Tigger transposable element-derived protein 1

Overview
NameTigger transposable element-derived protein 1
Smed IDSMED30005555
Length (bp)1708
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tigger transposable element-derived protein 1 (SMED30005555) t-SNE clustered cells

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30005555) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tigger transposable element-derived protein 1 (SMED30005555) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30005555) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005555

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30005555 dd_Smed_v4_20966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30005555 dd_Smed_v4_20966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005555 dd_Smed_v4_20966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005555 dd_Smed_v4_20966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005555 dd_Smed_v4_20966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005555 dd_Smed_v4_20966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 186.808 bits (473), Expect = 2.984e-51
Identity = 135/413 (32.69%), Postives = 214/413 (51.82%), Query Frame = 2
Query:  347 TRLLK*RQRVLEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRE--CNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCV-----EVNEGTNLT-LRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQQ 1561
            TR+++ R  ++ D+EK+L+VWI ++      ++++ I  KA  L+  +  K        +E F+ SRGWF  FK+ S  H+I   G+AAS DV+ A ++     K++    Y  QQ+       F+ K         R E     +    +R +  L  A A+ +FK+K  ++Y+ ENP A K     KS L V +++NSKA +T+  F  W  E F  TV+ Y  E  +P K LL++DNAP HP      L+E +    V F+  NT  +LQPMDQ V S FK  Y +  F + +     +V++G+  + L+ FWK  F  ++ +K I  +W  V   TL   W+KL    I  D++EG     E    D +V + K + LEV  +++ EL++ HD+ LT  EL  +  +++
Sbjct:   69 TRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSM--KAERGVEAAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTL-LLGANAAGDFKLKPMLIYHSENPRALKNYT--KSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRA----LMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKG-FTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLI--DDYEGFKTSVEEVSAD-VVEIAKELELEVEPEDVTELLQSHDKTLTDEELFLMDAQRK 468          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 110.538 bits (275), Expect = 4.578e-25
Identity = 107/398 (26.88%), Postives = 174/398 (43.72%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECN--AWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPG--LEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHE-EERSVIDEIVFLRKNMGLE-VNEDNIQELVEEHDQE-----LTANELI 1540
            E++++ +L W N+++   + ++     K+A   +  L           D  F  S GW   FK+   I  I    +  + D    E F   F   +  E   P+Q+      G F K     I   + +C       + ER +  +  A A+   K+KL VV   + P +FK       +L V +     AW+    F +W +++F   V++Y     L  K +L++DN+P HP    L  D  + F     K+L  N   L+QP DQ V +  K+ Y   L Q  +E  EG +  L+ FWK     ++ L  I  AWN V   T++ AW+K+     + +  E L  + E+ SV      L+   GLE V  +N+++ +E    E     LT +E+I
Sbjct:   77 EELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL---------GMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTI-MCCANATGLHKLKLCVVGKAKKPRSFKS--TDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIF----AKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLE--EGND--LKSFWK-KLTLLDALYEIAMAWNLVKPVTISRAWKKILP---MVEEKESLDFDVEDISVATVAAILQHTKGLENVTTENLEKWLEVDSTEPGYEVLTDSEII 450          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 102.064 bits (253), Expect = 3.161e-22
Identity = 86/331 (25.98%), Postives = 143/331 (43.20%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGK-IYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLW 1369
            E+++++++ W N+++     V+   IC K    + D +    D        F  S GW   FK+  GI      G     D   A  F   F + +  E   P+Q+    + G F K +  + +     +  +  +        +  A A+   K+ L VV   + P AFK   +  S+L V +     AWI    F +W  + F   V+K+     L  K +L++D  P  P   E+ L        VK+L  N   L+QPM Q V +  K+ Y   L Q+   ++EG +  +  FWKN    ++ +  + +AWN V   T+  AW+KL+
Sbjct:   77 EELDRVMIEWFNQQKTDGIPVS-GTICAKQAKFFFDALGMEGD--------FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPN--EEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKY--MDEGNDPKI--FWKN-LTVLDAIYEVSRAWNMVKSSTITKAWKKLF 389          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 102.064 bits (253), Expect = 3.161e-22
Identity = 86/331 (25.98%), Postives = 143/331 (43.20%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGK-IYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLW 1369
            E+++++++ W N+++     V+   IC K    + D +    D        F  S GW   FK+  GI      G     D   A  F   F + +  E   P+Q+    + G F K +  + +     +  +  +        +  A A+   K+ L VV   + P AFK   +  S+L V +     AWI    F +W  + F   V+K+     L  K +L++D  P  P   E+ L        VK+L  N   L+QPM Q V +  K+ Y   L Q+   ++EG +  +  FWKN    ++ +  + +AWN V   T+  AW+KL+
Sbjct:   77 EELDRVMIEWFNQQKTDGIPVS-GTICAKQAKFFFDALGMEGD--------FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPN--EEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKY--MDEGNDPKI--FWKN-LTVLDAIYEVSRAWNMVKSSTITKAWKKLF 389          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 76.6406 bits (187), Expect = 4.344e-14
Identity = 82/336 (24.40%), Postives = 131/336 (38.99%), Query Frame = 2
Query:  377 LEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLP--LKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLT---LRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLW 1369
