Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aldh18a10.000e+056.32aldehyde dehydrogenase 18 family member A1 [Source... [more]
aldh18a10.000e+056.27aldehyde dehydrogenase 18 family member A1 [Source... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRO26.931e-9639.60Gamma-glutamyl phosphate reductase; catalyzes the ... [more]
YHR033W_mRNA1.794e-3032.71Putative protein of unknown function; epitope-tagg... [more]
PRO15.877e-2731.72Gamma-glutamyl kinase; catalyzes the first step in... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO389230.000e+055.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ALDH18A10.000e+056.39delta-1-pyrroline-5-carboxylate synthase [Source:N... [more]
aldh18a10.000e+055.97delta-1-pyrroline-5-carboxylate synthase [Source:N... [more]
back to top
BLAST of Delta-1-pyrroline-5-carboxylate synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000045474.10.000e+0100.00SMESG000045474.1[more]
SMESG000045474.10.000e+099.87SMESG000045474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005571 ID=SMED30005571|Name=Delta-1-pyrroline-5-carboxylate synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=2389bp
ATTTAAATTAGCATAATTTCAAATAGAGATTTTCAATTGGCTTGAATTTA
TTATTTTCCAATTTATAATGTTGAAGATATCTAGATTTTTAAATAGAATA
TCACCTGCATCTGTGCACAATAAAAACTTCAATACTTCGAATATTTTGGG
ACGTGTTGCCAGTTCTCGATCGGATTTGAAAGACAGCAAACGAATTGTGG
TGAAACTCGGAAGTGCAGTGATAACTCGGGTGGATGAATGTGGACTTGCA
TTAGGGAGATTGGCATCAATTGTCGAACAAATATCAGAGATATCTCAACA
AGGTAAAGAATTGATACTAGTGACGAGTGGGGCAGTTGCCTTTGGTAAAC
AGAAATTATTGCACCAAGCCAAGATGACCATGTCCATTAAGCAGACATTG
AAGACATTGCATGACATTTCTGAAATTCATCCACATGTTGATCCAAGAGC
TTGCGCCGCGGCCGGGATGAGTGGTTTAATGTCATTGTATGAACAATTGT
TTCAACAGTATGGACTTCAAACCGCAGAGATACTTTTAACGAAACCAGAT
TTTTATAATGATCAGACAAGAGCAAATCTTCGTGGAACTTTGAACGAATT
ACTTCATTTAAACATTATTCCTATTATTAATACAAATGATGCTGTGGCTC
CTCCTCCTGATCTGGACAGTGATCTCCAAGGAGTGATCAGTATTAAAGAT
AATGATTCTTTGGCTGCACGAGTAGCTGCAGAAATGAATTGTGACTTACT
GATCATTATGTCAGATGTCGATGGATTATACTCGCGACCCCCAAATGAGG
AAGGGTCTGTGTTAATTGATACTTACTGTACTACTATGGTAAGCCCAGCG
TTAGAATTTGGAGGTAAATCTAGAGTAGGAACAGGAGGAATGGAAAGTAA
ATTTAAGGCCGCTGAATGGGCATTAACTCAAGGAATTTCAGTTGTGATTT
GCAAAGGAACTCATGAAAATGCTTTATTGGAAATCGTACATGGAAAGAAA
GTGGGCACATTTTTTACTTTAACTCCACAAGAAGATAATCAAGTTGAACT
ACAAGCTGAATTAGCACGGAAAGCTAGTTTAGAACTGTTTCAATCCACAT
CAAATCAAAGAGCAAATTCTATAAGAAAGCTAGCTGATCTTCTAATAGAA
CATCAAAATGATATTTTAATCGCAAACGATGAAGACTTTCGCTTGGCTAA
ATACAGTCTCGATGAAAATATGCTGTCAAGATTAAAATTAACTTCGTCAA
AACTTCAGACTCTGGCAATCGGGTTAAATCAAATCGCAGATTCCTGTGAT
