SMED30005554

Overview
NameSMED30005554
Smed IDSMED30005554
Length (bp)620
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005554 (SMED30005554) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005554 (SMED30005554) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005554 (SMED30005554) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005554 (SMED30005554) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005554

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 27

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v6_507_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30005554SMESG000016237.1 SmedASXL_018774SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005554SMESG000037127.1 SMESG000016240.1 SMESG000016239.1 SMESG000016238.1 SMESG000016237.1 Contig16615newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005554SMESG000037127.1 SMESG000016240.1 SMESG000016239.1 SMESG000016238.1 SMESG000016237.1 Contig16615uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005554SMESG000016237.1 Contig50994newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005554SMESG000016237.1 Contig50994uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005554SMESG000038252.1 Contig1813GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005554SMESG000016237.1 Contig1813GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30005554SMESG000016237.1 SMESG000033358.1 dd_Smed_v4_507_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005554 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002905:44485..45185 +2997
Homology
BLAST of SMED30005554 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0070639)

HSP 1 Score: 51.9878 bits (123), Expect = 1.358e-8
Identity = 34/68 (50.00%), Postives = 42/68 (61.76%), Query Frame = 2
Query:  254 IESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTA--LKHVETEEKSKLPTKEEIEAEK 451
            I +F+++ LKH ET EK  LPD E   + K   +  + IE   A  LKH ET EK+ LPTKE IEAEK
Sbjct:   60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127          

HSP 2 Score: 48.521 bits (114), Expect = 2.278e-7
Identity = 31/69 (44.93%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  251 EIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIE--KGTALKHVETEEKSKLPTKEEIEAEK 451
            ++E F++DKLK+  T EK +LP AE+    KT + +   I       LKH ET EK+ LP KE IE EK
Sbjct:   21 QLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEK 89          
BLAST of SMED30005554 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0070641)

HSP 1 Score: 51.9878 bits (123), Expect = 1.358e-8
Identity = 34/68 (50.00%), Postives = 42/68 (61.76%), Query Frame = 2
Query:  254 IESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTA--LKHVETEEKSKLPTKEEIEAEK 451
            I +F+++ LKH ET EK  LPD E   + K   +  + IE   A  LKH ET EK+ LPTKE IEAEK
Sbjct:   60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127          

HSP 2 Score: 48.521 bits (114), Expect = 2.278e-7
Identity = 31/69 (44.93%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  251 EIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIE--KGTALKHVETEEKSKLPTKEEIEAEK 451
            ++E F++DKLK+  T EK +LP AE+    KT + +   I       LKH ET EK+ LP KE IE EK
Sbjct:   21 QLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEK 89          
BLAST of SMED30005554 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0307206)

HSP 1 Score: 51.9878 bits (123), Expect = 1.358e-8
Identity = 34/68 (50.00%), Postives = 42/68 (61.76%), Query Frame = 2
Query:  254 IESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTA--LKHVETEEKSKLPTKEEIEAEK 451
            I +F+++ LKH ET EK  LPD E   + K   +  + IE   A  LKH ET EK+ LPTKE IEAEK
Sbjct:   60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127          

HSP 2 Score: 48.521 bits (114), Expect = 2.278e-7
Identity = 31/69 (44.93%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  251 EIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIE--KGTALKHVETEEKSKLPTKEEIEAEK 451
            ++E F++DKLK+  T EK +LP AE+    KT + +   I       LKH ET EK+ LP KE IE EK
Sbjct:   21 QLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEK 89          
BLAST of SMED30005554 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0343425)

HSP 1 Score: 51.9878 bits (123), Expect = 1.358e-8
Identity = 34/68 (50.00%), Postives = 42/68 (61.76%), Query Frame = 2
Query:  254 IESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTA--LKHVETEEKSKLPTKEEIEAEK 451
            I +F+++ LKH ET EK  LPD E   + K   +  + IE   A  LKH ET EK+ LPTKE IEAEK
Sbjct:   60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127          