            LE ++++L  W   K+     V+   + +KA   Y  +         +  E    S GW   FK   GI  +    +  S D + AE F   F  L        +QV      G F +                 Q  +R +  L  A A+ + ++K   +     P AFK       HL V ++    AW+    F +W + +F  +V+++F    LP   K +L++D++  HP   E +L+    FT   FL  +   L+QPM+Q +  +F + +          +N    L     R    +   +V C      AWN V       AWRKLW
Sbjct:   86 LEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQM---------QLTEPCVFSGGWLWRFKARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPTPEGG-AVPGPKQGKDRLTV-LMCANATGSHRLKPLAIGKCSGPRAFKGIQ----HLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAVLLLDSSRAHP--QEAELVSSNVFT--IFLPASVASLVQPMEQGIRRDFMRNF----------INPPVPLQGPHARYNMNDAIFSVAC------AWNAVPSHVFRRAWRKLW 386          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:Xenbase;Acc:XB-GENE-1014042])

HSP 1 Score: 78.5666 bits (192), Expect = 1.224e-14
Identity = 99/434 (22.81%), Postives = 174/434 (40.09%), Query Frame = 2
Query:  269 GMRVVDINYLQNIKKELRGIYVAKKVTRLLK*RQRVLE----DVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDL-ISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGK-IYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLP--LKGLLVMDNAPDHPPG---LEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQR----CVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDN------FEGLAHEEERSVIDEIVFLRKNMGLE----VNEDNIQE 1495
            G+    I  L+  K +L   Y       L+  R+ + +     V+K+L+ WI +++     ++ + I  +A   +  L IS    TP  Y      S GW+  FKK +G+  +  +G+ AS +   A+ F  +  KL+  E    +QV    +   F + + QK +   ++  ++  +  +     L  + A+   K +L V+    NP AFK   V      V +  N +A IT   F +W    F    + + +   L    K +L++D+ P HP     ++D++           L  +    +QP+DQ +   FK  Y     QR    C +   G     +   K+   T         AW+ V K  L   WR L       DN      F G     E  +  E++   +++       ++E+ I+E
Sbjct:  213 GIGTSTIYDLKKQKDKLLTFYSNSDAPDLMADRKTLHQAKNVSVDKVLMEWIRQRRRENFPLSRSLIMAQAKKFHVLLNIS----TPCEY------SSGWYGKFKKRNGLSILSINGEKASEEYNVADNFVKKLNKLVSDEHLSAEQVYNAAKASLFWRHLPQKLVATAQKPPSSGLEDPKERLTVLACSNAAGTHKARLLVIGKSRNPRAFKGVRV----FPVTYTANKQAGITREIFQDWFENHFVPEARAHCMSVGLSQDAKVMLILDHCPTHPSAEFLVKDNVF-------AVCLPPDCTSFIQPLDQGILRLFKSNYKSEFLQRMLTECNKGMAGAQFQAKANIKDAIWTAAL------AWDKVDKQALIHGWRNLCPSSFALDNPAEECDFLGFTELRESQLTSELMNYARSLSCPEARLLDEEAIEE 619          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: apmapl (adipocyte plasma membrane associated protein LIKE [Source:Xenbase;Acc:XB-GENE-5754317])

HSP 1 Score: 74.3294 bits (181), Expect = 1.870e-13
Identity = 74/297 (24.92%), Postives = 120/297 (40.40%), Query Frame = 2
Query:  533 FKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEER 1423
            FK S GWF  ++K  GI S   +G++        E   TE   ++I     P+Q  T      +G            E              L +A  + + K+K  VV    +P + +     +      + Y+  AW+T     EW  E F   VK+Y     L  K +L+++  P  PP  E+DL       +V FL+  T   +  MDQ V S+FK+LY + L +  V  +   +  +       F   + + +  ++WN +  G++   W  L+    LR  FE  A  E +
Sbjct:  121 FKASHGWFWRWQKRHGISSQRIYGES--------EVRQTEMDPVII----FPEQPNTPVADSGYGD-----------EVTV-----------LLAANLTGSHKLKPLVVGKLRDPPSLRHH--NQDKFPAVYHYSRNAWVTQELLREWFLEEFVPAVKRYLKRCCLQQKAVLLVNQCPGKPP--EEDLQTADGNIRVLFLSKTTRSKIPSMDQGVISSFKQLYRRELLKLMVSCDSSPSDFV-----TSFRLKDMIYLAGQSWNMIQAGSIEKCW--LYG---LRAAFETNASAETK 369          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000046714.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460367.1:582927:585046:-1 gene:ENSXETG00000018570.1 transcript:ENSXETT00000046714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 3.833e-8
Identity = 49/190 (25.79%), Postives = 79/190 (41.58%), Query Frame = 2
Query:  527 EGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFAT-EFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPL---KGLLVMDNAPDHPPGL 1084
            + F  S GW D FKK   +      G++ S+D+ T   + T + P  +  E Y  + +      G F  +       +R E     ++ +     LF+  A  + K+K  V+     P  FK      + L   +  N+KAW+T+  F E +          + L+N + L   K LL +D  P HPP L
Sbjct:  116 DNFTASNGWIDRFKKRYNVVYKAVCGESKSVDIDTVTNWKTNQLPCYL--EGYELKNIFNTDETGLFFNVLPGKTFCFRGEDCHGGKLSKLRLTVLFTTNADGSEKLKPLVIGKSVKPRCFKNV----NTLPTNYTANTKAWMTTKLFEEQM----------HLLDNRMRLQKHKILLFLDRCPAHPPSL 289          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 105.916 bits (263), Expect = 1.127e-23
Identity = 104/403 (25.81%), Postives = 168/403 (41.69%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAK--------ASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPG--LEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLE-VNEDNIQELVEEHDQE-----LTANELI 1540
            E+++K +L W N+++   + ++     K+A   +  L           D  F  S GW   FK+   I  I    +  + D    E F   F   +  E   P+Q+      G F K         + +C         P H L   +        A+   K+KL VV     P +FK       +L V +     AW+    F +W +++F   V++Y     L  K +L++DN+P HP    L  D  + F     K+L  N   L+QP+ Q V +  K+ Y   L    +E  EG +  L+ FWK     ++ L  I  AWN V   T++ AW+++       +  EGL  +E+ S       L+   GLE V  +N+++ +E    E     LT +E+I
Sbjct:   77 EELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL---------GMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTV-------PGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKS--TDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIF----AKYLPPNVASLIQPLGQGVIAAMKRNYRAGLLHNNLE--EGND--LKSFWK-KLTLLDALYEIAMAWNLVKPVTISRAWKQILPAI---EEKEGLDFDEDISGATVATILQHTKGLENVTPENLEKWLEIDSTEPGYEVLTDSEII 449          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 104.76 bits (260), Expect = 2.870e-23
Identity = 99/372 (26.61%), Postives = 159/372 (42.74%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGK-IYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSV-IDEIVFLRKNMG--LEVNED 1483