AATTTACTGAATCGAGTTCTTCGGAAAACTGAATTGGCTCCAGATTTAAT
TTTAGAAGAAATTACAATTCCAATTGGGGTGTTGCTAGTGATATTTGAAT
CTCGACCTGACTGTTTGCCACAGGTTGCTTCTTTAGCTATCGCCAGTGGC
AATGGTGTTTTGTTGAAAGGTGGATCAGAAGCATACAATAGCAATAAATG
CTTATTTAAGTTAGTAAAACAGGCACTGGAATCCCAAGGTCTTAATTCCG
ATGCTGTGAATTTGGTGAGTAAACGAGAGGACATACAGAGCTTGTTACAA
TTAAATAAATACATTGACCTAGTTATTCCGAGAGGTTCCAGTCAAATGAT
TAATAAAATAAAATGCATGAGCAAGTCGATTCCTGTGCTTGGGCATTCTG
AAGGAGTATGCCACGTGTTTGTTGACGAGCATGCGAACCTAGAGACGGCA
TTGAGAATAGTTCAGGATTCAAAATGTGACTACCCAGCCGCCTGCAATGC
GATGGAGACCCTTCTTATTCATAAAAAATTAATTGGAACCGAATTTTTTG
AAAAATTATACGACATGCTAGGTCAAAACCAAGTTCAAATATTTTCTGGT
CCCAAGTTGGCAAAGTCCCTGAAATTTTATAACGCTCAGCTAGCGACTCA
GATGAAAAAGGAATACGGATCTCTGAGTTGTACAATGGAAGTTGTGGATA
ATGTAAACGATGCCATTGACCATATCCGTATTTTCGGAAGCCAGCACACC
GATACGATAATCACGGAAAACGATTCAACAGCTTCTACTTTCCTCCAAAA
TGTTGATAGCGCTTGCGTGTTTCACAACGCGAGTACGAGATTTGCTGACG
GATACCGATTTGGATTAGGAGCTGAGGTTGGAATAAGTACATCTAGAATT
CATGCTAGAGGTCCAGTTGGTGTCGATGGTCTCTTGACATCAAAATGGAT
TTTGCGGGGCAAAGGTCACTGTGTTCAAGATTTTTCTCAGGGTAAATTTA
GCTTCACTCACAAATCGTTGCTAGCGGAATAATGATTTTGTTAAATTTAA
TTATTTGATTTAAATAAATGGATTTGTTTTTGAAAAAAA
back to top

protein sequence of SMED30005571-orf-1

>SMED30005571-orf-1 ID=SMED30005571-orf-1|Name=SMED30005571-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=755bp
MLKISRFLNRISPASVHNKNFNTSNILGRVASSRSDLKDSKRIVVKLGSA
VITRVDECGLALGRLASIVEQISEISQQGKELILVTSGAVAFGKQKLLHQ
AKMTMSIKQTLKTLHDISEIHPHVDPRACAAAGMSGLMSLYEQLFQQYGL
QTAEILLTKPDFYNDQTRANLRGTLNELLHLNIIPIINTNDAVAPPPDLD
SDLQGVISIKDNDSLAARVAAEMNCDLLIIMSDVDGLYSRPPNEEGSVLI
DTYCTTMVSPALEFGGKSRVGTGGMESKFKAAEWALTQGISVVICKGTHE
NALLEIVHGKKVGTFFTLTPQEDNQVELQAELARKASLELFQSTSNQRAN
SIRKLADLLIEHQNDILIANDEDFRLAKYSLDENMLSRLKLTSSKLQTLA
IGLNQIADSCDNLLNRVLRKTELAPDLILEEITIPIGVLLVIFESRPDCL
PQVASLAIASGNGVLLKGGSEAYNSNKCLFKLVKQALESQGLNSDAVNLV
SKREDIQSLLQLNKYIDLVIPRGSSQMINKIKCMSKSIPVLGHSEGVCHV
FVDEHANLETALRIVQDSKCDYPAACNAMETLLIHKKLIGTEFFEKLYDM
LGQNQVQIFSGPKLAKSLKFYNAQLATQMKKEYGSLSCTMEVVDNVNDAI
DHIRIFGSQHTDTIITENDSTASTFLQNVDSACVFHNASTRFADGYRFGL
GAEVGISTSRIHARGPVGVDGLLTSKWILRGKGHCVQDFSQGKFSFTHKS
LLAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0003117parapharyngeal cell
PLANA:0007552nu neoblast
Vocabulary: INTERPRO
TermDefinition
IPR005715Glu_5kinase/COase_Synthase
IPR000965GPR_dom
IPR036393AceGlu_kinase-like_sf
IPR041744G5K_ProBA
IPR001057Glu/AcGlu_kinase
IPR016163Ald_DH_C
IPR001048Asp/Glu/Uridylate_kinase
IPR005766P5_carboxy_syn
IPR015590Aldehyde_DH_dom
IPR016162Ald_DH_N
IPR020593G-glutamylP_reductase_CS
IPR016161Ald_DH/histidinol_DH