HSP 2 Score: 48.521 bits (114), Expect = 2.278e-7
Identity = 31/69 (44.93%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  251 EIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIE--KGTALKHVETEEKSKLPTKEEIEAEK 451
            ++E F++DKLK+  T EK +LP AE+    KT + +   I       LKH ET EK+ LP KE IE EK
Sbjct:   21 QLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEK 89          
BLAST of SMED30005554 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0070640)

HSP 1 Score: 43.5134 bits (101), Expect = 8.052e-6
Identity = 27/63 (42.86%), Postives = 37/63 (58.73%), Query Frame = 2
Query:  251 EIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIE--KGTALKHVETEEKSKLPTKE 433
            ++E F++DKLK+  T EK +LP AE+    KT + +   I       LKH ET EK+ LP KE
Sbjct:   21 QLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTETNEKNPLPDKE 83          
BLAST of SMED30005554 vs. TrEMBL
Match: Q5BTJ4 (SJCHGC00690 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.545e-13
Identity = 44/83 (53.01%), Postives = 59/83 (71.08%), Query Frame = 2
Query:  203 VLI*EKMSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 451
            V + + M+D+ KV +++I+ FDK KL+HVET EK VLPD E   K KT K+L  EIE   +LKH  T+EK+ LPTK++I AEK
Sbjct:    7 VFVLQVMADAIKV-LEDIDGFDKQKLRHVETEEKVVLPDKEVIAKEKTEKQLLQEIETPPSLKHTSTKEKNPLPTKDDIVAEK 88          
BLAST of SMED30005554 vs. TrEMBL
Match: C1L942 (Putative beta thymosin OS=Schistosoma japonicum OX=6182 GN=EWB00_001724 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.081e-13
Identity = 43/77 (55.84%), Postives = 56/77 (72.73%), Query Frame = 2
Query:  221 MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 451
            M+D+ KV +++I+ FDK KL+HVET EK VLPD E   K KT K+L  EIE   +LKH  T+EK+ LPTK++I AEK
Sbjct:    1 MADAIKV-LEDIDGFDKQKLRHVETEEKVVLPDKEVIAKEKTEKQLLQEIETPPSLKHTSTKEKNPLPTKDDIVAEK 76          
BLAST of SMED30005554 vs. TrEMBL
Match: G4VAQ2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_025860 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 5.191e-12
Identity = 43/77 (55.84%), Postives = 56/77 (72.73%), Query Frame = 2
Query:  221 MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 451
            M+D+ KV +++I+SFDK KL+HVET EK VLP+ E   K KT K+L  EIE   +LK   T+EK+ LPTKE+I AEK
Sbjct:    1 MADAGKV-LEDIDSFDKQKLRHVETEEKVVLPNKEVIEKEKTEKQLLQEIETPHSLKRTSTKEKNPLPTKEDIAAEK 76          
BLAST of SMED30005554 vs. TrEMBL
Match: A0A183KGI4 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS14133 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.257e-11
Identity = 42/77 (54.55%), Postives = 55/77 (71.43%), Query Frame = 2
Query:  221 MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 451
            M+D+ KV +++I+ FDK KL+HVET EK VLP+ E   K KT K+L  EIE   +LK   T+EK+ LPTKE+I AEK
Sbjct:    1 MADAGKV-LEDIDGFDKQKLRHVETEEKVVLPNKEVIEKEKTEKQLLQEIETPHSLKRTSTKEKNPLPTKEDIAAEK 76          
BLAST of SMED30005554 vs. TrEMBL
Match: A0A183LA02 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS627 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.257e-11
Identity = 42/77 (54.55%), Postives = 55/77 (71.43%), Query Frame = 2
Query:  221 MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 451
            M+D+ KV +++I+ FDK KL+HVET EK VLP+ E   K KT K+L  EIE   +LK   T+EK+ LPTKE+I AEK
Sbjct:    1 MADAGKV-LEDIDGFDKQKLRHVETEEKVVLPNKEVIEKEKTEKQLLQEIETPHSLKRTSTKEKNPLPTKEDIAAEK 76          
BLAST of SMED30005554 vs. Ensembl Nematostella
Match: EDO48924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW3])