            E+++++++ W N+++     V+   IC K    + D +    D        F  S GW   FK+  GI      G     D   A  F   F + +  E  LP+Q+    + G F K +  + + +   +     +        +  A A+ + K+ L VV   + P AFK   +  S+L V +     AWI      +W  + F   V+K+     L  K +L++D    HP   E+ L        VK+L  N   L+QPM Q V +  K+ Y   L Q+ ++  EG +   + FWKN    ++ +    +AWN +   T+  AW+KL         F G  +EE  SV IDE   L  N+   L+  ED
Sbjct:   77 EELDRVMIEWFNQQKTDGIPVS-GTICAKQARFFFDALGMEGD--------FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDL--SNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPA--EELLSSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMD--EGND--PKTFWKN-LTVLDAIYEASRAWNQIRSNTITRAWKKL---------FPG--NEENPSVSIDEGAILAANLATVLQNTED 419          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 78.1814 bits (191), Expect = 9.893e-15
Identity = 76/339 (22.42%), Postives = 135/339 (39.82%), Query Frame = 2
Query:  377 LEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKD------IHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLP--LKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLW 1369
            LE ++++L  W   K+     V+   + +KA   Y  +         R  E    S GW   FK   GI  +    +  + D + AE F   F  L       P+QV +    G   +           + ++++  +  +         L  A A+ + +IK   +     P AF+       HL + ++    AW+    F +W + +F  +V+++F    LP   K +L++D++  H    E +L+ +  FT   FL  +   LLQP +Q +   F +L+                +  + F   H +  + +  + +AWN V       AWRKLW
Sbjct:   86 LEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQM---------RLTEPCVFSGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPNSAPDDGTVPHFKQGKDRLTV--------LMCANATGSHRIKPLAIGKGGGPRAFRGIQ----HLPIAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAH--SQESELVSENVFT--IFLPSSVTSLLQPTEQGIRRAFMRLFIN------------PPVAFQGFPTRH-NINDAIVNVARAWNAVPSQVFQRAWRKLW 386          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.433e-50
Identity = 135/413 (32.69%), Postives = 214/413 (51.82%), Query Frame = 2
Query:  347 TRLLK*RQRVLEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRE--CNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCV-----EVNEGTNLT-LRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQQ 1561
            TR+++ R  ++ D+EK+L+VWI ++      ++++ I  KA  L+  +  K        +E F+ SRGWF  FK+ S  H+I   G+AAS DV+ A ++     K++    Y  QQ+       F+ K         R E     +    +R +  L  A A+ +FK+K  ++Y+ ENP A K     KS L V +++NSKA +T+  F  W  E F  TV+ Y  E  +P K LL++DNAP HP      L+E +    V F+  NT  +LQPMDQ V S FK  Y +  F + +     +V++G+  + L+ FWK  F  ++ +K I  +W  V   TL   W+KL    I  D++EG     E    D +V + K + LEV  +++ EL++ HD+ LT  EL  +  +++
Sbjct:   69 TRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSM--KAERGVEAAEEKFEASRGWFMRFKERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTL-LLGANAAGDFKLKPMLIYHSENPRALKNYT--KSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRA----LMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKG-FTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLI--DDYEGFKTSVEEVSAD-VVEIAKELELEVEPEDVTELLQSHDKTLTDEELFLMDAQRK 468          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 2.199e-24
Identity = 107/398 (26.88%), Postives = 174/398 (43.72%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECN--AWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPG--LEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHE-EERSVIDEIVFLRKNMGLE-VNEDNIQELVEEHDQE-----LTANELI 1540
            E++++ +L W N+++   + ++     K+A   +  L           D  F  S GW   FK+   I  I    +  + D    E F   F   +  E   P+Q+      G F K     I   + +C       + ER +  +  A A+   K+KL VV   + P +FK       +L V +     AW+    F +W +++F   V++Y     L  K +L++DN+P HP    L  D  + F     K+L  N   L+QP DQ V +  K+ Y   L Q  +E  EG +  L+ FWK     ++ L  I  AWN V   T++ AW+K+     + +  E L  + E+ SV      L+   GLE V  +N+++ +E    E     LT +E+I
Sbjct:   77 EELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL---------GMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTI-MCCANATGLHKLKLCVVGKAKKPRSFKS--TDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIF----AKYLPPNVASLIQPSDQGVIATMKRNYRAGLLQNNLE--EGND--LKSFWK-KLTLLDALYEIAMAWNLVKPVTISRAWKKILP---MVEEKESLDFDVEDISVATVAAILQHTKGLENVTTENLEKWLEVDSTEPGYEVLTDSEII 450          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 7.880e-23
Identity = 104/403 (25.81%), Postives = 168/403 (41.69%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAK--------ASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPG--LEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLE-VNEDNIQELVEEHDQE-----LTANELI 1540
            E+++K +L W N+++   + ++     K+A   +  L           D  F  S GW   FK+   I  I    +  + D    E F   F   +  E   P+Q+      G F K         + +C         P H L   +        A+   K+KL VV     P +FK       +L V +     AW+    F +W +++F   V++Y     L  K +L++DN+P HP    L  D  + F     K+L  N   L+QP+ Q V +  K+ Y   L    +E  EG +  L+ FWK     ++ L  I  AWN V   T++ AW+++       +  EGL  +E+ S       L+   GLE V  +N+++ +E    E     LT +E+I
Sbjct:   77 EELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL---------GMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTV-------PGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKS--TDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIF----AKYLPPNVASLIQPLGQGVIAAMKRNYRAGLLHNNLE--EGND--LKSFWK-KLTLLDALYEIAMAWNLVKPVTISRAWKQILPAI---EEKEGLDFDEDISGATVATILQHTKGLENVTPENLEKWLEIDSTEPGYEVLTDSEII 449          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q0VBL1|TIGD2_MOUSE (Tigger transposable element-derived protein 2 OS=Mus musculus OX=10090 GN=Tigd2 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 2.008e-22