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006561proline biosynthetic process
GO:0008152metabolic process
GO:0006536glutamate metabolic process
GO:0008652cellular amino acid biosynthetic process
GO:0016310phosphorylation
GO:0019240citrulline biosynthetic process
GO:0055129L-proline biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0003824catalytic activity
GO:0004350glutamate-5-semialdehyde dehydrogenase activity
GO:0000166nucleotide binding
GO:0004349glutamate 5-kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001057Glutamate/acetylglutamate kinasePRINTSPR00474GLU5KINASEcoord: 211..238
score: 57.01
coord: 130..158
score: 45.08
coord: 170..191
score: 49.83
coord: 79..93
score: 60.49
coord: 270..290
score: 52.2
IPR005715Glutamate 5-kinase/delta-1-pyrroline-5-carboxylate synthaseTIGRFAMTIGR01027TIGR01027coord: 41..320
e-value: 6.1E-60
score: 201.2
IPR005766Delta l-pyrroline-5-carboxylate synthetasePIRSFPIRSF036429P5C_synthetasecoord: 4..754
e-value: 0.0
score: 1074.3
IPR005766Delta l-pyrroline-5-carboxylate synthetaseTIGRFAMTIGR01092TIGR01092coord: 34..751
e-value: 1.5E-281
score: 933.7
IPR000965GPR domainTIGRFAMTIGR00407TIGR00407coord: 333..726
e-value: 7.0E-128
score: 424.8
IPR000965GPR domainCDDcd07079ALDH_F18-19_ProA-GPRcoord: 327..731
e-value: 0.0
score: 543.565
IPR016162Aldehyde dehydrogenase, N-terminalGENE3DG3DSA:3.40.605.10coord: 339..731
e-value: 4.3E-150
score: 501.8
IPR015590Aldehyde dehydrogenase domainPFAMPF00171Aldedhcoord: 321..601
e-value: 1.1E-11
score: 43.9
IPR036393Acetylglutamate kinase-like superfamilyGENE3DG3DSA:3.40.1160.10coord: 30..323
e-value: 9.3E-90
score: 302.7
IPR036393Acetylglutamate kinase-like superfamilySUPERFAMILYSSF53633Carbamate kinase-likecoord: 41..317
IPR016163Aldehyde dehydrogenase, C-terminalGENE3DG3DSA:3.40.309.10coord: 545..694
e-value: 4.3E-150
score: 501.8
IPR001048Aspartate/glutamate/uridylate kinasePFAMPF00696AA_kinasecoord: 41..296
e-value: 6.2E-38
score: 130.8
NoneNo IPR availablePANTHERPTHR11063GLUTAMATE SEMIALDEHYDE DEHYDROGENASEcoord: 19..750
NoneNo IPR availablePANTHERPTHR11063:SF19DELTA-1-PYRROLINE-5-CARBOXYLATE SYNTHASEcoord: 19..750
IPR020593Gamma-glutamyl phosphate reductase GPR, conserved sitePROSITEPS01223PROAcoord: 643..665
IPR041744Bifunctional delta 1-pyrroline-5-carboxylate synthetase, glutamate-5-kinase domainCDDcd04256AAK_P5CS_ProBAcoord: 33..317
e-value: 5.61687E-160
score: 462.672
IPR016161Aldehyde/histidinol dehydrogenaseSUPERFAMILYSSF53720ALDH-likecoord: 324..734