HSP 1 Score: 55.4546 bits (132), Expect = 2.193e-9
Identity = 36/78 (46.15%), Postives = 49/78 (62.82%), Query Frame = 2
Query:  239 VPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKEL--HSEIEK--GTALKHVETEEKSKLPTKEEIEAEKLNA 460
             P   +E F K+KLKHVET+EK  LPDA+        + L   SE+ K   + LKHVET+EK  +PTK+ IEAE +++
Sbjct:   84 APFSGVEVFQKNKLKHVETLEKNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVETKEKVVMPTKDVIEAEAIDS 161          

HSP 2 Score: 46.595 bits (109), Expect = 2.267e-6
Identity = 33/84 (39.29%), Postives = 44/84 (52.38%), Query Frame = 2
Query:  221 MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIE----KGTALKHVETEEKSKLPTKEEIEAEKLNA 460
            MS  +K  + E+  FD   LKHV+T EK  LP  E   +     E     E    + + L+HVET+EK+ LPTK+ I  EK  A
Sbjct:    1 MSQGSKPDVSEVAKFDAANLKHVQTKEKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPTKDTIADEKRTA 84          

HSP 3 Score: 45.8246 bits (107), Expect = 3.714e-6
Identity = 31/74 (41.89%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  251 EIESFDKDKLKHVETVEKEVLPDAEEFNK--IKTGKELHSEIEK--GTALKHVETEEKSKLPTKEEIEAEKLNA 460
            E++SFD  KLKHV T EK  LP  +  ++  I   K   SE+     T LKHV T+EKS +P++E+I+ E +++
Sbjct:  164 EVKSFDHSKLKHVVTQEKNPLPTPQTLHEELIPKNKPDRSEVASFDHTKLKHVTTQEKSIMPSQEDIKEEAVDS 237          
BLAST of SMED30005554 vs. Planmine SMEST
Match: SMESG000016237.1 (SMESG000016237.1)

HSP 1 Score: 153.68 bits (387), Expect = 1.233e-48
Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 2
Query:  221 MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEKLNAD 463
            MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEKLNAD
Sbjct:    1 MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEKLNAD 81          
BLAST of SMED30005554 vs. Planmine SMEST
Match: SMESG000025889.1 (SMESG000025889.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.339e-15
Identity = 39/69 (56.52%), Postives = 50/69 (72.46%), Query Frame = 2
Query:  245 IDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 451
            ++E+  F KDKLKHVE +EK VLPD +   + KT +EL  EIEKG  LKHVET EK+ LP K++I+ EK
Sbjct:   15 VNEVHDFPKDKLKHVEALEKVVLPDNDTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEK 83          

HSP 2 Score: 46.9802 bits (110), Expect = 7.418e-7
Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 2
Query:  275 KLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEKLN 457
            KLKHVET EK VLP+ ++  K K   +L SEI K   L+ V TE K +LP++ +IE EK N
Sbjct:   61 KLKHVETTEKTVLPNKDDIKKEKQEVQLLSEITKEHELRPVTTEVKQRLPSQIDIEEEKNN 121          
BLAST of SMED30005554 vs. Planmine SMEST
Match: SMESG000025888.1 (SMESG000025888.1)

HSP 1 Score: 46.2098 bits (108), Expect = 2.142e-6
Identity = 30/58 (51.72%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  278 LKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 451
            LKH  T+EK VLP+  +  K K   EL+SEI KG  L  V+TE K  LPTKE++  EK
Sbjct:   86 LKHTNTMEKVVLPNQHDIAKEKRESELNSEIVKGKQLNPVKTEVKVVLPTKEDLLHEK 143          