Identity = 99/372 (26.61%), Postives = 159/372 (42.74%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGK-IYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSV-IDEIVFLRKNMG--LEVNED 1483
            E+++++++ W N+++     V+   IC K    + D +    D        F  S GW   FK+  GI      G     D   A  F   F + +  E  LP+Q+    + G F K +  + + +   +     +        +  A A+ + K+ L VV   + P AFK   +  S+L V +     AWI      +W  + F   V+K+     L  K +L++D    HP   E+ L        VK+L  N   L+QPM Q V +  K+ Y   L Q+ ++  EG +   + FWKN    ++ +    +AWN +   T+  AW+KL         F G  +EE  SV IDE   L  N+   L+  ED
Sbjct:   77 EELDRVMIEWFNQQKTDGIPVS-GTICAKQARFFFDALGMEGD--------FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDL--SNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPA--EELLSSDDGRIIVKYLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMD--EGND--PKTFWKN-LTVLDAIYEASRAWNQIRSNTITRAWKKL---------FPG--NEENPSVSIDEGAILAANLATVLQNTED 419          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q4W5G0|TIGD2_HUMAN (Tigger transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=TIGD2 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.518e-21
Identity = 86/331 (25.98%), Postives = 143/331 (43.20%), Query Frame = 2
Query:  380 EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGK-IYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLW 1369
            E+++++++ W N+++     V+   IC K    + D +    D        F  S GW   FK+  GI      G     D   A  F   F + +  E   P+Q+    + G F K +  + +     +  +  +        +  A A+   K+ L VV   + P AFK   +  S+L V +     AWI    F +W  + F   V+K+     L  K +L++D  P  P   E+ L        VK+L  N   L+QPM Q V +  K+ Y   L Q+   ++EG +  +  FWKN    ++ +  + +AWN V   T+  AW+KL+
Sbjct:   77 EELDRVMIEWFNQQKTDGIPVS-GTICAKQAKFFFDALGMEGD--------FNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERIIIMCCANATGLHKLNLCVVGKAKKPRAFKGTDL--SNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPN--EEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKY--MDEGNDPKI--FWKN-LTVLDAIYEVSRAWNMVKSSTITKAWKKLF 389          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A3Q3IBC0 (HTH CENPB-type domain-containing protein OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 299/454 (65.86%), Postives = 325/454 (71.59%), Query Frame = 2
Query:  260 HARGMRVVDINYLQNI-----------KKELRGIYVAKKVTRLLK*RQRVLEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHP--------LFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQQQ 1564
            H RGMRV DI    N            K+E+ G+  AK VTR+ K R RVLEDVEKLLLVWINEKQL  DTV+EN IC+KA  LYTDL+SKLP T    +EGFK SRGWFDNFK+ SGIHS+VRH +AAS   K AEAF  EF KLM+SE YLP QV      G F K   K   Y   E NA       P H         L  A AS + KIK  +VY+ ENP AFKKC VQKS LNV WR NSKAW+T I FVEWINEVFG TVKKY LE NLPLK LLVMDNAP HPPGLEDDLLE+F F KVKFL  NT PLLQPMDQ VTSNFKKLYTKALFQ C EV EGTNLTLR+FWKNHFH VNCLK+IDKAWN VTK TLN AWRKLWSDC L  + EG A E++  V+DEI+ L K MGLEVNED+IQELVEEH QELT NELI+LH EQQQ
Sbjct:   34 HERGMRVADIARFYNKSTSTICTILKKKEEIMGLDAAKGVTRVSKQRPRVLEDVEKLLLVWINEKQLGGDTVSENIICEKAKALYTDLVSKLPGTSTENEEGFKASRGWFDNFKRRSGIHSVVRHREAASSYAKAAEAFTAEFQKLMVSEGYLPHQVFKCDETGLFWKKMPKRT-YITAEENA------MPGHKPMKDRLTLLLCANASGDLKIKPLLVYHSENPRAFKKCKVQKSQLNVMWRSNSKAWVTRILFVEWINEVFGPTVKKYLLEKNLPLKVLLVMDNAPAHPPGLEDDLLEEFEFIKVKFLPPNTTPLLQPMDQQVTSNFKKLYTKALFQLCFEVTEGTNLTLREFWKNHFHIVNCLKLIDKAWNWVTKRTLNSAWRKLWSDCALGHDVEGFAQEQQPPVVDEIMSLGKTMGLEVNEDDIQELVEEHGQELTTNELIDLHREQQQ 480          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A3B3R9B8 (HTH CENPB-type domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 299/454 (65.86%), Postives = 323/454 (71.15%), Query Frame = 2
Query:  260 HARGMRVVDINYLQNI-----------KKELRGIYVAKKVTRLLK*RQRVLEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHP--------LFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQQQ 1564
            H R MRV DI    N            K+E+ G+  AK VTR+ K R  VLEDVEKLLLVWINEKQLA DTVTEN IC+KA  LYTDL+SKLP T    +EGFK SRGWFDNFKK SGI S+VRHGDA   D K AE FA EF KLM+SECYLPQQV      G F K   K   Y   E NA       P H         L  A AS +FK+K  +VY+ ENP AFKKC VQKS LNV WR N KAW+T I FVEWINEVFG  VKKY LE NLPLK LLVMDNAP H PGLEDDLLE+F F KVKFL  NT  LLQPMDQ V SNFKKLYTKALFQRC EV EGTNLTLR+FWKNHFH VNCLKIIDKAW+GVTK TLN AWRKLWSDC+L   FEG AHE E  V+DEIV L K +GLEVNE++IQELVEEH QELT +ELI+L  EQQQ
Sbjct:   31 HERRMRVADIARFYNKSTSTICTILKKKEEIMGLDAAKGVTRVSKQRPHVLEDVEKLLLVWINEKQLAGDTVTENFICEKAKTLYTDLVSKLPGTSTE-NEGFKASRGWFDNFKKRSGIRSVVRHGDAGISDAKAAEVFADEFQKLMVSECYLPQQVFNCDEMGLFWKKMPKRT-YITAEENAM------PGHKPMKDRLTLLLCANASGDFKVKPLLVYHSENPRAFKKCRVQKSQLNVMWRSNRKAWVTRILFVEWINEVFGPAVKKYLLEKNLPLKVLLVMDNAPAHSPGLEDDLLEEFEFIKVKFLPPNTTSLLQPMDQQVISNFKKLYTKALFQRCFEVTEGTNLTLREFWKNHFHIVNCLKIIDKAWDGVTKRTLNSAWRKLWSDCVLGHGFEGFAHELEPPVVDEIVSLGKTLGLEVNEEDIQELVEEHGQELTTDELIDLRREQQQ 476          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A087UKA3 (Tigger transposable element-derived protein 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_04803 PE=4 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 5.057e-130
Identity = 219/454 (48.24%), Postives = 290/454 (63.88%), Query Frame = 2
Query:  260 HARGMRVVDINYLQNI----------KKEL-RGIYVAKKVTRLLK*RQRVLEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIR--YDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSH-PL-------FSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQ 1558
            H +G+R +D+  +             +KEL +GI  AK VT + K R  + E ++KLL VW+ EKQL   T+T++ I +KA  +Y DL+ ++P T  +   ++ FK SRGWFDNF+K +GIHS+VRHG+AAS DVK AE +   F +L+ ++ YLPQQV      G F K      +    E          P H P+         A AS + KIK  +VY+ ENP AF+   + K  L V WR N KAW+T  FFVEWIN VFG +VKKY  ENNLP++ LLV+DNAP HP  LEDDL E+F F K+ +L  NT P+LQ MDQ V S+FKKLYTK +F+R  EV E TNLTLR+FWK+HF+ + CL+IID+AW GVT  TL  AW+KLW + +    FEGLA   E SV++EIV LRK+MGL+V+E ++ +LVEE  Q+LT  EL +LH +Q
Sbjct:   20 HEQGVRKIDLARMYGCSISVICTVLKQKELIKGITPAKSVTIISKLRTSLYEKMKKLLKVWVTEKQLQGGTLTQSIIWEKARAIYGDLLKQIPHTFTKEESEDSFKASRGWFDNFRKRTGIHSVVRHGEAASSDVKAAEVYIITFSELIEAKGYLPQQVFNCDETGLFWKRMPNRTYITAEEKTM-------PGHKPMKDRLTLALCANASGDCKIKPLLVYHPENPRAFRSHKILKVKLPVMWRANPKAWLTRKFFVEWINLVFGLSVKKYLQENNLPMQALLVLDNAPAHPLNLEDDLFEEFKFIKILYLPPNTTPILQTMDQQVISDFKKLYTKHIFRRYFEVTENTNLTLREFWKDHFNIMLCLRIIDQAWPGVTTSTLTSAWKKLWPEAVAERAFEGLA--PEVSVVEEIVSLRKSMGLKVDERDVNKLVEEQVQKLTTEELHDLHSQQ 464          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4Y2J5W7 (Tigger transposable element-derived protein 1 OS=Araneus ventricosus OX=182803 GN=TIGD1_7 PE=4 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 2.250e-128
Identity = 217/448 (48.44%), Postives = 283/448 (63.17%), Query Frame = 2
Query:  266 RGMRVVD-----------INYLQNIKKELRGIYVAKKVTRLLK*RQRVLEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEG----FKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRE--CNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQ 1558
            +G+RV D           I+ +   KK ++G+  AK VT + K +  + E +EKLL+VW+ EKQL  DT+T+  IC+KA  +Y DL+++ P T    DEG    FK SR WFDNF+K +GIHSIVRHG+AAS DVK AE +   F +L+ +  Y+PQQV      G F K      +    E        + +R +  L  A AS + KIK  +VY+ ENP AFK   + K  L V WR N KAW+T  FFV+W+N VFG +VKKY  ENNLP++ LLV+DNA  HPP LEDD+LE+F F KV +L  NT P+LQPMDQ V SNFKKLYTK LF+RC EV E TNLTLR++WK+HF+ V CL++ID+AW  VT  TL  AW+KLW + +    FEG   E       EIV L K+MGL ++E ++ EL+EEH QELT  EL  L  ++
Sbjct:   31 QGVRVADLARQYGRSTSTISTVLKQKKSIKGVTPAKGVTIISKLQSSLHEKMEKLLMVWVTEKQLKVDTLTQGIICEKARAIYGDLLNQTPRTST--DEGSEDSFKASRSWFDNFRKRTGIHSIVRHGEAASSDVKAAEDYLKTFSELIEANGYIPQQVFNCDETGLFWKKMPNRTYITAEEKIMPGHKPMKDRLTLAL-CANASGDCKIKPLLVYHSENPRAFKSHKILKEKLQVMWRANPKAWVTRQFFVQWVNLVFGPSVKKYLQENNLPMQALLVLDNASAHPPNLEDDILEEFKFIKVLYLPPNTTPILQPMDQQVISNFKKLYTKHLFRRCFEVTENTNLTLREYWKDHFNIVVCLRMIDQAWLSVTTRTLTSAWKKLWPESVAERTFEGFEPEVPVEE--EIVSLGKSMGLVMDERDVNELIEEHSQELTTVELQELQSQK 473          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4Y2CVZ5 (Tigger transposable element-derived protein 1 OS=Araneus ventricosus OX=182803 GN=TIGD1_64 PE=4 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 3.258e-126
Identity = 226/452 (50.00%), Postives = 284/452 (62.83%), Query Frame = 2
Query:  266 RGMRVVDINYLQNI-----------KKELRGIYVAKKVTRLLK*RQRVLEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHP--------LFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQQQ 1564
            RG+ V D+    N            K  ++ +  +K VTR+   R R+L+DVE+LLL WINEKQL  D V EN IC+KA  ++ DL+ K P +    +E FK SRGWF+ FK+ +GI  +VRHG+AAS + K AE F + F KL+  E YLPQQV      G F K   K   Y  +E NA       P H         LF A AS + KIK  +VY+ E P  FKKC +QKS LNV WR N+ A +T   F +WINEVF  +VKKY LE NLPL  LL+MDN+P HPP L+D LLE+F F K+ FL  NT  LLQPM+Q V S+FKKLYTKALF+RC EV E TN+TLR+FWK HFH V CLK+I+ AW GVTK TL  AW+KLW + ++   FE         V+ EIV L K +GLEV+ ++I++LVEEH+QELT  EL+ LH   QQ
Sbjct:   31 RGVSVADLARTYNRSTSTICTILKDKDRIKEVDASKGVTRISTQRLRILDDVERLLLRWINEKQLQGDFVNENIICEKAKAIFADLVKKTPGSST-TEEVFKGSRGWFEKFKRRTGI--VVRHGEAASFETKAAENFISNFKKLVYFEGYLPQQVFNCAETGLFWKKMPKRT-YITQEENAL------PGHKPMKDRLTLLFCANASGDLKIKPLLVYHSETPQDFKKCKIQKSRLNVMWRSNNTACVTRDIFTDWINEVFAPSVKKYLLEMNLPLHVLLIMDNSPAHPPDLQDHLLEEFKFIKILFLPPNTTQLLQPMNQQVLSSFKKLYTKALFERCFEVTEVTNITLREFWKCHFHIVACLKMIENAWEGVTKRTLTSAWKKLWPESVVECEFEEPETVPVDPVVYEIVSLAKIVGLEVDSNDIEQLVEEHNQELTTEELLELHRVSQQ 472          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.058 bits (375), Expect = 3.931e-39
Identity = 119/412 (28.88%), Postives = 193/412 (46.84%), Query Frame = 2
Query:  299 QNIKKELRGI--YVAKKVTRLLK*RQRVLEDVEKLLLVWI---NEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWS-QVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGL-EVNEDNIQELVEEHD 1513
            +NIK   + +   VA K+TR    R  ++E++E+ L +WI   NE ++   T     I  KA  L+ D   +  ++    +E F  S GW+  FK    +  +   G+ A  DV+ AEAF +   +++    Y P+QV      G F K         R E  A   +  +     L  A A+ + K+K  +VY+ + P A K C+  K+ L V WR N K WIT+  F++W+   F   ++KY  + NL  K LL+++NAP HPP L +                        + +HV         +   ++ V   +    T+R+FW++ ++ ++ +  I++AWN V + TLN  W KLW +C  + +  GL  ++  + I  IV L +N G  EV +      VEE D
Sbjct:   55 ENIKARAQRMTPLVAAKLTRK---RSPLMENMEESLGMWIKHQNEHRMPLSTA---LIQAKALRLFNDFKKRAGESAA--NETFGASTGWYAKFKGRYNLRHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETGLFWKRMPASTFLSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRALKGCI--KADLPVIWRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDHKALLLLNNAPGHPPTLSE------------------------LSEHV---------RGTMEQIVANTDKDVQTIREFWRS-YNIMDAIDNINEAWNEVAQTTLNACWGKLWKEC--KHDLTGL--QDPVNDIHRIVELARNAGFHEVEQRKGLVSVEEDD 418          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005921.1 (pep scaffold:Pmarinus_7.0:GL487978:976:2666:1 gene:ENSPMAG00000005352.1 transcript:ENSPMAT00000005921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 7.953e-31
Identity = 83/229 (36.24%), Postives = 116/229 (50.66%), Query Frame = 2
Query:  869 ENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEG-TNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNF----EGLAHEEERS-VIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANEL 1537
            ENP AFK   + K+ L V +R N  AW+T   F +W    F   V+KY  +  +P K LLV+DNAP HP  L DD        KV FL  N   +LQPMDQ V +  K  Y +    + +E  EG T  T+R+FW+  +     ++ I KAW  VT+  LN AW K+               G  ++E  + V   IV L   + LEV+  +++EL+E H  EL+  +L