HSP 2 Score: 45.8246 bits (107), Expect = 2.744e-6
Identity = 37/107 (34.58%), Postives = 49/107 (45.79%), Query Frame = 2
Query:  221 MSDSTKVPI-DEIESFDKDKLKHVE-----------------------------TVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEK 451
            MS   K P+  E+ SF+KDKL+HV+                             T EK +LP+ +   + KT  +L  EIEKG  LKH  T EK  LP + +I  EK
Sbjct:    1 MSKPNKSPVAREVHSFEKDKLRHVDPIVKEVIEKEKKKDIHSEIKKEKKLKQTNTKEKIILPNQDMIEQEKTEIQLRDEIEKGKPLKHTNTMEKVVLPNQHDIAKEK 107          
The following BLAST results are available for this feature:
BLAST of SMED30005554 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cib1.358e-850.00gene:FBgn0026084 transcript:FBtr0070639[more]
cib1.358e-850.00gene:FBgn0026084 transcript:FBtr0070641[more]
cib1.358e-850.00gene:FBgn0026084 transcript:FBtr0307206[more]
cib1.358e-850.00gene:FBgn0026084 transcript:FBtr0343425[more]
cib8.052e-642.86gene:FBgn0026084 transcript:FBtr0070640[more]
back to top
BLAST of SMED30005554 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5BTJ41.545e-1353.01SJCHGC00690 protein (Fragment) OS=Schistosoma japo... [more]
C1L9427.081e-1355.84Putative beta thymosin OS=Schistosoma japonicum OX... [more]
G4VAQ25.191e-1255.84Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183KGI42.257e-1154.55Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A183LA022.257e-1154.55Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of SMED30005554 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489242.193e-946.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30005554 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005554 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000016237.11.233e-48100.00SMESG000016237.1[more]
SMESG000025889.11.339e-1556.52SMESG000025889.1[more]
SMESG000025888.12.142e-651.72SMESG000025888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005554 ID=SMED30005554|Name=SMED30005554|organism=Schmidtea mediterranea sexual|type=transcript|length=620bp
TCATAAAAAAAACGTAATAACAACAACATTTTGTATTTTGAATGGCAATG
AATTCAGACTGAAAGCAGCAATTGACTCACTCAATCAATCTTTTGCTGAG
ATTGGCTGCACACCGATCAGTCGACCAATCAGATTCATCCGAGGGCAGGA
AAGCCCACATACACACAACACGAACAAAGAGAATAAAAACTTTTTGCTTT
GTGTATTGATTTGAGAAAAAATGTCGGACAGCACGAAAGTTCCCATTGAT
GAAATTGAGTCATTTGATAAAGATAAACTGAAGCATGTGGAAACCGTGGA
GAAAGAAGTTCTGCCTGATGCAGAGGAATTCAATAAAATTAAAACTGGGA
AAGAATTGCATAGCGAAATCGAAAAAGGAACGGCTTTGAAGCATGTGGAA
ACTGAAGAGAAAAGTAAATTGCCAACAAAAGAAGAAATTGAAGCAGAAAA
ATTGAATGCCGATTGAAAACTTGCATAAATTTATCCACAAAATGGCCGTT
TATTTATAATTTAAGTTTGAATTAAGTAGCAAATTGCTCGTTATTAGTTG
TGAAATGACTGATTTTGTTTTGGTTTGTTCTGTTTGAATATAATGCATAT
TTTTTGTTTTTAAAAAAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
PLANA:0000478pharynx musculature
PLANA:0000484secretory system
PLANA:0002109X1 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR038386Beta-thymosin_sf
IPR001152Beta-thymosin
IPR003124WH2_dom
Vocabulary: molecular function
TermDefinition
GO:0003785actin monomer binding
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001152Beta-thymosinSMARTSM00152THY_2coord: 9..45
e-value: 9.8E-7
score: 38.4
coord: 47..81
e-value: 1.6
score: 9.8
IPR001152Beta-thymosinPFAMPF01290Thymosincoord: 7..39
e-value: 8.4E-11
score: 41.4
coord: 48..77
e-value: 2.6E-8
score: 33.4
IPR038386Beta-thymosin superfamilyGENE3DG3DSA:1.20.5.520coord: 46..78
e-value: 3.9E-8
score: 34.7
coord: 4..42
e-value: 1.6E-11
score: 45.6
IPR003124WH2 domainPFAMPF02205WH2coord: 48..65
e-value: 0.028
score: 14.3
coord: 11..29
e-value: 0.069
score: 13.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 56..81
NoneNo IPR availablePANTHERPTHR20940TETRA THYMOSINcoord: 6..77