Sbjct:  189 ENPRAFKG--ISKATLPVYFRANPTAWVTVAIFEDWFINCFIPDVEKYCRDEGIPFKILLVIDNAPSHPAHL-DDFHPNI---KVVFLPPNATSVLQPMDQGVNAKCKAYYLRRTLAQALEATEGDTGKTVREFWE-AYDVYQAVQNIAKAWAEVTQTCLNGAWEKMCPQLAAAAAAVHARRGPQNDETHAEVAQSIVTLAAELRLEVDAADVEELIESHGAELSNEDL 410          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003106.1 (pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 gene:ENSPMAG00000002845.1 transcript:ENSPMAT00000003106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.79 bits (312), Expect = 9.196e-31
Identity = 89/238 (37.39%), Postives = 124/238 (52.10%), Query Frame = 2
Query:  869 ENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLE--DDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVN--EGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQQQRF 1570
            ENP A K     K+ L V W+ N KA +T   F EW    F   VK+Y   NNL  K +LV+DNAP HP  +E  D  +      KV FLT NT  LLQPMDQ V S+FK  Y +  F + +     EG   TL +FWK  F  ++ +K I  +W  + +  LN  WRKL  + +   NF+G   +    V + +V +   + LEV  +++ EL+  H  EL+  +L+ L   +QQR 
Sbjct:  182 ENPRALKGYT--KNTLPVIWKSNPKARVTGAIFEEWFRVYFVPAVKEYCRTNNLAFKAILVLDNAPCHPVSVEGFDPNI------KVVFLTPNTTALLQPMDQGVMSSFKAYYLRQTFAQAISATDKEG-GPTLTEFWKG-FSILDAVKNIAASWKEMKQSNLNGVWRKLCPEFV--SNFQGFT-DTVEEVTENVVEMAGQLQLEVAPEDVGELLASHAHELSNEDLLQL---EQQRL 403          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003283.1 (pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gene:ENSPMAG00000003000.1 transcript:ENSPMAT00000003283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 1.045e-30
Identity = 117/419 (27.92%), Postives = 189/419 (45.11%), Query Frame = 2
Query:  308 KKELRGIYVAKKVTRLLK*RQRVLEDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKL-PDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRD--NFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCE 1555
            +K+LR   ++   +R ++ R +++E+ E+LL +WI  +       +   I +KA  +Y DL  K  PD      + F  S  W   FKK   +H+     +AAS D   A  F     +++    Y P +    T  G      +  +                    +  A AS  +++K  VV++  NP   K  +  ++ L V +R + + W+T   F +++ E     +++Y    N   K LLV+DNAP HPP +  DL E+    KV FL  +T  LLQPM Q V + FK  Y +  F   +E  +G N      W++ F+    + II +AW  +T+  LN   RKL    ++RD   FE    E+ + +  + V L +  G E     ++   E H +EL+  EL  L  E
Sbjct:   54 RKKLRKANIS--ASRSVRARPKIVEETERLLSLWIESQTKRRSGPSFLTIKQKALSIYEDLKKKCKPDN----VQPFNASSEWLAGFKKRFDLHNAKLTVEAASADAAVAANFPDALNRVIDEGGYSPDRA---TAPGLRAAKDRLTV--------------------MLGANASGGYRLKPVVVHHSANPRTLKGFV--RADLGVHFRSSKRGWMTDQMFTDYVLETLQDELRRYCKRKNQDFKILLVVDNAPSHPPYIV-DLSEQI---KVVFLPPHTTSLLQPMGQGVIAAFKAYYLRRTFAMLIEATDGENSQASVTWRS-FNIKQAIDIIVEAWTDITQPCLNGVCRKLPH--VVRDFRAFEA-QQEQLKKIQIQCVALARRAGFE----KVEGAEESHREELSTEELQKLTAE 429          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010132.1 (pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 gene:ENSPMAG00000009170.1 transcript:ENSPMAT00000010132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 2.785e-30
Identity = 104/388 (26.80%), Postives = 175/388 (45.10%), Query Frame = 2
Query:  353 LLK*RQRVLEDVEKLLLVWI---NEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWS-QVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVE 1504
            L++ R  ++E++E+ L +WI   NE ++   T     I  KA I    L  +L ++  R  E F  S GW+  FK    +H +   G+ A  DV+ AEAF +   +++    Y P+QV        F K         R +  A   +  +     L  A  + + ++K  +VY+ + P   K C+  K+ L + WR N K WIT+  F++W+   F   ++KY  + NL LK LL+ +NAP HPP   +                        + +HV              + V   +     +R+FW + ++ ++ +  I++AWN V + TLN  W KLW +C  + +  GL  +E  + I  IV L +   + V +D+  E  +
Sbjct:   71 LMRKRSPLMENMEESLGMWIKHQNEHRMPLSTA---LIQVKALIQAKAL--RLEES--RQAETFGASTGWYAKFKGRYNLHHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCI--KADLPI-WRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDLKALLLRNNAPGHPPTPSE------------------------LSEHV--------------KIVANTDKDVQIIREFW-HSYNIMDAIDNINEAWNEVAQTTLNAYWGKLWKEC--KCDLTGL--QEPVNDIHRIVELARKGLVSVEKDDGAEATQ 405          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 56.9954 bits (136), Expect = 9.322e-9
Identity = 42/139 (30.22%), Postives = 64/139 (46.04%), Query Frame = 2
Query:  845 KLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTL-----NTNPLLQPMDQHVTSNFKKLY-TKALFQRCVEVNEG 1243
            K  V+    NP  F K  +    L V WR N +AWIT+  F +W+      T+ +   + +  +  LL +DN+P HPP L+         T VK + L     NT   LQP+ Q +   F+  Y  K LF    ++++ 
Sbjct:  207 KPLVIGPTANPPCFAK--LDSECLPVIWRANRRAWITTSIFADWLR-----TLDRKMRQKDRRI--LLFLDNSPPHPPTLQ--------LTNVKLVFLIKPSNNTVNQLQPLTQGIVEAFRMAYRRKVLFSTLAKLDDS 328          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO40000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8J7])

HSP 1 Score: 47.7506 bits (112), Expect = 5.579e-6
Identity = 57/243 (23.46%), Postives = 97/243 (39.92%), Query Frame = 2
Query:  365 RQRVL----EDVEKLLLVWINEKQLACDTVTENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWI-TSIFFVEWINEVFGFTVKKYFLENNLPLKGL-LVMDNAPDHP 1075
            RQR+     ED+EK L  W    +     ++   + + A     +LIS +         GF  S GW D +KK   +      G+  S  ++   ++       ++S+  L      +    F+  +  K +H   + C    Q   R +    +A +S   K+ +FV+   + P    +C     +L  ++R   K WI  S  F EW+ E       + F     P + + LV+DN P HP
Sbjct:   21 RQRLTPCGNEDLEKALYTWSVRMKQQGVPISGPVLKETAIHFANELISIVLS-------GFVGSNGWIDRWKKRQDVAFKTVSGEILSCTLEMTASWEESTLPTLLSKYALEDMFDADEFGLFYKALPDKLMHLKLQSCVGGKQSKVRLTG--LAAASSSGEKLPMFVIGKSQKP----RCFSGVRNLPCRYRAPKKGWILDSNLFEEWVRE-----QDRSF---ERPGRNVALVVDNGPAHP 242          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 2.910e-35
Identity = 107/354 (30.23%), Postives = 163/354 (46.05%), Query Frame = 2
Query:  533 FKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFA-TEFPKLMISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAKASK----------NFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVE-VNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNM---GL-EVNEDNIQELVEEHDQELTANELINL 1546
            F  S+GWFD F+K  G+ S+   G+A   D   AEA+A T+F  ++    Y P+QV      G F                 W Q+  +     F  +  +           F IK  ++   +NP A K   +  S L V W +N+ AW+T    + W    F   VK Y  E  L  K LL++DNA     G  DDL       +++FL  NT+ L+QPMDQ +   FK LYT+   Q  V+ ++   N + + +W+  +   +CL+ I +A   +   TLN  W KLW + +  +  E    E  RSV++  V L K +   G  E+  D++  L++ H Q LT  +L  +
Sbjct:  102 FYASKGWFDKFQKRFGLKSVSLQGEATPADAAGAEAYAKTKFKTIIKEGTYKPEQVFNMGETGLF-----------------WKQIPSQAKASGFRGQKDRVTLVMCGNAAGFMIKPGLISRLKNPRALKNKNM--SALPVYWMHNTMAWMTKALNLNWFKGCFIPEVKGYLTEKGLDFKVLLLIDNAG----GFADDLSHDG--VQIEFLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHLVDAMDSDQNFSFKDYWR-EYTIASCLQHIQRAHQEMKSETLNGCWEKLWPEAV-HNPTESRLDEIHRSVVETAVSLAKRLRGDGFDEITSDDVNSLIDAHSQPLTDEDLAEM 428          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 3.361e-33
Identity = 98/322 (30.43%), Postives = 144/322 (44.72%), Query Frame = 2
Query:  503 PDTPIRYDE--GFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISEC-YLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLFSAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIFFVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*FTKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVE-VNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRK 1456
            P T   + E   F  S+GWF+NFKK                     +AF     K +I E  Y P+Q+      G F K         + E  A     ++    L     +  F IK  ++Y  +NP A K     K  L+V W YN+KAW+T    ++W    F   VK Y     L  K LL++DNA  H   L  D ++      +KFL  NT  L+QPMDQ +   FK LYT+   Q  V+ ++   + +L+ +W+  +   +CL+ I +A   +   TLN  W+KLW + + ++   G   E  RS +D  V L K
Sbjct:   65 PSTSAVHAEPCAFNASKGWFENFKK---------------------QAFVNNKFKAIIEEGGYKPEQIFNIDETGLFWKRMPSRTFIMQEEAKAPGFKAQKDRLTLVKCGNAAGFMIKPGLIYRSKNPRALKN--KNKDDLHVCWMYNAKAWMTKALNLDWFKNCFIPQVKCYLRGKGLDFKVLLLVDNAGGHADDLAYDCVQ------IKFLPPNTTSLIQPMDQGIIRAFKALYTRNTLQHLVDAMDSDQDSSLKDYWRG-YTIASCLQNIQRAIQEMKTETLNACWKKLWPEAV-QNPTGGSLDEVHRSAVDAAVNLTK 355          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000040783.1 (SMESG000040783.1)

HSP 1 Score: 132.88 bits (333), Expect = 1.420e-32
Identity = 62/81 (76.54%), Postives = 69/81 (85.19%), Query Frame = 2
Query:  446 ENCICKKA*ILYTDLISKLPDTPIRYDEGFKVSRGWFDNFKKISGIHSIVRHGDAASLDVKTAEAFATEFPKLMISECYLP 688
            ENCIC+KA I+YT LISKLPDT IRY+E FKVSRGWFDN KK SGIHS VR+G+AA+ DVK A+ F TEFPKLMISE YLP
Sbjct:    2 ENCICEKAKIVYTALISKLPDTSIRYEESFKVSRGWFDNVKKRSGIHSAVRYGEAANSDVKAADEFFTEFPKLMISENYLP 82          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 66.2402 bits (160), Expect = 8.186e-12
Identity = 40/133 (30.08%), Postives = 69/133 (51.88%), Query Frame = 2
Query: 1115 TKVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLE----VNEDNIQELV 1501
            + + F+  N   L+QP+DQ + + FKK Y K+ ++  +++ E   L L K WK  F  ++C+  +  A N +   TLN  W+ +W +C+  +   G   E    + DEI+ L    G E     N+++I+EL 
Sbjct:   43 STILFIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESILKI-ENETLPLSKIWK-KFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGN---GTIAE----ISDEIIALAHLFGGEGFETFNQNDIEELA 166          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.396e-11
Identity = 40/132 (30.30%), Postives = 69/132 (52.27%), Query Frame = 2
Query: 1118 KVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLE----VNEDNIQELV 1501
            ++ F+  N   L+QP+DQ + + FKK Y K+ ++  +++ E   L L K WK  F  ++C+  +  A N +   TLN  W+ +W +C+  +   G   E    + DEI+ L    G E     N+++I+EL 
Sbjct:  105 QILFIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESILKI-ENETLPLSKIWK-KFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGN---GTIAE----ISDEIIALAHLFGGEGFETFNQNDIEELA 227          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000057528.1 (SMESG000057528.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.482e-11
Identity = 40/132 (30.30%), Postives = 69/132 (52.27%), Query Frame = 2
Query: 1118 KVKFLTLNTNPLLQPMDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLE----VNEDNIQELV 1501
            ++ F+  N   L+QP+DQ + + FKK Y K+ ++  +++ E   L L K WK  F  ++C+  +  A N +   TLN  W+ +W +C+  +   G   E    + DEI+ L    G E     N+++I+EL 
Sbjct:  113 QILFIPPNMTSLIQPLDQGIIAPFKKYYIKSTYESILKI-ENETLPLSKIWK-KFTILDCINHVANAINQIRPMTLNLCWKAIWPECVTGN---GTIAE----ISDEIIALAHLFGGEGFETFNQNDIEELA 235          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000037674.1 (SMESG000037674.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.516e-11
Identity = 38/88 (43.18%), Postives = 51/88 (57.95%), Query Frame = 2
Query: 1301 KIIDKAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNMGLEVNEDNIQELVEEHDQELTANELINLHCEQQQ 1564
            KII+  W  VTK T+    +KLW       NFEG+      S++++IV L   MGLEVN ++I ELV+E  QELT  E + LH   Q+
Sbjct:   14 KIIETVWEAVTKRTIISERKKLWPYGDGECNFEGVETLPVESLVNKIVSLATTMGLEVNVNDIHELVKEPIQELTTEEQMELHYVSQE 101          
The following BLAST results are available for this feature:
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIGD12.984e-5132.69tigger transposable element derived 1 [Source:HGNC... [more]
JRKL4.578e-2526.88JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
TIGD23.161e-2225.98tigger transposable element derived 2 [Source:HGNC... [more]
TIGD23.161e-2225.98tigger transposable element derived 2 [Source:HGNC... [more]
JRK4.344e-1424.40Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kif61.224e-1422.81kinesin family member 6 [Source:Xenbase;Acc:XB-GEN... [more]
apmapl1.870e-1324.92adipocyte plasma membrane associated protein LIKE ... [more]
ENSXETT00000046714.13.833e-825.79pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Jrkl1.127e-2325.81Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Tigd22.870e-2326.61tigger transposable element derived 2 [Source:MGI ... [more]
Jrk9.893e-1522.42jerky [Source:MGI Symbol;Acc:MGI:106214][more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96MW7|TIGD1_HUMAN1.433e-5032.69Tigger transposable element-derived protein 1 OS=H... [more]
sp|Q9Y4A0|JERKL_HUMAN2.199e-2426.88Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|B2RRL2|JERKL_MOUSE7.880e-2325.81Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
sp|Q0VBL1|TIGD2_MOUSE2.008e-2226.61Tigger transposable element-derived protein 2 OS=M... [more]
sp|Q4W5G0|TIGD2_HUMAN1.518e-2125.98Tigger transposable element-derived protein 2 OS=H... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3IBC00.000e+065.86HTH CENPB-type domain-containing protein OS=Monopt... [more]
A0A3B3R9B80.000e+065.86HTH CENPB-type domain-containing protein OS=Paramo... [more]
A0A087UKA35.057e-13048.24Tigger transposable element-derived protein 1 (Fra... [more]
A0A4Y2J5W72.250e-12848.44Tigger transposable element-derived protein 1 OS=A... [more]
A0A4Y2CVZ53.258e-12650.00Tigger transposable element-derived protein 1 OS=A... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005656.13.931e-3928.88pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000005921.17.953e-3136.24pep scaffold:Pmarinus_7.0:GL487978:976:2666:1 gene... [more]
ENSPMAT00000003106.19.196e-3137.39pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 g... [more]
ENSPMAT00000003283.11.045e-3027.92pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gen... [more]
ENSPMAT00000010132.12.785e-3026.80pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 g... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO447389.322e-930.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400005.579e-623.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000036785.12.910e-3530.23pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
ENSORLT00000031980.13.361e-3330.43pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040783.11.420e-3276.54SMESG000040783.1[more]
SMESG000057528.18.186e-1230.08SMESG000057528.1[more]
SMESG000057528.11.396e-1130.30SMESG000057528.1[more]
SMESG000057528.11.482e-1130.30SMESG000057528.1[more]
SMESG000037674.11.516e-1143.18SMESG000037674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005555 ID=SMED30005555|Name=Tigger transposable element-derived protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1708bp
GCTAAGTATTGTAATACGAGTAACATGTATACGTATGTCTACCAACCGCC
ACGTTCGGTTTCAGTCGGTCGGTGTTGGTGTGTTTTAACATATTTACTCG
ACATACGTACGAAGTATTGTTTATTTTCTTTCTAAACGTGGTTAATGAGT
ATTTATTGATAACAGTACTGTAACCATGGCTCCCAAAAAGAAAACTGTTG
ATAAAGAAAATGATAAGAAAATTATTACGGTGGAAGTTAAGAAGGAAATC
ATCGAGAAGCACGCACGAGGTATGAGAGTTGTCGACATCAACTATTTGCA
GAATATTAAAAAAGAATTAAGGGGAATATATGTAGCAAAAAAAGTCACGA
GACTATTAAAGTAACGGCAACGTGTTCTGGAAGATGTAGAAAAGTTGCTT
CTCGTGTGGATAAACGAGAAACAACTAGCATGTGATACTGTAACGGAAAA
CTGTATTTGCAAGAAGGCATAGATTTTGTACACCGACCTCATAAGTAAAC
TACCAGATACGCCGATAAGATACGATGAAGGCTTTAAAGTGAGCAGGGGC
TGGTTTGACAATTTTAAAAAGATAAGTGGTATCCATAGTATTGTGCGACA
CGGAGATGCTGCGAGTTTGGATGTTAAGACAGCTGAGGCGTTCGCCACCG
AATTTCCGAAACTCATGATTTCCGAGTGTTACCTACCACAGCAAGTTTTA
ACTGAGACGAGACAGGGATTTTTCGGAAAAATATACCAAAAAGACATACA
TTACTATAGAAGAGAATGCAATGCCTGGTCACAAGTGCATGAAAGGCCAT
CTCACCCTCTTTTTTCTGCTAAAGCAAGCAAGAATTTTAAAATTAAGCTG
TTCGTGGTGTATTATTTCGAGAATCCTAGTGCTTTCAAGAAATGCATGGT
ACAGAAGAGTCATTTAAACGTTAAATGGAGGTATAACAGCAAAGCTTGGA
TCACTAGTATCTTCTTCGTTGAGTGGATCAATGAGGTCTTCGGTTTTACA
GTGAAAAAATACTTTTTAGAAAATAATCTGCCACTCAAAGGTTTGCTAGT
TATGGACAATGCCCCGGATCATCCACCAGGACTTGAGGATGATTTACTGG
AGAAATTCTAGTTCACTAAGGTGAAGTTTCTTACTCTCAATACCAATCCC
CTACTTCAGCCCATGGATCAGCATGTCACTTCGAACTTTAAAAAGCTTTA
CACCAAAGCATTATTTCAGCGATGCGTTGAGGTAAATGAAGGAACAAATC
TTACTCTCCGAAAATTCTGGAAAAATCATTTCCACACCGTGAACTGTCTC
AAGATCATCGATAAAGCTTGGAATGGGGTCACCAAGGGAACGCTCAATTT
TGCTTGGAGAAAACTGTGGTCTGACTGCATTCTAAGAGATAACTTTGAGG
GGTTAGCTCACGAAGAGGAACGGTCAGTTATAGATGAAATTGTCTTCTTG
AGGAAGAATATGGGCCTGGAAGTGAATGAGGATAACATTCAAGAGCTAGT
TGAGGAACATGACCAGGAGCTGACCGCCAACGAGCTAATTAATCTGCATT
GCGAACAACAGCAAAGATTTGAGGAGGAGATCTCGTGTGAGGAAAGCGAG
ATAAAGGAAAGGATATTATAAAGAGAAGGCAGAAGCAAATGTCCCTTGAT
AGTTTCGTCGTTAGAGTTACACAAAAGGAAAAATATTCCAGTGTTCCAAA
CGCAAATT
back to top

protein sequence of SMED30005555-orf-1

>SMED30005555-orf-1 ID=SMED30005555-orf-1|Name=SMED30005555-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MISECYLPQQVLTETRQGFFGKIYQKDIHYYRRECNAWSQVHERPSHPLF
SAKASKNFKIKLFVVYYFENPSAFKKCMVQKSHLNVKWRYNSKAWITSIF
FVEWINEVFGFTVKKYFLENNLPLKGLLVMDNAPDHPPGLEDDLLEKF*
back to top

protein sequence of SMED30005555-orf-2

>SMED30005555-orf-2 ID=SMED30005555-orf-2|Name=SMED30005555-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=153bp
MDQHVTSNFKKLYTKALFQRCVEVNEGTNLTLRKFWKNHFHTVNCLKIID
KAWNGVTKGTLNFAWRKLWSDCILRDNFEGLAHEEERSVIDEIVFLRKNM
GLEVNEDNIQELVEEHDQELTANELINLHCEQQQRFEEEISCEESEIKER
IL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004875DDE_SF_endonuclease_dom
IPR009057Homeobox-like_sf
IPR014721Ribosomal_S5_D2-typ_fold_subgr
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding