Thioredoxin domain-containing protein 3-like

Overview
NameThioredoxin domain-containing protein 3-like
Smed IDSMED30005553
Uniprot Best hitThioredoxin domain-containing protein 3 homolog OS=Ciona intestinalis OX=7719 GN=CiIC3 PE=2 SV=1 (E=0)
Length (bp)3159
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005553

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005553SMESG000043677.1 SmedASXL_002659SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005553SMESG000043677.1 SmedASXL_007848SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005553 SmedASXL_007849SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005553SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005553SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005553SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005553SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30005553SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30005553SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005553SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005553SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005553SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005553SMESG000043677.1 dd_Smed_v6_8026_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005553SMESG000043677.1 dd_Smed_v6_8401_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005553 dd_Smed_v6_18787_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005553SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30005553SMESG000043677.1 dd_Smed_v4_8401_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005553SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30005553SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30005553SMESG000043677.1 dd_Smed_v4_8026_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME8 (NME/NM23 family member 8 [Source:HGNC Symbol;Acc:HGNC:16473])

HSP 1 Score: 357.066 bits (915), Expect = 1.582e-110
Identity = 206/599 (34.39%), Postives = 340/599 (56.76%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIH-----------------------EFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            MA KK+E+ LQ  IN Q  WDE+++ +GL V+DVYQ WCGPC+A+   FR++KNE+ +D  L+FAVA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K+  GEM R +  +  L D  +D +V E +   E ++   ++A+IKPD V + KV EI  K+ + G  I A+    LT E+   FY  +AD   FE+ + F+ SG S ILV+++G     H                       E    + P  +    +N   S++       +       +D     + +  FFPDF        K ++  +++TLAL+RP  + E ++ +L  I +  FK+  Q++V L+++EA     +++++ +F +LI+ M+ G  LAL L + N +Q W+ +LGP+ VE+A E  P SL AQF+ + + VN ++GSDS ETAE E+++FFP++ T+  IKP    E  E+I   + +A F + ++K++ +     E+ Y   + ++++ DL+  +  GP+  M+L++ +A+  WR L+GP DP+ A+   PDSIRA +G    KN V+G+ N  E + V+N +F
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVD--SDSEVSE-ESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSK---HNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMM----KNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPDFK-------KMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLF 582          

HSP 2 Score: 78.5666 bits (192), Expect = 3.220e-14
Identity = 48/151 (31.79%), Postives = 85/151 (56.29%), Query Frame = 3
Query:  504 LEEIEREV--------TLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 932
            LE  ERE+        TL LIKP      + ++I+  ++E G ++   +   LT E+ ++ Y  +   + ++DL++ ++ GPS +++L K +A  + E+R L+GP   +EAK  SP SIRA +G + ++N +HGA +   A+  +   F D
Sbjct:  437 LETAEREIQHFFPLQSTLGLIKPHATSEQR-EQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNA--VAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFED 584          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME8 (NME/NM23 family member 8 [Source:HGNC Symbol;Acc:HGNC:16473])

HSP 1 Score: 357.066 bits (915), Expect = 1.582e-110
Identity = 206/599 (34.39%), Postives = 340/599 (56.76%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIH-----------------------EFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            MA KK+E+ LQ  IN Q  WDE+++ +GL V+DVYQ WCGPC+A+   FR++KNE+ +D  L+FAVA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K+  GEM R +  +  L D  +D +V E +   E ++   ++A+IKPD V + KV EI  K+ + G  I A+    LT E+   FY  +AD   FE+ + F+ SG S ILV+++G     H                       E    + P  +    +N   S++       +       +D     + +  FFPDF        K ++  +++TLAL+RP  + E ++ +L  I +  FK+  Q++V L+++EA     +++++ +F +LI+ M+ G  LAL L + N +Q W+ +LGP+ VE+A E  P SL AQF+ + + VN ++GSDS ETAE E+++FFP++ T+  IKP    E  E+I   + +A F + ++K++ +     E+ Y   + ++++ DL+  +  GP+  M+L++ +A+  WR L+GP DP+ A+   PDSIRA +G    KN V+G+ N  E + V+N +F
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVD--SDSEVSE-ESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSK---HNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMM----KNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPDFK-------KMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLF 582          

HSP 2 Score: 78.5666 bits (192), Expect = 3.220e-14
Identity = 48/151 (31.79%), Postives = 85/151 (56.29%), Query Frame = 3
Query:  504 LEEIEREV--------TLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 932
            LE  ERE+        TL LIKP      + ++I+  ++E G ++   +   LT E+ ++ Y  +   + ++DL++ ++ GPS +++L K +A  + E+R L+GP   +EAK  SP SIRA +G + ++N +HGA +   A+  +   F D
Sbjct:  437 LETAEREIQHFFPLQSTLGLIKPHATSEQR-EQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNA--VAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFED 584          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 274.633 bits (701), Expect = 3.543e-83
Identity = 144/300 (48.00%), Postives = 195/300 (65.00%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEV-----DKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            M  +K+EIALQ  I+TQE W+E++  +GL VVDVYQ WCGPCK V++ F++++ E+G D L+FA+A+AD +D LEKYRG+CEP FL Y G  LV V+RGAN P+L+ TI  +LE E KV+    ER   KD  L+D   DE V        D+D+   ER  TLA+IKPD V  GK DEII K+QE G EIL  ++R +T  E + FY H A  E FE L+  + SGPS +L+L +  G   ++  +R ++GP+  + A+   P+S+RA YGT    NA+HG+ DR+ A RELA  FP  
Sbjct:    1 MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKVIKDEALSD--EDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSL 298          

HSP 2 Score: 105.916 bits (263), Expect = 4.787e-24
Identity = 53/149 (35.57%), Postives = 91/149 (61.07%), Query Frame = 3
Query: 1392 TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPE 1820
            T+A IKPD + +   +EI  KI +A F+I+  +  TM ++    FY  ++ +E F  L+ HM SGP++ ++L+R    ED +  WR+++GP+DP  A    P+S+RA YG ++  NAV+GS +  +  R + L+F  L+F++  +  P+
Sbjct:  161 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKDTEAPQ 309          

HSP 3 Score: 83.5741 bits (205), Expect = 1.908e-16
Identity = 48/137 (35.04%), Postives = 73/137 (53.28%), Query Frame = 3
Query:  987 TLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            TLA+++P A    + + I+ KI  AGF++   +E  +T+ E  LFY     +  FE+L+  M  G    L L +    ++ V  WR ++GP+D   A+   P SLRAQ+  E +  N +HGS   E A+ EL   FP
Sbjct:  161 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTE-MPFNAVHGSRDREDADRELALLFP 296          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 209.149 bits (531), Expect = 1.781e-60
Identity = 112/278 (40.29%), Postives = 154/278 (55.40%), Query Frame = 3
Query:  123 LIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEV-----DKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            ++  +GL VVDVYQ WCGPCK V++ F++++ E+G D L+FA+A+AD +D LEKYRG+CEP FL Y                                         KD  L+D   DE V        D+D+   ER  TLA+IKPD V  GK DEII K+QE G EIL  ++R +T  E + FY H A  E FE L+  + SGPS +L+L +  G   ++  +R ++GP+  + A+   P+S+RA YGT    NA+HG+ DR+ A RELA  FP  
Sbjct:    1 MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYA---------------------------------------IKDEALSD--EDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSL 237          

HSP 2 Score: 106.301 bits (264), Expect = 1.172e-24
Identity = 54/151 (35.76%), Postives = 92/151 (60.93%), Query Frame = 3
Query: 1392 TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYE 1826
            T+A IKPD + +   +EI  KI +A F+I+  +  TM ++    FY  ++ +E F  L+ HM SGP++ ++L+R    ED +  WR+++GP+DP  A    P+S+RA YG ++  NAV+GS +  +  R + L+F  L+F++  +  P+ E
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKDTEAPQGE 250          

HSP 3 Score: 83.9593 bits (206), Expect = 4.920e-17
Identity = 48/137 (35.04%), Postives = 73/137 (53.28%), Query Frame = 3
Query:  987 TLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            TLA+++P A    + + I+ KI  AGF++   +E  +T+ E  LFY     +  FE+L+  M  G    L L +    ++ V  WR ++GP+D   A+   P SLRAQ+  E +  N +HGS   E A+ EL   FP
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTE-MPFNAVHGSRDREDADRELALLFP 235          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 209.149 bits (531), Expect = 1.781e-60
Identity = 112/278 (40.29%), Postives = 154/278 (55.40%), Query Frame = 3
Query:  123 LIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEV-----DKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            ++  +GL VVDVYQ WCGPCK V++ F++++ E+G D L+FA+A+AD +D LEKYRG+CEP FL Y                                         KD  L+D   DE V        D+D+   ER  TLA+IKPD V  GK DEII K+QE G EIL  ++R +T  E + FY H A  E FE L+  + SGPS +L+L +  G   ++  +R ++GP+  + A+   P+S+RA YGT    NA+HG+ DR+ A RELA  FP  
Sbjct:    1 MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYA---------------------------------------IKDEALSD--EDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSL 237          

HSP 2 Score: 106.301 bits (264), Expect = 1.172e-24
Identity = 54/151 (35.76%), Postives = 92/151 (60.93%), Query Frame = 3
Query: 1392 TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYE 1826
            T+A IKPD + +   +EI  KI +A F+I+  +  TM ++    FY  ++ +E F  L+ HM SGP++ ++L+R    ED +  WR+++GP+DP  A    P+S+RA YG ++  NAV+GS +  +  R + L+F  L+F++  +  P+ E
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKDTEAPQGE 250          

HSP 3 Score: 83.9593 bits (206), Expect = 4.920e-17
Identity = 48/137 (35.04%), Postives = 73/137 (53.28%), Query Frame = 3
Query:  987 TLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            TLA+++P A    + + I+ KI  AGF++   +E  +T+ E  LFY     +  FE+L+  M  G    L L +    ++ V  WR ++GP+D   A+   P SLRAQ+  E +  N +HGS   E A+ EL   FP
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTE-MPFNAVHGSRDREDADRELALLFP 235          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 70.0922 bits (170), Expect = 8.992e-14
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 3
Query:  972 SNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1379
            SN +RT   ++P   +      I+ +    G+K+   K++  +K    + Y   KDKPFF  LI+ MS G ++A+  +  + V+  R MLG  +   +    P ++R  F  +  + N+ HGSD+ ++A  E+ ++F
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGR-NICHGSDAVDSANREIAHWF 134          

HSP 2 Score: 69.3218 bits (168), Expect = 1.853e-13
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1808
            E+T  AIKPDG+      +I  +  +  +K+V +K++T  K+  E  Y D   + +F  LI +M SGP   MV    D ++  RS++G  +P  +    P +IR  +     +N  +GSD      R +   F + E N+  S
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYAS 144          

HSP 3 Score: 68.9366 bits (167), Expect = 2.751e-13
Identity = 40/135 (29.63%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 926
            E T   IKPD V  G V +IIA+ +E G +++A +    +    +  Y  + D   F  LI++++SGP   +V    D  ++ + R ++G         ++P +IR  +   +  N  HG+D  D+A RE+A +F
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLD--VVKQGRSMLGAT---NPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 70.0922 bits (170), Expect = 8.992e-14
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 3
Query:  972 SNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1379
            SN +RT   ++P   +      I+ +    G+K+   K++  +K    + Y   KDKPFF  LI+ MS G ++A+  +  + V+  R MLG  +   +    P ++R  F  +  + N+ HGSD+ ++A  E+ ++F
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGR-NICHGSDAVDSANREIAHWF 134          

HSP 2 Score: 69.3218 bits (168), Expect = 1.853e-13
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1808
            E+T  AIKPDG+      +I  +  +  +K+V +K++T  K+  E  Y D   + +F  LI +M SGP   MV    D ++  RS++G  +P  +    P +IR  +     +N  +GSD      R +   F + E N+  S
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYAS 144          

HSP 3 Score: 68.9366 bits (167), Expect = 2.751e-13
Identity = 40/135 (29.63%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 926
            E T   IKPD V  G V +IIA+ +E G +++A +    +    +  Y  + D   F  LI++++SGP   +V    D  ++ + R ++G         ++P +IR  +   +  N  HG+D  D+A RE+A +F
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLD--VVKQGRSMLGAT---NPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 70.0922 bits (170), Expect = 8.992e-14
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 3
Query:  972 SNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1379
            SN +RT   ++P   +      I+ +    G+K+   K++  +K    + Y   KDKPFF  LI+ MS G ++A+  +  + V+  R MLG  +   +    P ++R  F  +  + N+ HGSD+ ++A  E+ ++F
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGR-NICHGSDAVDSANREIAHWF 134          

HSP 2 Score: 69.3218 bits (168), Expect = 1.853e-13
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1808
            E+T  AIKPDG+      +I  +  +  +K+V +K++T  K+  E  Y D   + +F  LI +M SGP   MV    D ++  RS++G  +P  +    P +IR  +     +N  +GSD      R +   F + E N+  S
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYAS 144          

HSP 3 Score: 68.9366 bits (167), Expect = 2.751e-13
Identity = 40/135 (29.63%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 926
            E T   IKPD V  G V +IIA+ +E G +++A +    +    +  Y  + D   F  LI++++SGP   +V    D  ++ + R ++G         ++P +IR  +   +  N  HG+D  D+A RE+A +F
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLD--VVKQGRSMLGAT---NPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 70.0922 bits (170), Expect = 8.992e-14
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 3
Query:  972 SNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1379
            SN +RT   ++P   +      I+ +    G+K+   K++  +K    + Y   KDKPFF  LI+ MS G ++A+  +  + V+  R MLG  +   +    P ++R  F  +  + N+ HGSD+ ++A  E+ ++F
Sbjct:    2 SNTERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGR-NICHGSDAVDSANREIAHWF 134          

HSP 2 Score: 69.3218 bits (168), Expect = 1.853e-13
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1808
            E+T  AIKPDG+      +I  +  +  +K+V +K++T  K+  E  Y D   + +F  LI +M SGP   MV    D ++  RS++G  +P  +    P +IR  +     +N  +GSD      R +   F + E N+  S
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLASA---PGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEINDYAS 144          

HSP 3 Score: 68.9366 bits (167), Expect = 2.751e-13
Identity = 40/135 (29.63%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 926
            E T   IKPD V  G V +IIA+ +E G +++A +    +    +  Y  + D   F  LI++++SGP   +V    D  ++ + R ++G         ++P +IR  +   +  N  HG+D  D+A RE+A +F
Sbjct:    5 ERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLD--VVKQGRSMLGAT---NPLASAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Match: Y48G8AL.15 (pep chromosome:WBcel235:I:1254770:1258258:1 gene:WBGene00021692.1 transcript:Y48G8AL.15.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G8AL.15)

HSP 1 Score: 52.373 bits (124), Expect = 9.802e-8
Identity = 39/132 (29.55%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  531 LALIKPDIVKAGKVDEI-IAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFF 923
            L ++KP+IV    + ++ +++L+ NGIEI   +   ++   AK+ Y        ++ L++ I+SGP  I +   G+A      R+ IG   L    E + Q IR  +  + + N  H A D D A++EL  F
Sbjct:   13 LVVLKPEIVAHRVLAQVALSELRSNGIEIEEMRQMKISGSLAKQLYAQHQGKFFYDRLVRHISSGPV-IAMRVSGNA------RKCIGSSRLWPRLEPTVQPIRQRFALSDVRNVAH-ASDEDAAEKELQLF 136          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: CG18130 (gene:FBgn0030359 transcript:FBtr0073581)

HSP 1 Score: 98.2117 bits (243), Expect = 1.441e-20
Identity = 41/103 (39.81%), Postives = 69/103 (66.99%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPP 365
            MA+K  +  LQA+I T EE +  +++ GLLV+DVY +WCGPC+ ++   R++K ++G D L+ A+ K+DTI +L+++  R EP +L   G   V ++ G++ P
Sbjct:    1 MAKKGGQQQLQADIQTDEELERFMERPGLLVLDVYSEWCGPCQGMVGSLRKIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGSDVP 103          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: nmdyn-D6 (gene:FBgn0030573 transcript:FBtr0073933)

HSP 1 Score: 88.5817 bits (218), Expect = 3.987e-20
Identity = 50/133 (37.59%), Postives = 72/133 (54.14%), Query Frame = 3
Query:  987 TLALVRPAAY-TEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            TLAL++P      Y    +  + +  F +  QKEV +TKE +  FY +HK K F+  L   M+ G   AL L+ +  +Q WR +LGP  V +A   DPN +RA +   D + N  HGSDS+ +A  E+   FP
Sbjct:    4 TLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTR-NACHGSDSEASALREISILFP 135          

HSP 2 Score: 88.5817 bits (218), Expect = 4.885e-20
Identity = 45/138 (32.61%), Postives = 80/138 (57.97%), Query Frame = 3
Query: 1383 VEQTIAAIKPDGIENEEEI--FNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLE 1790
            +E T+A IKP  + N   +     ++   F I+  K + + K L+E FY++   + +++ L + M SGP+Y ++L  E  I+ WRSL+GP     A  + P+ IRA+YG    +NA +GSD+E+   R ++++F + +
Sbjct:    1 MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILFPEFD 138          

HSP 3 Score: 84.3445 bits (207), Expect = 1.320e-18
Identity = 48/138 (34.78%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            E+TLALIKP +++     + I  L      IL Q++  +T E ++ FY        +  L  F+ SGPS  L+L       I ++R L+GP  +  A  + P  IRA+YG +   NA HG+D   +A RE++  FP+F
Sbjct:    2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETC--IQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILFPEF 137          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: CG14221 (gene:FBgn0031042 transcript:FBtr0332485)

HSP 1 Score: 85.1149 bits (209), Expect = 1.288e-16
Identity = 34/103 (33.01%), Postives = 64/103 (62.14%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPP 365
            MA+K     LQA++ + EE+++ +++ GLLV+D+Y +WCGPC  ++   R++K E+G D L  A+ KA +I  L+++  + EP ++       + ++ G + P
Sbjct:    1 MAKKGGVQQLQADLASDEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKAGSISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVP 103          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346150)

HSP 1 Score: 68.9366 bits (167), Expect = 4.050e-13
Identity = 39/138 (28.26%), Postives = 70/138 (50.72%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEF 1793
            E+T   +KPDG++     +I  +     FK+V +K     K L E+ Y+D S + +F  L+ +M SGP   MV    + ++  R ++G  +P    D+ P +IR  +   + +N ++GSD     ++ + L F + E 
Sbjct:   21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPA---DSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKEL 155          

HSP 2 Score: 65.0846 bits (157), Expect = 9.607e-12
Identity = 42/138 (30.43%), Postives = 68/138 (49.28%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1379
            A+N +RT  +V+P          I+E+    GFK+   K    +KE     Y     +PFF  L+  M+ G ++ +  E  N V+  R MLG  +   +    P ++R  F  + +  N+IHGSD+ E+AE E+  +F
Sbjct:   17 AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSL---PGTIRGDFCIQ-VGRNIIHGSDAVESAEKEIALWF 150          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0339146)

HSP 1 Score: 68.9366 bits (167), Expect = 4.050e-13
Identity = 39/138 (28.26%), Postives = 70/138 (50.72%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEF 1793
            E+T   +KPDG++     +I  +     FK+V +K     K L E+ Y+D S + +F  L+ +M SGP   MV    + ++  R ++G  +P    D+ P +IR  +   + +N ++GSD     ++ + L F + E 
Sbjct:   21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPA---DSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKEL 155          

HSP 2 Score: 65.0846 bits (157), Expect = 9.607e-12
Identity = 42/138 (30.43%), Postives = 68/138 (49.28%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1379
            A+N +RT  +V+P          I+E+    GFK+   K    +KE     Y     +PFF  L+  M+ G ++ +  E  N V+  R MLG  +   +    P ++R  F  + +  N+IHGSD+ E+AE E+  +F
Sbjct:   17 AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSL---PGTIRGDFCIQ-VGRNIIHGSDAVESAEKEIALWF 150          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme8 (NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE-070410-39])

HSP 1 Score: 455.292 bits (1170), Expect = 8.163e-149
Identity = 244/517 (47.20%), Postives = 344/517 (66.54%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEE----------IEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHM 1571
            MA KK+EI+LQ  IN  E+W E +  +GLLVVDVYQ WCGPC+AV+  FR++KNE+GD+ L+FA A+AD I++LE YRG+CEP FL Y G  LV V+RG N P+L+ TI+ +L  E  V++    R   KD  L + E      EV+ D E+           ++  T+A+IKPD+V  GK DEII K+Q+ G  ILA ++R LT  EA++FY H A    F++L++F++SGPS +LV++K  G   +I  +RE IGP  ++EA+   P+S+RA YG+ S+ N +HG+ DR+ A RELAFFFP+F    +   + E   V+RTLALVRP A  E RE IL +I  AGF+VAMQKE+ LT+E+  LFY+ H ++ +F  L++ M+ G +LALAL K+ AV+ WR +LGPKD  KAK   P+SLRAQFS E+  +N +HGS S E AE E+ +FFP E T+A IKPD  +++EEI  +I    F I ++K   + + +AEEFY +   + +F+ L+ +M
Sbjct:    1 MAAKKKEISLQININNDEQWSEALALKGLLVVDVYQQWCGPCRAVVGLFRKIKNELGDELLHFATAEADGIEALEMYRGKCEPTFLFYAGGELVSVLRGPNAPLLQKTIQEELSNEKNVLEHGGARRAVKDEGLTEEE------EVNDDTEDHPHDEDVTVPTDKSYTVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFPNFSF-SVWDSRPEEEPVERTLALVRPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSINQLHGSSSSEEAEKEISFFFPPEDTLAVIKPD-TQHKEEILEEIQAQGFTISQLKDTILSREMAEEFYKEHREKPFFSQLVDYM 509          

HSP 2 Score: 169.088 bits (427), Expect = 5.879e-44
Identity = 93/259 (35.91%), Postives = 145/259 (55.98%), Query Frame = 3
Query:  987 TLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP---------------VEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIY 1700
            T+A+++P      + + I+ KI +AGF +   +E  LT+ EA  FY     +P+F+EL++ MS G    L + K    ++ +  WR  +GP DVE+A+   P SLRAQ+  E + +N +HGS   E A  EL +FFP               VE+T+A ++PD   EN EEI ++I  A F++   K + + +     FYS    +EYFN L+ +M SG    + L +E A+  WR+++GPKDP  A++  PDS+RA +
Sbjct:  162 TVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESL-LNGLHGSSDRERASRELAFFFPNFSFSVWDSRPEEEPVERTLALVRPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQF 419          

HSP 3 Score: 112.849 bits (281), Expect = 2.232e-25
Identity = 73/224 (32.59%), Postives = 128/224 (57.14%), Query Frame = 3
Query:  507 EEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGT-NSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSK 1175
            E +ER  TLAL++PD  +  + +EI++++++ G  +  Q++  LT E+ + FY    + E F  L++ + SG   +L LA    G +  +R ++GPK   +AK   P S+RA +   NS  N +HG+   + A++E++FFFP                 + TLA+++P   T+++E ILE+I   GF ++  K+  L++E A  FY +H++KPFF +L+  M +
Sbjct:  311 EPVER--TLALVRPDAARENR-EEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSG--LVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSINQLHGSSSSEEAEKEISFFFPP----------------EDTLAVIKPD--TQHKEEILEEIQAQGFTISQLKDTILSREMAEEFYKEHREKPFFSQLVDYMCR 511          

HSP 4 Score: 96.6709 bits (239), Expect = 3.553e-20
Identity = 55/162 (33.95%), Postives = 86/162 (53.09%), Query Frame = 3
Query: 1329 HGSDSDETAETELKYFFPVEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1796
            H  D D T  T+  Y      T+A IKPD + +   +EI  KI DA F I+  +  T+ ++ A++FY  ++ + YF +L+  M SGP++ +V+S+    ED I  WR  IGP D + A    P+S+RA YG +   N ++GS +     R +   F    F+
Sbjct:  147 HPHDEDVTVPTDKSY------TVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFPNFSFS 302          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme7 (NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE-000210-35])

HSP 1 Score: 142.124 bits (357), Expect = 4.589e-36
Identity = 90/275 (32.73%), Postives = 145/275 (52.73%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEF---YSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1739
             S  +RTLA+++P A ++  + I++ I +A   V   K  +LT ++AA FY +H+ K FF  L++ +S G ++A+ L    AV  WR +LGP D   A++   +SLR QF  +  K N  HGSDS  +A  EL+YFFP              + T   IKP  I      +I   I++  F+I  ++   M+++ AEEF   Y     +  +  ++  + SGP   + +   DA R +R   GP DP+ A    P ++RA+YG++  +N V+ +D
Sbjct:   86 GSKKERTLAMIKPDAVSKVGD-IIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTK-NAGHGSDSLASAARELEYFFPSTAGHGLSNTAKYSDCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYKGVVAE--YTKMVDELCSGPCMALEIHATDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQNGVHCTD 356          

HSP 2 Score: 131.724 bits (330), Expect = 1.274e-32
Identity = 85/296 (28.72%), Postives = 154/296 (52.03%), Query Frame = 3
Query:  516 EREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQR----TLALVRPAAYTEYRES-ILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1385
            ++E TLA+IKPD V   KV +II  + +  + +   +   LT ++A +FY        F +L++F++SGP   + L   +A  +  +R+++GP     A++ +  S+R  +GT+  +NA HG+D   +A REL +FFP       +   H  SN  +    T  +++P A +E     IL+ I   GF+++  +   + +  A  F   +K     + +++ E+  G  +AL +   +A + +R   GP D E A+ + P +LRA + K  ++ N +H +D  E    E++YFF +
Sbjct:   88 KKERTLAMIKPDAVS--KVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEA--VSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFFP-------STAGHGLSNTAKYSDCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYKGVVAEYTKMVDELCSGPCMALEIHATDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQ-NGVHCTDLPEDGILEVQYFFKI 371          

HSP 3 Score: 88.1965 bits (217), Expect = 6.230e-18
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T+A IKPD +    +I   I DA   + K K   +    A +FY +   + +FN+L+  + SGP   M L  ++A+  WR ++GP D   A+     S+R  +G D  KNA +GSD+ +   R +   F
Sbjct:   90 ERTLAMIKPDAVSKVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFF 220          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme5 (NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE-040718-221])

HSP 1 Score: 101.679 bits (252), Expect = 1.170e-23
Identity = 51/135 (37.78%), Postives = 83/135 (61.48%), Query Frame = 3
Query:  978 VQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            V+RTLAL++P A  +  E I + I  +GF +  ++ +QL+ E+ + FY +H  K  F  L   MS G ++ALAL +  A+  W+ ++GP    KA+E  P+ LRA+F   D++ N +HGS++   AE E+++ FP
Sbjct:   22 VERTLALIKPDAIHKTDE-IEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLR-NAVHGSETFSAAEREIRFMFP 154          

HSP 2 Score: 98.9821 bits (245), Expect = 8.016e-23
Identity = 47/132 (35.61%), Postives = 79/132 (59.85%), Query Frame = 3
Query: 1383 VEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            VE+T+A IKPD I   +EI + IL + F I++ +R+ +      +FY++   + +F  L A M SGP   + L+R+ AI  W++++GP     A +T+PD +RA +G    +NAV+GS+  S  +R +  +F
Sbjct:   22 VERTLALIKPDAIHKTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMF 153          

HSP 3 Score: 87.0409 bits (214), Expect = 1.059e-18
Identity = 51/143 (35.66%), Postives = 79/143 (55.24%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKI 950
            E TLALIKPD +   K DEI   + ++G  IL ++   L+ E+  +FY        F  L  F++SGP   L LA+  A  I  ++ ++GP    +A+E  P  +RA +GT  + NA+HG++    A+RE+ F FP  ++  I
Sbjct:   23 ERTLALIKPDAIH--KTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQA--IATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMFPHSVIEPI 161          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 91.6633 bits (226), Expect = 9.403e-21
Identity = 47/138 (34.06%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  978 VQRTLALVRPAAYTEYRESILEKINNA---GFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            +Q TLA+++P A       ILE ++      F +  +K++   K ++ +FY +H  + FF+ L++ MS G + A  L +++A+  WR M+GP  V +A+   P +LR ++   D + N  HGSDS E+A+ E+ +FFP
Sbjct:    7 LQLTLAVIKPDAMAH--PLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTR-NTTHGSDSIESAKREISFFFP 141          

HSP 2 Score: 90.1225 bits (222), Expect = 2.741e-20
Identity = 48/139 (34.53%), Postives = 86/139 (61.87%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEII-AKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            ++TLA+IKPD +    + E +  K+ EN I I+ ++D      +++ FY   +    F+ L++F++SGP +  +LA+ DA  I  +R ++GP  +  A+ +SP+++R  YG     N  HG+D  ++A+RE++FFFP+F
Sbjct:    8 QLTLAVIKPDAMAHPLILEALHQKILENFI-IIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDA--ITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFFPEF 143          

HSP 3 Score: 86.2705 bits (212), Expect = 6.035e-19
Identity = 45/135 (33.33%), Postives = 77/135 (57.04%), Query Frame = 3
Query: 1383 VEQTIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            ++ T+A IKPD + +    E +  KIL+  F I++ K +   K+ +E FY++ S + +F  L+  M SGP    +L+REDAI  WR+++GP     A  + P+++R  YG    +N  +GSD+    +R ++  F
Sbjct:    7 LQLTLAVIKPDAMAHPLILEALHQKILE-NFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFF 140          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Match: nme2b.2 (NME/NM23 nucleoside diphosphate kinase 2b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-000210-33])

HSP 1 Score: 79.337 bits (194), Expect = 1.009e-16
Identity = 49/145 (33.79%), Postives = 77/145 (53.10%), Query Frame = 3
Query:  969 ASNVQRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIA 1400
            A   +RT   V+P          I+++    GF++   K VQ +++ A   Y   KD+PF+  L+K  S G LLA+  E  N ++  R MLG  D   +K   P ++R  F  E +  NLIHGSDS+++A TE+  +F  E+ ++
Sbjct:    2 AGKTERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAAKFVQASEDLAKQHYIDLKDQPFYAGLVKYTSSGPLLAMVWEGLNVIKTGRVMLGETDPFASK---PGTIRGDFCIE-VGRNLIHGSDSEKSAATEVSLWFKPEELVS 142          

HSP 2 Score: 68.9366 bits (167), Expect = 4.418e-13
Identity = 38/133 (28.57%), Postives = 69/133 (51.88%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T  A+KPDG++     EI  +     F++V  K +   + LA++ Y D   Q ++  L+ +  SGP   MV    + I+  R ++G  DP  ++   P +IR  +  ++ +N ++GSD+E      ++L F
Sbjct:    6 ERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAAKFVQASEDLAKQHYIDLKDQPFYAGLVKYTSSGPLLAMVWEGLNVIKTGRVMLGETDPFASK---PGTIRGDFCIEVGRNLIHGSDSEKSAATEVSLWF 135          

HSP 3 Score: 59.6918 bits (143), Expect = 7.246e-10
Identity = 36/135 (26.67%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 926
            E T   +KPD V+ G + EII + ++ G  ++A +    + + AK+ Y  + D   +  L+K+ +SGP  +L +      +I   R ++G     +   + P +IR  +      N IHG+D   +A  E++ +F
Sbjct:    6 ERTFIAVKPDGVQRGLMGEIIKRFEQKGFRLVAAKFVQASEDLAKQHYIDLKDQPFYAGLVKYTSSGP--LLAMVWEGLNVIKTGRVMLGE---TDPFASKPGTIRGDFCIEVGRNLIHGSDSEKSAATEVSLWF 135          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 538.88 bits (1387), Expect = 1.113e-179
Identity = 271/587 (46.17%), Postives = 389/587 (66.27%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV----QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1796
            MA KK+E  LQ  ++ QE+W+E +  +GLLVVDVYQ WCGPCK  ++ FR++KNE+GDD L+FAVA++DTIDSL KYRG+CEP FL+  G  LV V+RGAN P+L+ TI  +L  E KV+    ER+  KD  + + E DE V    Q  D++L    +  T+A+IKPD V  GK DEII K+QE+G EILA ++  +T  EA+EFY H    E F++LI+F++SGP  +L+++K D    +I  +RE IGP  ++ AK+  P+S+RA YGT  + NA+HG++DR+ A RELAFFFP+F +   +     +   +RTLAL+RP    + ++ IL+ I +AGF +AMQKEV LT+++   FY +H DK ++  L+K+M+ G +LALAL K +AV  WR MLGP  + +A    P+SLRAQF+  D  +N +HGS + E A+ EL +FFPVE T+A IKPD + E+ +EI  +I    F I +IK   + + +AEEFY +   + +F  L+ +M  GP   M+LS+E+A++ WRSL+GP DP  A+   PDS+RA + + I +NAV+GS N       M  IFG ++ +
Sbjct:    1 MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDE-DEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 586          

HSP 2 Score: 92.8189 bits (229), Expect = 1.072e-18
Identity = 52/150 (34.67%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA 971
            E TLA IKPD ++  + DEI+ ++Q  G  I   ++ NL+ E A+EFY        FE L+ ++  GP  +++L+K +A  + E+R L+GP    EA++ SP S+RA +  + ++NA+HG+ + + A  ++ F F D     + R+ HE+
Sbjct:  449 EHTLATIKPDALEEHR-DEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENA--VQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDI---DLDRIVHES 592          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 538.495 bits (1386), Expect = 1.403e-179
Identity = 271/587 (46.17%), Postives = 389/587 (66.27%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV----QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1796
            MA KK+E  LQ  ++ QE+W+E +  +GLLVVDVYQ WCGPCK  ++ FR++KNE+GDD L+FAVA++DTIDSL KYRG+CEP FL+  G  LV V+RGAN P+L+ TI  +L  E KV+    ER+  KD  + + E DE V    Q  D++L    +  T+A+IKPD V  GK DEII K+QE+G EILA ++  +T  EA+EFY H    E F++LI+F++SGP  +L+++K D    +I  +RE IGP  ++ AK+  P+S+RA YGT  + NA+HG++DR+ A RELAFFFP+F +   +     +   +RTLAL+RP    + ++ IL+ I +AGF +AMQKEV LT+++   FY +H DK ++  L+K+M+ G +LALAL K +AV  WR MLGP  + +A    P+SLRAQF+  D  +N +HGS + E A+ EL +FFPVE T+A IKPD + E+ +EI  +I    F I +IK   + + +AEEFY +   + +F  L+ +M  GP   M+LS+E+A++ WRSL+GP DP  A+   PDS+RA + + I +NAV+GS N       M  IFG ++ +
Sbjct:    1 MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDE-DEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 586          

HSP 2 Score: 92.8189 bits (229), Expect = 1.123e-18
Identity = 52/150 (34.67%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA 971
            E TLA IKPD ++  + DEI+ ++Q  G  I   ++ NL+ E A+EFY        FE L+ ++  GP  +++L+K +A  + E+R L+GP    EA++ SP S+RA +  + ++NA+HG+ + + A  ++ F F D     + R+ HE+
Sbjct:  449 EHTLATIKPDALEEHR-DEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENA--VQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDI---DLDRIVHES 592          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 530.406 bits (1365), Expect = 2.021e-176
Identity = 266/586 (45.39%), Postives = 384/586 (65.53%), Query Frame = 3
Query:   60 ARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV----QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1796
             +  Q    Q  ++ QE+W+E +  +GLLVVDVYQ WCGPCK  ++ FR++KNE+GDD L+FAVA++DTIDSL KYRG+CEP FL+  G  LV V+RGAN P+L+ TI  +L  E KV+    ER+  KD  + + E DE V    Q  D++L    +  T+A+IKPD V  GK DEII K+QE+G EILA ++  +T  EA+EFY H    E F++LI+F++SGP  +L+++K D    +I  +RE IGP  ++ AK+  P+S+RA YGT  + NA+HG++DR+ A RELAFFFP+F +   +     +   +RTLAL+RP    + ++ IL+ I +AGF +AMQKEV LT+++   FY +H DK ++  L+K+M+ G +LALAL K +AV  WR MLGP  + +A    P+SLRAQF+  D  +N +HGS + E A+ EL +FFPVE T+A IKPD + E+ +EI  +I    F I +IK   + + +AEEFY +   + +F  L+ +M  GP   M+LS+E+A++ WRSL+GP DP  A+   PDS+RA + + I +NAV+GS N       M  IFG ++ +
Sbjct:    3 GKTDQSTLFQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDE-DEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 587          

HSP 2 Score: 92.8189 bits (229), Expect = 1.126e-18
Identity = 52/150 (34.67%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA 971
            E TLA IKPD ++  + DEI+ ++Q  G  I   ++ NL+ E A+EFY        FE L+ ++  GP  +++L+K +A  + E+R L+GP    EA++ SP S+RA +  + ++NA+HG+ + + A  ++ F F D     + R+ HE+
Sbjct:  450 EHTLATIKPDALEEHR-DEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENA--VQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDI---DLDRIVHES 593          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 496.123 bits (1276), Expect = 1.849e-163
Identity = 252/582 (43.30%), Postives = 369/582 (63.40%), Query Frame = 3
Query:   60 ARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1796
             +  Q    Q  ++ QE+W+E +  +GLLVVDVYQ WCGPCK  ++ FR++KNE+GDD L+FAVA++DTIDSL KYRG+CEP FL+  G  LV V+RGAN P+L+ TI  +L  E KV+    ER+  KD   A  E ++++  V    E+ E    L  I               ++QE+G EILA ++  +T  EA+EFY H    E F++LI+F++SGP  +L+++K D    +I  +RE IGP  ++ AK+  P+S+RA YGT  + NA+HG++DR+ A RELAFFFP+F +   +     +   +RTLAL+RP    + ++ IL+ I +AGF +AMQKEV LT+++   FY +H DK ++  L+K+M+ G +LALAL K +AV  WR MLGP  + +A    P+SLRAQF+  D  +N +HGS + E A+ EL +FFPVE T+A IKPD + E+ +EI  +I    F I +IK   + + +AEEFY +   + +F  L+ +M  GP   M+LS+E+A++ WRSL+GP DP  A+   PDS+RA + + I +NAV+GS N       M  IFG ++ +
Sbjct:    3 GKTDQSTLFQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDE--AILEDEDEIVPVQAQTEDEELGEKLNKIYTSF-----------QIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQLHGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 571          

HSP 2 Score: 93.2041 bits (230), Expect = 8.561e-19
Identity = 52/150 (34.67%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA 971
            E TLA IKPD ++  + DEI+ ++Q  G  I   ++ NL+ E A+EFY        FE L+ ++  GP  +++L+K +A  + E+R L+GP    EA++ SP S+RA +  + ++NA+HG+ + + A  ++ F F D     + R+ HE+
Sbjct:  434 EHTLATIKPDALEEHR-DEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENA--VQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDI---DLDRIVHES 577          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 162.54 bits (410), Expect = 6.977e-43
Identity = 99/275 (36.00%), Postives = 151/275 (54.91%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEF---YSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1739
             S  ++TLAL++P A T+   SI+E I ++GF ++  K V L + EA  FYN+H  K FF +LI  M+ G ++A+ +    AV  WR +LGP +   A+   P S+RA+F  +  K N  HGSDS  +A  EL++FFP              + T   IKP  I      +I N ILDA F+I  ++  T+E++ AEEF   Y     +  F+D+I  + SGP   + +   +A + +R   GP DP+ A    P ++RA +G++  KNAV+ +D
Sbjct:   88 GSKKEKTLALIKPDAVTKM-GSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTK-NAAHGSDSIASAARELEFFFPSSGGRAPKNTAKFTDCTCCIIKPHAISEGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAE--FSDMIVELCSGPCIALEIRDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTD 358          

HSP 2 Score: 144.821 bits (364), Expect = 7.728e-37
Identity = 99/289 (34.26%), Postives = 150/289 (51.90%), Query Frame = 3
Query:  516 EREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARV-KHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKY 1373
            ++E TLALIKPD V   K+  II  + ++G  I   +   L   EA +FY+       F DLI F+ SGP   + +   +A  +  +R+L+GP     A+   PQSIRA +GT+  +NA HG+D   +A REL FFFP        R  K+ A     T  +++P A +E     IL  I +AGF+++  +   + +  A  F   +K     F ++I E+  G  +AL +    A + +R   GP D E A+ + P +LRA+F K  IK N +H +D  E A  E++Y
Sbjct:   90 KKEKTLALIKPDAVT--KMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEA--VSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFPS----SGGRAPKNTAKFTDCTCCIIKPHAISEGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEIRDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIK-NAVHCTDLPEDAPLEVRY 369          

HSP 3 Score: 101.679 bits (252), Expect = 2.434e-22
Identity = 49/131 (37.40%), Postives = 75/131 (57.25%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T+A IKPD +     I   ILD+ F I K K + + ++ A +FY++   + +F+DLI+ M SGP   M +  ++A+  WR L+GP +   A    P SIRA +G D  KNA +GSD+ +   R +   F
Sbjct:   92 EKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFF 222          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme8 (NME/NM23 family member 8 [Source:MGI Symbol;Acc:MGI:1920662])

HSP 1 Score: 338.576 bits (867), Expect = 8.713e-104
Identity = 196/593 (33.05%), Postives = 329/593 (55.48%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-----------------GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEE-EIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            MA KK+E+ LQ+ +N+Q  WDE++  +GL V+DVYQ WCGPCKAV + FR++KNE+ +D  L+F VA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K++ GEM+R +  +  L D   DE+  EV    E       +A+IKPD V   K  E+  K+ + G  I  Q++  L  E  +EFY H+AD   FE+ +  + +G S +L++++ D+                 G++ E      P  + + ++    S++       + +     DD     + +   FPDF   K       ++NVQ TLAL+ P    E ++ +L  I+N GF + MQ+++ L++EEA      H+++ +F+ LI  M+      LAL ++N V+ W+ ++GPK +E+A    P SL  QF+  +   N  +GS S   AE E+ +FFP + T+A IKP     E  EI   I +A F++  +K + +    A + Y   + ++++ +++  +  G +  MVL++ +A+  WR ++GP DP+ A+   P+S+RA YG DI +NAV+G+ N SE   +++ +F
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVD-AIDEEYGEVQ--YESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRD----SLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMK-------STNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKPHVTHKERMEILKTIKEAGFELTLMKEMHLTPEHANKIYFKITGKDFYKNVLEVLSLGMSLVMVLTKWNAVAEWRRMVGPVDPEEAKLLSPESLRAKYGLDILRNAVHGASNFSEASEIISNVF 579          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme8 (NME/NM23 family member 8 [Source:MGI Symbol;Acc:MGI:1920662])

HSP 1 Score: 270.396 bits (690), Expect = 5.288e-80
Identity = 159/470 (33.83%), Postives = 258/470 (54.89%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-----------------GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKP 1412
            MA KK+E+ LQ+ +N+Q  WDE++  +GL V+DVYQ WCGPCKAV + FR++KNE+ +D  L+F VA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K++ GEM+R +  +  L D   DE+  EV    E       +A+IKPD V   K  E+  K+ + G  I  Q++  L  E  +EFY H+AD   FE+ +  + +G S +L++++ D+                 G++ E      P  + + ++    S++       + +     DD     + +   FPDF   K       ++NVQ TLAL+ P    E ++ +L  I+N GF + MQ+++ L++EEA      H+++ +F+ LI  M+      LAL ++N V+ W+ ++GPK +E+A    P SL  QF+  +   N  +GS S   AE E+ +FFP + T+A IKP
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVD-AIDEEYGEVQ--YESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRD----SLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMK-------STNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKP 456          

HSP 2 Score: 91.6633 bits (226), Expect = 9.555e-19
Identity = 75/298 (25.17%), Postives = 140/298 (46.98%), Query Frame = 3
Query:  957 VKHEASNVQRTLALVRPAAYTEYRE-SILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSL---RAQFSKEDIK---------VNLIHGSDSDETAETELKY------FFP---------VEQTIAAIKPDGIENE-EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGR-DINKNAVYGSDNESEVQR 1760
            V++E++     +A+++P A    +   + EKI   GF + +Q+ + L +E    FY    D+P FEE +  M+ G    L + ++++       L   D E+    +P  L     +F+   IK         ++  H SD  +  +  +K        FP         V+ T+A + PD  E E +++ N I +  F I+  ++I + +  A        ++EYF++LI HM S  +Y + L RE+ +  W++LIGPK  + A  ++P S+   +   +   N  YGS +++  ++
Sbjct:  146 VQYESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETLPQTDTEE----EPGVLEEPHVRFAPVMIKKKRDSLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMKSTNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEK 439          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme9 (NME/NM23 family member 9 [Source:MGI Symbol;Acc:MGI:4359686])

HSP 1 Score: 250.751 bits (639), Expect = 1.232e-74
Identity = 135/298 (45.30%), Postives = 187/298 (62.75%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKV-MKGEMERNETKDSFLA--DFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            M  +K+EIALQ  INTQE W+E++  +GL VVDVYQ WCGPCK +++ F++++ E+G D L+FA A+AD +D LEKY+G+CEP FL Y    LV V++GANP +L+ TI  +LE E KV  +G   R  T +  L    +    K    D D+    +  TL +IKPD V  GK +EII K+QE G +IL +++R LT  E + FY H A  E FE L+  + SGPS +L+L K  G   ++  +R  +GP   + A+   P+S+RA YGT    NA+HG+ DR+ A RELA  FP F
Sbjct:    1 MGNRKKEIALQVNINTQELWEEMLGSKGLTVVDVYQGWCGPCKPMVSLFQKMRIEVGLDRLHFASAEADRLDVLEKYQGKCEPTFLFYTRGELVAVVKGANPTLLQKTILQQLEAEKKVPAEGGEWRAATDEELLGALKWPPHRKDGGEDGDIASSGKTCTLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRELALLFPSF 298          

HSP 2 Score: 102.064 bits (253), Expect = 7.310e-23
Identity = 49/142 (34.51%), Postives = 85/142 (59.86%), Query Frame = 3
Query: 1392 TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSR----EDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNE 1799
            T+  IKPD + +   EEI  KI +A F I+  +  T+ ++  + FY  ++ +E F  L+ HM SGP++ ++L++    ED +  WR+ +GP DP  A   +P+S+RA YG ++  NAV+GS +  +  R + L+F   +F++
Sbjct:  161 TLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRELALLFPSFKFSD 302          

HSP 3 Score: 81.6481 bits (200), Expect = 5.645e-16
Identity = 51/143 (35.66%), Postives = 70/143 (48.95%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEK----QNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            +S    TL +++P A    + E I+ KI  AGF + +++E  LT+ E   FY     +  FE L+  M  G    L L K    ++ V  WR  LGP D   A+   P SLRAQ+  E +  N +HGS   E A  EL   FP
Sbjct:  155 SSGKTCTLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTE-MPFNAVHGSRDREDANRELALLFP 296          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 147.132 bits (370), Expect = 1.178e-37
Identity = 84/278 (30.22%), Postives = 151/278 (54.32%), Query Frame = 3
Query:  960 KHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIENEEEIFNKIL----DAKFKIVKIKRITMEKSLAEEFY-SDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1739
            +   S  ++TLAL++P A ++  E I+E IN +GF +   + + LT++EAA F+  H  +PF+ ELI+ ++ G ++A+ + + +A+  W+ +LGP +   ++   P S+RA F  + ++ N  HG D+  +A  E++ FFP                T   IKP  I   E +  KIL    DA F +  I+   ++++  EEFY   +     +ND++  + SGP   + + + +  + +R   GP DP+ A    P+++RAI+G+   +NAV+ +D
Sbjct:  104 RQLGSRKEKTLALIKPDAVSKAGE-IIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVR-NAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAI--SEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTD 377          

HSP 2 Score: 143.665 bits (361), Expect = 2.229e-36
Identity = 99/335 (29.55%), Postives = 165/335 (49.25%), Query Frame = 3
Query:  426 MERNETKDSFLADFETDEKVQEVDKDLEEIE-------------REVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1385
            ++R + +D  L D     KV    + L  I+             +E TLALIKPD V   K  EII  + ++G  I   +   LT +EA +F+        + +LI+FI SGP   + + + DA  I E++ L+GP     ++ ++P SIRA++GT+ + NA HG D   +A RE+  FFP           + A     T  +++P A +E     IL  I +A F ++  +   L +     FY  +K     + +++ E+  G  +A+ +++ N  + +R   GP D E A+ + P +LRA F K  ++ N +H +D  E    E++YFF +
Sbjct:   66 LKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVS--KAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDA--ICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPS---SGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQ-NAVHCTDLPEDGLLEVQYFFKI 392          

HSP 3 Score: 97.4413 bits (241), Expect = 6.071e-21
Identity = 47/131 (35.88%), Postives = 74/131 (56.49%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T+A IKPD +    EI   I  + F I K++ +T+ +  A +F+ D   + ++N+LI  + SGP   M + R+DAI  W+ L+GP +   +    P SIRA++G D  +NA +G D  +   R M L F
Sbjct:  111 EKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFF 241          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 147.132 bits (370), Expect = 1.178e-37
Identity = 84/278 (30.22%), Postives = 151/278 (54.32%), Query Frame = 3
Query:  960 KHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIENEEEIFNKIL----DAKFKIVKIKRITMEKSLAEEFY-SDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1739
            +   S  ++TLAL++P A ++  E I+E IN +GF +   + + LT++EAA F+  H  +PF+ ELI+ ++ G ++A+ + + +A+  W+ +LGP +   ++   P S+RA F  + ++ N  HG D+  +A  E++ FFP                T   IKP  I   E +  KIL    DA F +  I+   ++++  EEFY   +     +ND++  + SGP   + + + +  + +R   GP DP+ A    P+++RAI+G+   +NAV+ +D
Sbjct:  104 RQLGSRKEKTLALIKPDAVSKAGE-IIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVR-NAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAI--SEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTD 377          

HSP 2 Score: 143.665 bits (361), Expect = 2.229e-36
Identity = 99/335 (29.55%), Postives = 165/335 (49.25%), Query Frame = 3
Query:  426 MERNETKDSFLADFETDEKVQEVDKDLEEIE-------------REVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1385
            ++R + +D  L D     KV    + L  I+             +E TLALIKPD V   K  EII  + ++G  I   +   LT +EA +F+        + +LI+FI SGP   + + + DA  I E++ L+GP     ++ ++P SIRA++GT+ + NA HG D   +A RE+  FFP           + A     T  +++P A +E     IL  I +A F ++  +   L +     FY  +K     + +++ E+  G  +A+ +++ N  + +R   GP D E A+ + P +LRA F K  ++ N +H +D  E    E++YFF +
Sbjct:   66 LKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVS--KAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDA--ICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPS---SGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQ-NAVHCTDLPEDGLLEVQYFFKI 392          

HSP 3 Score: 97.4413 bits (241), Expect = 6.071e-21
Identity = 47/131 (35.88%), Postives = 74/131 (56.49%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T+A IKPD +    EI   I  + F I K++ +T+ +  A +F+ D   + ++N+LI  + SGP   M + R+DAI  W+ L+GP +   +    P SIRA++G D  +NA +G D  +   R M L F
Sbjct:  111 EKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFF 241          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|Q95YJ5|TXND3_CIOIN (Thioredoxin domain-containing protein 3 homolog OS=Ciona intestinalis OX=7719 GN=CiIC3 PE=2 SV=1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 272/604 (45.03%), Postives = 402/604 (66.56%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEE------IEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVP--------------KIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNED 1802
            MA++K E+ LQ  +NTQE W+  +    L VVD +Q WCGPC A++   +R+KNE+GDD L FA A+ D ID+LE+YRG+CEP FL YGG  LV  +RG N P+++ TI+  L+ EHK++ GEMER   +D +     +D   QE +++ EE      + +++T+ALIKPD+V+ G+VDEI+ K+ E GIE+LA ++R LT+EEA++FY +  + E F+ LI ++ SGP ++LVL KG++G  ++  +R++IGP     AKE +P S+RAIYGT++  NA+HG+   + A REL FFFPDF  P              + ++   +   +QRTLA++RP A   +++SIL+KI+ AGFK+AMQKE+ LT+E+A  FY++HKD  +FE L+K+M+ G +LAL L   +AV  WR MLGPK V  A E  P+SLRAQF  E+ +VN++HGSDS E AE EL   F VEQT+A IKPD I+ +E+I  K+ +A F I   K + + K +A E Y  +   EY++ LI HM SGPT  MVLS E+A+   R ++GP DP+ A++++P+S+RA++ + I +NA++        Q  + ++FG  +F+ D
Sbjct:    1 MAKRK-EVILQETLNTQEAWEVAMNSGKLYVVDAHQKWCGPCTAIVGMLKRIKNELGDDLLRFATAQVDVIDTLEQYRGKCEPNFLFYGGGELVAAVRGCNAPLVQETIQETLKNEHKILSGEMERKVFRDVY-----SDTPDQEEEEEDEEEEEGGVVSKQITVALIKPDVVQNGQVDEILQKISEAGIEVLADEERMLTVEEARDFYKNKEEEEYFDQLIDYVTSGPCRVLVLTKGESGEGVVTLWRDIIGPFDAAVAKEENPDSLRAIYGTDATSNALHGSSSTEEAVRELGFFFPDFKPPTYRSAKSAASRASGRRSKTPSQKPRLQRTLAIIRPDALQAHKDSILQKIDEAGFKIAMQKEMVLTREQAESFYSEHKDTDYFEPLVKQMTCGPVLALCLAHDDAVDHWRSMLGPKVVADAVEEQPDSLRAQFRVEEAEVNMLHGSDSAEAAEEELSKIFHVEQTLAVIKPDAIDEKEQIMGKLKEAGFMISCQKDMNLSKEIASEIYKSKEGSEYYDHLIDHMTSGPTLMMVLSAENAVEKLRDIMGPTDPEVAKESHPESLRAMFAKSILENAIHSPSTNESAQEKIRIVFGDAQFDWD 598          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|P90666|TXND3_HELCR (Thioredoxin domain-containing protein 3 homolog OS=Heliocidaris crassispina OX=1043166 GN=NME8 PE=1 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 2.634e-130
Identity = 206/438 (47.03%), Postives = 301/438 (68.72%), Query Frame = 3
Query:  507 EEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1811
            E + +EVT+ LIKPD V  G VD IIAK++E+G EIL  +D+ LT +EA+EFY    + E FE L+ F+ASGPSKILVL +GD G  ++ E R L+GPK ++ AKE +P S+RA +GT+   NA+HGAD ++TA RE+AF  P+F VP I         +++TLAL+RP+A  ++++ +L+KI  AGF+V +QK VQLT+++A  FY + +  P FE+LI+EM+ G +LAL L K++A+Q WR  +GP  +++AKE  P+SLRAQ+S  D +VN++HGSDS +TAE EL +FFP + T+A IKPD   E++E I  KI +A F I   + + + K LA + Y +   +E++ +LI HM SG +  MVLSREDA+ GWR+L+GP DP  A +  P+S+RA+ G+D+ +NAV+GS N  E +  +  +F  +E    G +
Sbjct:  197 EPVPKEVTVVLIKPDAVANGHVDSIIAKIEEHGFEILTTEDKTLTEDEAREFYKQHEEEEHFEVLVTFMASGPSKILVLTRGDTGEGVVSEVRNLLGPKDIEVAKEEAPDSLRAQFGTDKKMNAMHGADSKETAAREMAFLLPNFSVP-IVPGTGPPPTIEKTLALIRPSALKDHKDEMLQKIQEAGFEVCLQKMVQLTEDQAKEFYKEQEGTPHFEDLIREMTSGEVLALGLAKESAIQSWREFIGPTTIDEAKEKAPDSLRAQYSIPDTQVNVVHGSDSVDTAEKELGFFFPKQTTLAVIKPDAAGEHKEAIIEKIKEAGFNISLQRDVELNKELASKLYLEHEGKEFYENLIDHMSSGLSMVMVLSREDAVDGWRTLMGPTDPDYAREHAPESLRALLGKDVLQNAVHGSSNPEEAKTRIERLFPDVEVLPGGEV 633          

HSP 2 Score: 167.162 bits (422), Expect = 4.919e-41
Identity = 76/134 (56.72%), Postives = 100/134 (74.63%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFL 458
            M  KK++I LQ EI  QE WDEL+  EGL V+DVYQ WCGPC AV++ F+R++NEIGDD L FAVA+AD+I++LE+YRG+CEPCFL YG   LV V+RG N P L   ++ +L++EHKV++  +ER   KD  L
Sbjct:    1 MPAKKEQIQLQKEILNQEMWDELLSLEGLTVIDVYQKWCGPCAAVLSLFKRLRNEIGDDLLRFAVAEADSIETLERYRGKCEPCFLRYGSGQLVNVVRGVNAPALLKNVERELKQEHKVLEEGVERVVIKDPLL 134          

HSP 3 Score: 94.7449 bits (234), Expect = 1.957e-18
Identity = 54/154 (35.06%), Postives = 91/154 (59.09%), Query Frame = 3
Query:  519 REVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNV 980
            ++ TLA+IKPD     K + II K++E G  I  Q+D  L  E A + Y      E +E+LI  ++SG S ++VL++ DA  +  +R L+GP   D A+E++P+S+RA+ G + ++NA+HG+ + + A+  +   FPD  V     VK   +++
Sbjct:  490 KQTTLAVIKPDAAGEHK-EAIIEKIKEAGFNISLQRDVELNKELASKLYLEHEGKEFYENLIDHMSSGLSMVMVLSREDA--VDGWRTLMGPTDPDYAREHAPESLRALLGKDVLQNAVHGSSNPEEAKTRIERLFPDVEVLPGGEVKDSVASI 640          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|Q8N427|TXND3_HUMAN (Thioredoxin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NME8 PE=2 SV=2)

HSP 1 Score: 357.066 bits (915), Expect = 7.597e-110
Identity = 206/599 (34.39%), Postives = 340/599 (56.76%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIH-----------------------EFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            MA KK+E+ LQ  IN Q  WDE+++ +GL V+DVYQ WCGPC+A+   FR++KNE+ +D  L+FAVA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K+  GEM R +  +  L D  +D +V E +   E ++   ++A+IKPD V + KV EI  K+ + G  I A+    LT E+   FY  +AD   FE+ + F+ SG S ILV+++G     H                       E    + P  +    +N   S++       +       +D     + +  FFPDF        K ++  +++TLAL+RP  + E ++ +L  I +  FK+  Q++V L+++EA     +++++ +F +LI+ M+ G  LAL L + N +Q W+ +LGP+ VE+A E  P SL AQF+ + + VN ++GSDS ETAE E+++FFP++ T+  IKP    E  E+I   + +A F + ++K++ +     E+ Y   + ++++ DL+  +  GP+  M+L++ +A+  WR L+GP DP+ A+   PDSIRA +G    KN V+G+ N  E + V+N +F
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVD--SDSEVSE-ESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSK---HNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMM----KNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPDFK-------KMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLF 582          

HSP 2 Score: 78.5666 bits (192), Expect = 1.546e-13
Identity = 48/151 (31.79%), Postives = 85/151 (56.29%), Query Frame = 3
Query:  504 LEEIEREV--------TLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 932
            LE  ERE+        TL LIKP      + ++I+  ++E G ++   +   LT E+ ++ Y  +   + ++DL++ ++ GPS +++L K +A  + E+R L+GP   +EAK  SP SIRA +G + ++N +HGA +   A+  +   F D
Sbjct:  437 LETAEREIQHFFPLQSTLGLIKPHATSEQR-EQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNA--VAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFED 584          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|Q715S9|TXND3_RAT (Thioredoxin domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nme8 PE=2 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 2.655e-103
Identity = 204/596 (34.23%), Postives = 336/596 (56.38%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREV-TLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKG-DAGIIHE-------------FRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEE-EIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEF 1793
            MA KK+E+ LQ+ +N+Q  WDE++  +GL V+DVYQ WCGPCKAV   FR++KNE+ +D  L+F VA+AD+I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K+  GEM R +  +  L D   DE+  EV     E   EV  +A+I PD V   K  EI  K+ + G  I  Q++  L  E A+EFY+HM D   FE+ +  + +  S +L++++G D  +I E               E    +F     +    S++       + +  H  DD     + +   FPDF   K       ++NVQRTL L+ P    E ++++L+ I N GF + MQ++V L++EEA    + H+D+ +F+ LI  M       L L ++++V+ W+ ++GPK VE+A    P+SL  +F+  +  VN  +GS S   AETE+++FFP + T+A IKP     E  EI   I DA+F++ ++K + +    A + Y   + ++++ +++  + SG +  M+L++ +A+  WR ++GP DP+ A+   P+S+RA YG D+ +NAV+G+ N SE    ++ +F +  F
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQALFRKLKNELNEDELLHFVVAEADSIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVIALIDEEKKIAAGEMARPQYVEIPLVD-SLDEEYGEVHY---ESNVEVYNMAVINPDAVLMRKNLEIKEKITKEGFIIEIQENMLLPEEVAREFYNHMIDEPDFEEFVYSMTNRLSCVLIISQGEDTEVIEEEALPQSDDEEEPDPLEEPHVRFAPMLVKKKRDSLQEYMDRQHMSDYCHVEDDAVKVSKFIDILFPDFKTMK-------STNVQRTLGLLYPEVCEEEKDNVLDIIQNEGFTILMQRQVVLSEEEARAVCHVHEDEDYFDNLIGYMCSNNSYILVLMREHSVERWKELIGPKTVEEAYASHPDSLCVRFASGNFPVNQFYGSSSKAAAETEIEHFFPPQSTLALIKPHVSHKERMEILKAIRDARFELTQMKEMHLTPEHASKVYFKITGKDFYKNVLDVLSSGMSVVMILTKWNAVGEWRRMMGPVDPEEAKLLSPNSLRARYGIDVLRNAVHGASNMSEAATAISNVFTESNF 585          
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Match: sp|Q715T0|TXND3_MOUSE (Thioredoxin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Nme8 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 6.095e-103
Identity = 196/593 (33.05%), Postives = 329/593 (55.48%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDD-FLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-----------------GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEE-EIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            MA KK+E+ LQ+ +N+Q  WDE++  +GL V+DVYQ WCGPCKAV + FR++KNE+ +D  L+F VA+AD I +L+ +R +CEP FL      ++  I+GAN P++   +   ++EE K++ GEM+R +  +  L D   DE+  EV    E       +A+IKPD V   K  E+  K+ + G  I  Q++  L  E  +EFY H+AD   FE+ +  + +G S +L++++ D+                 G++ E      P  + + ++    S++       + +     DD     + +   FPDF   K       ++NVQ TLAL+ P    E ++ +L  I+N GF + MQ+++ L++EEA      H+++ +F+ LI  M+      LAL ++N V+ W+ ++GPK +E+A    P SL  QF+  +   N  +GS S   AE E+ +FFP + T+A IKP     E  EI   I +A F++  +K + +    A + Y   + ++++ +++  +  G +  MVL++ +A+  WR ++GP DP+ A+   P+S+RA YG DI +NAV+G+ N SE   +++ +F
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVD-AIDEEYGEVQ--YESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRD----SLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMK-------STNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKPHVTHKERMEILKTIKEAGFELTLMKEMHLTPEHANKIYFKITGKDFYKNVLEVLSLGMSLVMVLTKWNAVAEWRRMVGPVDPEEAKLLSPESLRAKYGLDILRNAVHGASNFSEASEIISNVF 579          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20303730 (tr|A0A1S3IQQ0|A0A1S3IQQ0_LINUN thioredoxin domain-containing protein 3 homolog isoform X6 OS=Lingula unguis OX=7574 GN=LOC106166507 PE=3 SV=1)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 319/589 (54.16%), Postives = 431/589 (73.17%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV--QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA-SNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1811
            MA KK+EI LQ +I TQEEW+E + KEGLLVVDVYQ+W GPCKA++   R++K E+ DD+L+FA AKADTID+LEKYRG+C+PCFL + G  LV V+RGAN PV+E T+K +L +EHKVM+G  ER E +D  L + E ++    +E  +  E  ++EVT+A+IKPD VKAGKV+EI+ +++E GIE+LAQ++R LT EEA+EFY    D E FEDL+ F++SGPS +LVL KG   GII E+R+L+GP  ++EAKE +P S+RA +G+    NA+HG+D +DTA RELAFFFP+F++P     K  A   VQRTLAL+RP A TE++++ILEKI  AGF +AMQKEVQLTKE+A  FY +HKD+P+FEEL   MS G LLAL+L + +AV  WRGMLGPK+V+KAKE  P SLRAQF+ E +++N +HGSDS  TA+ EL+YFFP++QT+A +KPD  + ++EI   I +A F I   K   +   + ++ Y +   +EY+ DL+ HM SGPT FMVLS+E+A+ GWR +IGP DP  A++  PDSIRA +G D+  NAV+GS +    +  +  IFG L F +DG+L
Sbjct:    1 MAGKKKEIVLQVQIETQEEWEEFMTKEGLLVVDVYQEWSGPCKAMVTNLRKLKMELSDDYLHFATAKADTIDALEKYRGKCQPCFLFFAGGCLVAVVRGANAPVIERTLKDQLAQEHKVMEGIAERKEIRDPALGEEEKEKGGLDEEETEKEEAPKKEVTVAIIKPDAVKAGKVEEILEQMKEAGIEVLAQEERQLTDEEAREFYSAQQDQEHFEDLVSFMSSGPSHVLVLTKGSGEGIIQEWRDLLGPTSVEEAKEQAPDSLRAKFGSEKYFNALHGSDSQDTATRELAFFFPNFVMPGSPAAKSAAKPQVQRTLALIRPDALTEHKDAILEKIQEAGFTIAMQKEVQLTKEQAEEFYKEHKDQPYFEELTNRMSCGPLLALSLARDDAVDAWRGMLGPKEVDKAKEEAPESLRAQFAVEGVEINPVHGSDSPTTAQQELEYFFPMQQTLAVVKPDAYKTKDEIMELIKEAGFHIAARKETELTPDIVQQLYKEHEGKEYYGDLVEHMTSGPTLFMVLSKENAVEGWRGIIGPTDPAKAKEEAPDSIRAQFGSDVKANAVHGSSDVEHAKEAITAIFGDLVFEKDGTL 589          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|23495143 (tr|A0A210QRC6|A0A210QRC6_MIZYE Thioredoxin domain-containing protein 3-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24243 PE=3 SV=1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 316/590 (53.56%), Postives = 432/590 (73.22%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLA--DFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAG--IIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLL 1814
            MAR+KQEI LQ EI TQEEW++++ KEGL V+DVYQ+WCGPC  +I   +R+KNE+GDD L+FA+AKADTID+LEKYRG C+PCFL Y G  LV VIRGAN P++  T+  +L++EH+V+ G  ER E KD +++  D  +++  ++ ++  +E ++EVT+A+IKPD VKAGKVDEII  ++ +GIEIL Q++R +T +EAK  Y H+ D + F DLI F+ SGPS ILVL KG  G  II+EFR+LIGP  +++AKE  P+S+RA +G  +  NA+HG+   D A RELAFFFPDF +P           +QRTLAL+RP A+  +++ +++ IN AGFKVA+QKE+ LTKE A  FY +H+ + +F EL   MS G L+AL L +++AV+GWR MLGPK+++KAKE  P+SLRA+F+ ED+ +N  HGSDS+  A+ EL +FFPV+QTIA IKPD +  ++EI  K+ DA FKI   K  T+ + +AEEFYSD   ++Y+NDL+ HM SGPT FMVLSREDA+ GWRSLIGP DP+ A++  PDS+RA+YG DI KNAV+GS N  + +  +  IFG L+F  +G L+
Sbjct:   10 MARRKQEIQLQQEIETQEEWEDIMSKEGLYVIDVYQEWCGPCSGLIANLKRLKNELGDDLLHFAIAKADTIDALEKYRGHCQPCFLFYAGGMLVAVIRGANSPMVMRTVTEQLQQEHRVIDGAAERKEIKDPYISMVDNMSNDADEDEEEAEDESKKEVTVAVIKPDAVKAGKVDEIIEDIKAHGIEILKQEERLMTEDEAKNIYTHLQDEDFFNDLITFMTSGPSHILVLTKGRTGENIINEFRDLIGPTSVEDAKEKQPESLRAKHGEKTFMNALHGSSSDDQAMRELAFFFPDFAIP----ASEGKPKLQRTLALIRPDAFKLHKDEVMQMINEAGFKVALQKEMSLTKEMAEDFYREHEGQEYFNELTTRMSSGPLMALGLAREDAVEGWRSMLGPKELDKAKEESPDSLRAKFALEDVAINQFHGSDSEAAAQKELDFFFPVQQTIAVIKPDALGTKDEIIEKVHDAGFKIAARKETTLSREIAEEFYSDHKDKDYYNDLVEHMSSGPTMFMVLSREDAVDGWRSLIGPTDPEKAKEESPDSLRALYGGDILKNAVHGSSNVDQAKTTIQKIFGDLKFTPEGLLI 595          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20333760 (tr|A0A1S3ISM9|A0A1S3ISM9_LINUN thioredoxin domain-containing protein 3 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106166507 PE=3 SV=1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 313/590 (53.05%), Postives = 429/590 (72.71%), Query Frame = 3
Query:   54 IMARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV--QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA-GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA-SNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1811
            +  + K+E A+  +I TQEEW+E + KEGL+VVDVYQ+W GPCKA++   R++K E+ DD+L+FA AKADTID+LEKYRG+C+PCFL + G  LV V+RGAN PV+E T+K +L +EHKVM+G  ER E +D  L + E ++    +E  +  E  ++EVT+A+IKPD VKAGKV+EI+ +++E GIE+LAQ++R LT EEA+EFY    D E FEDL+ F++SGPS +LVL KG   GII E+R+L+GP  ++EAKE +P S+RA +G+    NA+HG+D +DTA RELAFFFP+F++P     K  A   VQRTLAL+RP A TE++++ILEKI  AGF +AMQKEVQLTKE+A  FY +HKD+P+FEEL   MS G LLAL+L + +AV  WRGMLGPK+V+KAKE  P SLRAQF+ E +++N +HGSDS  TA+ EL+YFFP++QT+A +KPD  + ++EI   I +A F I   K   +   + ++ Y +   +EY+ DL+ HM SGPT FMVLS+E+A+ GWR +IGP DP  A++  PDSIRA +G D+  NAV+GS +    +  +  IFG L F +DG+L
Sbjct:    1 MAGKGKKEAAIAVDIGTQEEWEECLAKEGLIVVDVYQEWSGPCKAMVTNLRKLKMELSDDYLHFATAKADTIDALEKYRGKCQPCFLFFAGGCLVAVVRGANAPVIERTLKDQLAQEHKVMEGIAERKEIRDPALGEEEKEKGGLDEEETEKEEAPKKEVTVAIIKPDAVKAGKVEEILEQMKEAGIEVLAQEERQLTDEEAREFYSAQQDQEHFEDLVSFMSSGPSHVLVLTKGSGEGIIQEWRDLLGPTSVEEAKEQAPDSLRAKFGSEKYFNALHGSDSQDTATRELAFFFPNFVMPGSPAAKSAAKPQVQRTLALIRPDALTEHKDAILEKIQEAGFTIAMQKEVQLTKEQAEEFYKEHKDQPYFEELTNRMSCGPLLALSLARDDAVDAWRGMLGPKEVDKAKEEAPESLRAQFAVEGVEINPVHGSDSPTTAQQELEYFFPMQQTLAVVKPDAYKTKDEIMELIKEAGFHIAARKETELTPDIVQQLYKEHEGKEYYGDLVEHMTSGPTLFMVLSKENAVEGWRGIIGPTDPAKAKEEAPDSIRAQFGSDVKANAVHGSSDVEHAKEAITAIFGDLVFEKDGTL 590          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20323686 (tr|A0A1S3IRI1|A0A1S3IRI1_LINUN thioredoxin domain-containing protein 3 homolog isoform X2 OS=Lingula unguis OX=7574 GN=LOC106166507 PE=3 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 313/592 (52.87%), Postives = 429/592 (72.47%), Query Frame = 3
Query:   54 IMARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV--QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADS--EIFEDLIKFIASGPSKILVLAKGDA-GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA-SNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1811
            +  + K+E A+  +I TQEEW+E + KEGL+VVDVYQ+W GPCKA++   R++K E+ DD+L+FA AKADTID+LEKYRG+C+PCFL + G  LV V+RGAN PV+E T+K +L +EHKVM+G  ER E +D  L + E ++    +E  +  E  ++EVT+A+IKPD VKAGKV+EI+ +++E GIE+LAQ++R LT EEA+EFY    D   E FEDL+ F++SGPS +LVL KG   GII E+R+L+GP  ++EAKE +P S+RA +G+    NA+HG+D +DTA RELAFFFP+F++P     K  A   VQRTLAL+RP A TE++++ILEKI  AGF +AMQKEVQLTKE+A  FY +HKD+P+FEEL   MS G LLAL+L + +AV  WRGMLGPK+V+KAKE  P SLRAQF+ E +++N +HGSDS  TA+ EL+YFFP++QT+A +KPD  + ++EI   I +A F I   K   +   + ++ Y +   +EY+ DL+ HM SGPT FMVLS+E+A+ GWR +IGP DP  A++  PDSIRA +G D+  NAV+GS +    +  +  IFG L F +DG+L
Sbjct:    1 MAGKGKKEAAIAVDIGTQEEWEECLAKEGLIVVDVYQEWSGPCKAMVTNLRKLKMELSDDYLHFATAKADTIDALEKYRGKCQPCFLFFAGGCLVAVVRGANAPVIERTLKDQLAQEHKVMEGIAERKEIRDPALGEEEKEKGGLDEEETEKEEAPKKEVTVAIIKPDAVKAGKVEEILEQMKEAGIEVLAQEERQLTDEEAREFYSAQQDQFKEHFEDLVSFMSSGPSHVLVLTKGSGEGIIQEWRDLLGPTSVEEAKEQAPDSLRAKFGSEKYFNALHGSDSQDTATRELAFFFPNFVMPGSPAAKSAAKPQVQRTLALIRPDALTEHKDAILEKIQEAGFTIAMQKEVQLTKEQAEEFYKEHKDQPYFEELTNRMSCGPLLALSLARDDAVDAWRGMLGPKEVDKAKEEAPESLRAQFAVEGVEINPVHGSDSPTTAQQELEYFFPMQQTLAVVKPDAYKTKDEIMELIKEAGFHIAARKETELTPDIVQQLYKEHEGKEYYGDLVEHMTSGPTLFMVLSKENAVEGWRGIIGPTDPAKAKEEAPDSIRAQFGSDVKANAVHGSSDVEHAKEAITAIFGDLVFEKDGTL 592          
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20307003 (tr|A0A1S3IR48|A0A1S3IR48_LINUN thioredoxin domain-containing protein 3 homolog isoform X3 OS=Lingula unguis OX=7574 GN=LOC106166507 PE=3 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 313/592 (52.87%), Postives = 429/592 (72.47%), Query Frame = 3
Query:   54 IMARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKV--QEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADS--EIFEDLIKFIASGPSKILVLAKGDA-GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEA-SNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1811
            +  + K+E A+  +I TQEEW+E + KEGL+VVDVYQ+W GPCKA++   R++K E+ DD+L+FA AKADTID+LEKYRG+C+PCFL + G  LV V+RGAN PV+E T+K +L +EHKVM+G  ER E +D  L + E ++    +E  +  E  ++EVT+A+IKPD VKAGKV+EI+ +++E GIE+LAQ++R LT EEA+EFY    D   E FEDL+ F++SGPS +LVL KG   GII E+R+L+GP  ++EAKE +P S+RA +G+    NA+HG+D +DTA RELAFFFP+F++P     K  A   VQRTLAL+RP A TE++++ILEKI  AGF +AMQKEVQLTKE+A  FY +HKD+P+FEEL   MS G LLAL+L + +AV  WRGMLGPK+V+KAKE  P SLRAQF+ E +++N +HGSDS  TA+ EL+YFFP++QT+A +KPD  + ++EI   I +A F I   K   +   + ++ Y +   +EY+ DL+ HM SGPT FMVLS+E+A+ GWR +IGP DP  A++  PDSIRA +G D+  NAV+GS +    +  +  IFG L F +DG+L
Sbjct:    1 MAGKGKKEAAIAVDIGTQEEWEECLAKEGLIVVDVYQEWSGPCKAMVTNLRKLKMELSDDYLHFATAKADTIDALEKYRGKCQPCFLFFAGGCLVAVVRGANAPVIERTLKDQLAQEHKVMEGIAERKEIRDPALGEEEKEKGGLDEEETEKEEAPKKEVTVAIIKPDAVKAGKVEEILEQMKEAGIEVLAQEERQLTDEEAREFYSAQQDQFKEHFEDLVSFMSSGPSHVLVLTKGSGEGIIQEWRDLLGPTSVEEAKEQAPDSLRAKFGSEKYFNALHGSDSQDTATRELAFFFPNFVMPGSPAAKSAAKPQVQRTLALIRPDALTEHKDAILEKIQEAGFTIAMQKEVQLTKEQAEEFYKEHKDQPYFEELTNRMSCGPLLALSLARDDAVDAWRGMLGPKEVDKAKEEAPESLRAQFAVEGVEINPVHGSDSPTTAQQELEYFFPMQQTLAVVKPDAYKTKDEIMELIKEAGFHIAARKETELTPDIVQQLYKEHEGKEYYGDLVEHMTSGPTLFMVLSKENAVEGWRGIIGPTDPAKAKEEAPDSIRAQFGSDVKANAVHGSSDVEHAKEAITAIFGDLVFEKDGTL 592          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 278/588 (47.28%), Postives = 396/588 (67.35%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDE----KVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASN----VQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKL 1787
            MA KK+E++LQ  I   E+W E++  +GL VVDVYQ WCGPC+AVI+ FR++KNE+GDD L+FAVA+AD+I+ LEKYRG+CEP FL Y G  LV V+RGAN P+L+  +  +L +E +V++  ++R   KD  L D E  E     +Q  +  L    R  T+A+IKPDIV  GK DEII K+Q+ G EILA ++R LT  EA+EFY H A    F++L++F++SGPS +LV++K  G   +I  +RE +GP  ++EAK   P S+RA YG+ ++ NA+HG+ D + A RELAFFFP+F      R    A      V+RTLAL+RP    E RE IL KI+ AGFKVAMQKEV LT+E+  LFY++H+++ +F  L+K M+ G +LALAL KQ AV+ WR +LGPKD ++AKE  P SLRAQF+ E   VN +HGS S E AE E+ +FFP EQT+A IKPD   E+ +EI  +I    F I +++   + + +AEEFY +   + +F+ L+ +M  GP   ++L++E+A+  WR+++GP DP  A++  P S+RA + +DI +NAV+GS N    Q  ++ +FG++
Sbjct:    1 MAGKKKEVSLQVSIGNDEQWGEMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAVAEADSINVLEKYRGKCEPTFLFYAGGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFGEI 588          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 504.982 bits (1299), Expect = 4.683e-166
Identity = 262/588 (44.56%), Postives = 376/588 (63.95%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDE----KVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASN----VQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKL 1787
            MA KK+E++LQ  I   E+W E++  +GL VVDVYQ WCGPC+AVI+ FR++KNE+GDD L+FAV                        G  LV V+RGAN P+L+  +  +L +E +V++  ++R   KD  L D E  E     +Q  +  L    R  T+A+IKPDIV  GK DEII K+Q+ G EILA ++R LT  EA+EFY H A    F++L++F++SGPS +LV++K  G   +I  +RE +GP  ++EAK   P S+RA YG+ ++ NA+HG+ D + A RELAFFFP+F      R    A      V+RTLAL+RP    E RE IL KI+ AGFKVAMQKEV LT+E+  LFY++H+++ +F  L+K M+ G +LALAL KQ AV+ WR +LGPKD ++AKE  P SLRAQF+ E   VN +HGS S E AE E+ +FFP EQT+A IKPD   E+ +EI  +I    F I +++   + + +AEEFY +   + +F+ L+ +M  GP   ++L++E+A+  WR+++GP DP  A++  P S+RA + +DI +NAV+GS N    Q  ++ +FG++
Sbjct:    1 MAGKKKEVSLQVSIGNDEQWGEMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAV------------------------GGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFGEI 564          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 463.766 bits (1192), Expect = 1.963e-152
Identity = 241/495 (48.69%), Postives = 334/495 (67.47%), Query Frame = 3
Query:  120 ELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDE----KVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAK--GDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIAR----VKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGI-ENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHM 1571
            E++  +GL VVDVYQ WCGPC+AVI+ FR++KNE+GDD L+FAVA+AD+I+ LEKYRG+CEP FL Y G  LV V+RGAN P+L+  +  +L +E +V++  ++R   KD  L D E  E     +Q  +  L    R  T+A+IKPDIV  GK DEII K+Q+ G EILA ++R LT  EA+EFY H A    F++L++F++SGPS +LV++K  G   +I  +RE +GP  ++EAK   P S+RA YG+ ++ NA+HG+ D + A RELAFFFP+F      R       E   V+RTLAL+RP    E RE IL KI+ AGFKVAMQKEV LT+E+  LFY++H+++ +F  L+K M+ G +LALAL KQ AV+ WR +LGPKD ++AKE  P SLRAQF+ E   VN +HGS S E AE E+ +FFP EQT+A IKPD   E+ +EI  +I    F I +++   + + +AEEFY +   + +F+ L+ +M
Sbjct:    1 EMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAVAEADSINVLEKYRGKCEPTFLFYAGGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYM 495          

HSP 2 Score: 179.104 bits (453), Expect = 1.782e-47
Identity = 104/297 (35.02%), Postives = 161/297 (54.21%), Query Frame = 3
Query:  975 NVQRTLALVRPAAYTEYR-ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQ----NAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP--------------------VEQTIAAIKPD-GIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIY-GRDINKNAVYGSDNESEVQRVMNLIFGK 1784
            N   T+A+++P      + + I+ KI +AGF++   +E  LT+ EA  FY     +P+F+EL++ MS G    L + K     + +  WR  LGP D+E+AK   P+SLRAQ+  E +  N +HGS   E A  EL +FFP                    VE+T+A I+PD   EN E I  KI  A FK+   K + + +     FYS+  ++EYF  L+  M SGP   + L+++ A+  WR+L+GPKDPK A++  P+S+RA + G     N ++GS +  E ++ ++  F K
Sbjct:  137 NRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETL-FNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPK 432          

HSP 3 Score: 139.043 bits (349), Expect = 3.714e-34
Identity = 79/224 (35.27%), Postives = 130/224 (58.04%), Query Frame = 3
Query:  507 EEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIY-GTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSK 1175
            E +ER  TLALI+PD  +  + + I+AK+ + G ++  Q++  LT E+   FY    + E F  L+K + SGP  +L LA    G +  +R L+GPK   +AKE+ P+S+RA + G +   N +HG+   + A++E++FFFP                 ++TLA+++P    E+R+ ILE+I   GF ++  +E  L++E A  FY +H+DKPFF +L+  M +
Sbjct:  295 EPVER--TLALIRPDTARENR-EMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGP--VLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPK----------------EQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCR 497          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 151.754 bits (382), Expect = 9.422e-40
Identity = 92/275 (33.45%), Postives = 149/275 (54.18%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEF---YSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1739
             S  +RTLA+++P A T+  + I++ I +AG  V   +  +L+ ++AA FY +H+ K FF  L++ +S G ++ + L    AV  WR +LGP D   A++    SLRAQF  +  K N  HGSDS  +A  EL++FFP              + T   IKP  +      +I N I +A F+I  ++  +++++ AEEF   Y     +  +  L+A + SGP   + +   DA R +R   GP DP+ A    P ++RA+YG++  +NAV+ +D
Sbjct:   52 GSQKERTLAMIKPDAVTKVGD-IIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTK-NAGHGSDSMASAARELEFFFPSTAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTE--YTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTD 322          

HSP 2 Score: 144.05 bits (362), Expect = 4.146e-37
Identity = 89/296 (30.07%), Postives = 156/296 (52.70%), Query Frame = 3
Query:  516 EREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQR----TLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1385
            ++E TLA+IKPD V   KV +II  + + G+ +   +   L+ ++A +FY        F +L++F++SGP  ++ L   +A  +  +R+++GP     A++++  S+RA +GT+  +NA HG+D   +A REL FFFP       +   H   N  +    T  +++P A +E     IL  I  AGF+++  +   L +  A  F   +K     +  L+ E+  G  +AL +   +A + +R   GP D E A+ + P +LRA + K  ++ N +H +D  E    E++YFF +
Sbjct:   54 QKERTLAMIKPDAVT--KVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEA--VSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFP-------STAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTEYTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQ-NAVHCTDLPEDGLLEVQYFFKI 337          

HSP 3 Score: 89.3521 bits (220), Expect = 1.112e-18
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T+A IKPD +    +I   I DA   + K +   +    A +FY +   + +FN+L+  + SGP   M L  ++A+  WR ++GP D   A      S+RA +G D  KNA +GSD+ +   R +   F
Sbjct:   56 ERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFF 186          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 150.599 bits (379), Expect = 4.369e-39
Identity = 92/275 (33.45%), Postives = 149/275 (54.18%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEF---YSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1739
             S  +RTLA+++P A T+  + I++ I +AG  V   +  +L+ ++AA FY +H+ K FF  L++ +S G ++ + L    AV  WR +LGP D   A++    SLRAQF  +  K N  HGSDS  +A  EL++FFP              + T   IKP  +      +I N I +A F+I  ++  +++++ AEEF   Y     +  +  L+A + SGP   + +   DA R +R   GP DP+ A    P ++RA+YG++  +NAV+ +D
Sbjct:   86 GSQKERTLAMIKPDAVTKVGD-IIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTK-NAGHGSDSMASAARELEFFFPSTAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTE--YTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTD 356          

HSP 2 Score: 143.28 bits (360), Expect = 1.288e-36
Identity = 89/296 (30.07%), Postives = 156/296 (52.70%), Query Frame = 3
Query:  516 EREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQR----TLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1385
            ++E TLA+IKPD V   KV +II  + + G+ +   +   L+ ++A +FY        F +L++F++SGP  ++ L   +A  +  +R+++GP     A++++  S+RA +GT+  +NA HG+D   +A REL FFFP       +   H   N  +    T  +++P A +E     IL  I  AGF+++  +   L +  A  F   +K     +  L+ E+  G  +AL +   +A + +R   GP D E A+ + P +LRA + K  ++ N +H +D  E    E++YFF +
Sbjct:   88 QKERTLAMIKPDAVT--KVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEA--VSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFP-------STAGHSPPNTAKFSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTEYTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQ-NAVHCTDLPEDGLLEVQYFFKI 371          

HSP 3 Score: 89.3521 bits (220), Expect = 2.098e-18
Identity = 43/131 (32.82%), Postives = 68/131 (51.91%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T+A IKPD +    +I   I DA   + K +   +    A +FY +   + +FN+L+  + SGP   M L  ++A+  WR ++GP D   A      S+RA +G D  KNA +GSD+ +   R +   F
Sbjct:   90 ERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFF 220          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008106.1 (pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 gene:ENSPMAG00000007330.1 transcript:ENSPMAT00000008106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 2.244e-27
Identity = 46/120 (38.33%), Postives = 72/120 (60.00%), Query Frame = 3
Query: 1437 IFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFN 1796
            +   I +A F I   K + + +  A EFY +   Q+YF  L+ HM  GP+  +VL+REDA+  WR L+GP DP  A  T P+S+RA + R + +NA++G+ N    Q  ++L+FG + F+
Sbjct:    7 VLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDAVEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLFGDISFS 126          

HSP 2 Score: 96.6709 bits (239), Expect = 7.759e-24
Identity = 45/117 (38.46%), Postives = 77/117 (65.81%), Query Frame = 3
Query: 1029 ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFF 1379
            +++L  I  AGF +AMQKEV LT+E+A  FY +H+ + +F  L+K M++G  L L L +++AV+ WR ++GP D + A++  P SLRA+F++  ++ N +HG+ +   A+  +   F
Sbjct:    5 DTVLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDAVEEWRRLMGPADPDVARKTAPESLRARFARSLLE-NALHGASNLHHAQENIHLLF 120          

HSP 3 Score: 84.7297 bits (208), Expect = 1.242e-19
Identity = 44/121 (36.36%), Postives = 71/121 (58.68%), Query Frame = 3
Query:  570 VDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 932
             D ++  ++E G  I  Q++  LT E+A+EFY      + F  L+K +  GPS +LVL + DA  + E+R L+GP   D A++ +P+S+RA +  + +ENA+HGA +   AQ  +   F D
Sbjct:    4 ADTVLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDA--VEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLFGD 122          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Sea Lamprey
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 95.5153 bits (236), Expect = 6.730e-23
Identity = 48/139 (34.53%), Postives = 78/139 (56.12%), Query Frame = 3
Query: 1383 VEQTIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLE 1790
            ++ T+A +KPD + +    E +   +L  KF IVK K + +++S +E FY+    + +F  L+  M SGP    VL+  DA+RGWR L+GP     A  T P+SIRA YG    +N  +GSD+ +   + ++  F + +
Sbjct:   10 LQLTLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPEFD 148          

HSP 2 Score: 95.1301 bits (235), Expect = 8.565e-23
Identity = 51/141 (36.17%), Postives = 83/141 (58.87%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAK-LQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMV 941
            ++TLAL+KPD +  G   E + + + +N   I+  ++  L   +++ FY        F+ L++F+ASGP ++ VLA  DA  +  +REL+GP  +  A   +P+SIRA YG     N  HG+D   +A +E++FFFP+F V
Sbjct:   11 QLTLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDA--VRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPEFDV 149          

HSP 3 Score: 92.8189 bits (229), Expect = 5.299e-22
Identity = 48/137 (35.04%), Postives = 77/137 (56.20%), Query Frame = 3
Query:  978 VQRTLALVRPAAYTE--YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            +Q TLAL++P A       E++ + +    F +   KE++L + ++  FY  HK K FF+ L++ M+ G +    L   +AV+GWR ++GP  V +A    P S+RA +   D + N  HGSDS  +A  E+ +FFP
Sbjct:   10 LQLTLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTR-NTTHGSDSSASALQEISFFFP 145          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Sea Lamprey
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-000210-34])

HSP 1 Score: 77.0258 bits (188), Expect = 1.804e-16
Identity = 41/133 (30.83%), Postives = 71/133 (53.38%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T+ AIKPDG++     +I  +      K+V +K +    +L ++ Y D   + +++ L+  M SGP   MV      +R  R ++G  DP    D+ P +IR  +  DI +N ++GSD+E   Q+ ++L F
Sbjct:   21 ERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMKFLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGPVLAMVWEGNGVVRTCRRMLGETDPA---DSAPGTIRGDFCIDIGRNVIHGSDSEESAQKEISLWF 150          

HSP 2 Score: 66.6254 bits (161), Expect = 6.243e-13
Identity = 35/139 (25.18%), Postives = 74/139 (53.24%), Query Frame = 3
Query:  510 EIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 926
            E   E TL  IKPD V+   + +I+ + +  G++++A +     +   ++ Y  + D   +  L++F+ SGP  +L +     G++   R ++G     +  +++P +IR  +  +   N IHG+D  ++AQ+E++ +F
Sbjct:   17 EPRHERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMKFLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGP--VLAMVWEGNGVVRTCRRMLGET---DPADSAPGTIRGDFCIDIGRNVIHGSDSEESAQKEISLWF 150          

HSP 3 Score: 65.0846 bits (157), Expect = 2.111e-12
Identity = 45/143 (31.47%), Postives = 70/143 (48.95%), Query Frame = 3
Query:  981 QRTLALVRP-AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALF---YNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTI 1397
            +RTL  ++P          I+++    G K+   K     K   AL    Y   KDK F+  L++ M+ G +LA+  E    V+  R MLG  D   +    P ++R  F   DI  N+IHGSDS+E+A+ E+  +F  E+ +
Sbjct:   21 ERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMK---FLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGPVLAMVWEGNGVVRTCRRMLGETDPADSA---PGTIRGDFCI-DIGRNVIHGSDSEESAQKEISLWFQPEELV 156          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Yeast
Match: YNK1 (Nucleoside diphosphate kinase; catalyzes the transfer of gamma phosphates from nucleoside triphosphates, usually ATP, to nucleoside diphosphates by a mechanism that involves formation of an autophosphorylated enzyme intermediate; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001550])

HSP 1 Score: 80.1073 bits (196), Expect = 5.967e-18
Identity = 41/138 (29.71%), Postives = 76/138 (55.07%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENE--EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEF 1793
            E+T  A+KPDG++     +I ++     +K+V IK +  +  L E+ Y++   + +F  +++ M+SGP    V   +D +R  R+++G  +P  +    P +IR  +G D+ +N  +GSD+    +R +NL F K E 
Sbjct:    6 ERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSA---PGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEEL 140          

HSP 2 Score: 63.5438 bits (153), Expect = 3.699e-12
Identity = 42/144 (29.17%), Postives = 71/144 (49.31%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTEYRES-ILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTI 1397
            +S  +RT   V+P        S IL +    G+K+   K V+   +     Y +H  KPFF +++  M  G +LA   E ++ V+  R +LG  +   +    P ++R  F   D+  N+ HGSDS ++AE E+  +F  E+ +
Sbjct:    2 SSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSA---PGTIRGDFGI-DLGRNVCHGSDSVDSAEREINLWFKKEELV 141          

HSP 3 Score: 58.5362 bits (140), Expect = 2.099e-10
Identity = 34/137 (24.82%), Postives = 68/137 (49.64%), Query Frame = 3
Query:  516 EREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFF 926
            + E T   +KPD V+ G V +I+++ ++ G +++A +      +  ++ Y        F  ++ F+ SGP  IL        ++ + R ++G         ++P +IR  +G +   N  HG+D  D+A+RE+  +F
Sbjct:    4 QTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGP--ILATVWEGKDVVRQGRTILGA---TNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWF 135          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Yeast
Match: TRX1 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx2p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases iunder DNA replication stress; TRX1 has a paralog, TRX2, that arose from the whole genome duplication [Source:SGD;Acc:S000004033])

HSP 1 Score: 45.4394 bits (106), Expect = 2.460e-6
Identity = 27/91 (29.67%), Postives = 40/91 (43.96%), Query Frame = 3
Query:   93 EINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGD-DFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANP 362
            +  T  E+D  I ++ L+VVD Y  WCGPCK +     +   +    DF    V +    D  +K      P  L++     V  + GANP
Sbjct:    4 QFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELG--DVAQKNEVSAMPTLLLFKNGKEVAKVVGANP 92          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO42234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S268])

HSP 1 Score: 531.176 bits (1367), Expect = 1.738e-177
Identity = 275/572 (48.08%), Postives = 393/572 (68.71%), Query Frame = 3
Query:  147 VVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLE-EIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDA------GIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIF-NKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLE 1838
            +VD Y +WCGPCKA+I+  +R+KNEIGDD L FA+A+ D+IDSLEKYR R +P FL Y   +LV VIRG + P L  TI+ +L+ EHKV++G  ER   K+    +   +E+ +E+ K  +  + ++VT+A+IKPD VKAG V+EII K++E GIE+L  ++R LT EEA EFY     +E F+ L++F++SGP   L L+K         G+I  FRELIGPK ++ AKE +P S+RA+YGT+++ NA+HG D  ++A RELAFFFPDF  P +A  K +   +QRTLAL+RP A    RESI+ KI  AGF++AM KE+ LT+E+A  FY++HKD+ FF+ L+  MS G ++AL L +++A++GWRGMLGPK+VEKAK+  P SLRAQF  ED  +N +HGSD+ E AE E++ FFP++ T+A IKP+   ++ E+   +I +A FKI   K +T+ K LA +FY +   +++F  L  +M SGPT FMVLS+EDA+ GWRSL+GP DP+ A++  P+SIRA  G+D+ KN V+G  +  +  +V+   F + +   DG++     DK E
Sbjct:    1 MVDAYSEWCGPCKAIISSLKRLKNEIGDDLLIFAMAETDSIDSLEKYRMRSQPTFLFYAAGTLVNVIRGCHCPKLLKTIRKELDHEHKVLEGNAERKVVKEEKKEEITPEEEEEEIGKTHDFHLPKQVTVAVIKPDAVKAGLVEEIIRKVEEAGIEVLKMEERTLTREEAAEFYKQHEGTEHFDQLVEFMSSGPLMTLALSKAGETPEALEGVIDNFRELIGPKDVNVAKEEAPNSLRAMYGTDTVMNAVHGCDSNESAARELAFFFPDFAAPTVAN-KRKKRQLQRTLALIRPDALRSRRESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKEVEKAKDEAPESLRAQFQVEDSPINPLHGSDTAENAEKEIQKFFPMQSTVAVIKPEVEPDQRELIKQRIKEAGFKIQLQKEVTLSKELASQFYHEHEGKDFFEGLTDYMSSGPTMFMVLSKEDAVSGWRSLMGPVDPEQAKEMAPESIRAALGKDVMKNVVHGPSDPEKAGKVIKEFFPEAKILPDGTVKKVQPDKAE 571          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO34502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP47])

HSP 1 Score: 160.614 bits (405), Expect = 6.136e-43
Identity = 91/266 (34.21%), Postives = 150/266 (56.39%), Query Frame = 3
Query:  981 QRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQ---------TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSH--QEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1739
            ++TLA+++P A       I+E I+ AGFK+   K V+L ++EA+ FY +H  +PF++ L++ +S G ++A  L+   AV  WR +LGP D   A+   P S+RA+F  ++ K N  HGSDS E+AE E+ +FF   +         T+  +KP  + +     I   I DA F+I  ++   +E++ AEEF+        EY  +++  + SGP   + +  +D  + +R  +GP DP+ A    P S+RA +G+D  KNAV+ +D
Sbjct:   89 EKTLAMIKPDA-VGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTK-NAAHGSDSTESAEREVSFFFDKRRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGVVNEYERNMVEELCSGPCLAVEVRGQDVTKTFRDFVGPADPEIARHLRPKSLRAKFGKDKIKNAVHCTD 352          

HSP 2 Score: 147.517 bits (371), Expect = 1.825e-38
Identity = 90/291 (30.93%), Postives = 159/291 (54.64%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKD--KPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPV 1385
            E TLA+IKPD V  G +  I+  + + G ++   +   L  +EA +FY   A    ++ L++FI+SGP  ++       G +  +R+++GP     A+  +P S+RA +GT++ +NA HG+D  ++A+RE++FFF         R ++ A     TL +V+P A  +     I+  I +AGF+++  +   L +  A  F+  +K     +   +++E+  G  LA+ +  Q+  + +R  +GP D E A+ + P SLRA+F K+ IK N +H +D  E    E++YFF +
Sbjct:   89 EKTLAMIKPDAV--GCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGP--VVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDK-------RRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGVVNEYERNMVEELCSGPCLAVEVRGQDVTKTFRDFVGPADPEIARHLRPKSLRAKFGKDKIK-NAVHCTDLPEDGLLEVEYFFKI 367          

HSP 3 Score: 92.8189 bits (229), Expect = 4.494e-20
Identity = 45/133 (33.83%), Postives = 72/133 (54.14%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGK 1784
            E+T+A IKPD +     I   I  A FK+ + K + + +  A +FY + + Q +++ L+  + SGP     L    A+  WR ++GP D  TA +  P S+RA +G D  KNA +GSD+    +R ++  F K
Sbjct:   89 EKTLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDK 221          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO50065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA5])

HSP 1 Score: 121.324 bits (303), Expect = 2.854e-30
Identity = 68/192 (35.42%), Postives = 111/192 (57.81%), Query Frame = 3
Query:  981 QRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQ---------TIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFY 1523
            ++TLA+++P A       I+E I+ AGFK+   K V+L ++EA+ FY +H  +PF++ L++ +S G ++A  L+   AV  WR +LGP D   A+   P S+RA+F  ++ K N  HGSDS E+AE E+ +FF   +         T+  +KP  + +     I   I DA F+I  ++   +E++ AEEF+
Sbjct:   89 EKTLAMIKPDA-VGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTK-NAAHGSDSTESAEREVSFFFDKRRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFH 278          

HSP 2 Score: 98.9821 bits (245), Expect = 1.397e-22
Identity = 62/205 (30.24%), Postives = 111/205 (54.15%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHK 1133
            E TLA+IKPD V  G +  I+  + + G ++   +   L  +EA +FY   A    ++ L++FI+SGP  ++       G +  +R+++GP     A+  +P S+RA +GT++ +NA HG+D  ++A+RE++FFF         R ++ A     TL +V+P A  +     I+  I +AGF+++  +   L +  A  F+  +K
Sbjct:   89 EKTLAMIKPDAV--GCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGP--VVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDK-------RRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYK 282          

HSP 3 Score: 92.0485 bits (227), Expect = 2.379e-20
Identity = 45/133 (33.83%), Postives = 72/133 (54.14%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGK 1784
            E+T+A IKPD +     I   I  A FK+ + K + + +  A +FY + + Q +++ L+  + SGP     L    A+  WR ++GP D  TA +  P S+RA +G D  KNA +GSD+    +R ++  F K
Sbjct:   89 EKTLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDK 221          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO39201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT1])

HSP 1 Score: 114.39 bits (285), Expect = 1.061e-28
Identity = 64/160 (40.00%), Postives = 98/160 (61.25%), Query Frame = 3
Query:  513 IEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTL 992
            I  E TLALIKPD V   K DEI   + ++G  IL ++  +LT E+  +FY        F  L+ +++SGP   LVLA+ +A  I  +R+LIGP    +A++ +P+S+RAIYGT+S  NA+HG+D   +A +E+ FFFPD +V  ++  +     + RT+
Sbjct:   15 IHIERTLALIKPDAVH--KSDEIEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENA--ISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFFPDSIVEPVSTGQAAKDYLTRTV 170          

HSP 2 Score: 110.538 bits (275), Expect = 2.407e-27
Identity = 51/132 (38.64%), Postives = 80/132 (60.61%), Query Frame = 3
Query: 1383 VEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            +E+T+A IKPD +   +EI   IL   F I++ +R  +      +FY++   + +F  L+A+M SGP   +VL+RE+AI  WR LIGP + + A D  P+S+RAIYG D  +NA++GSD      + ++  F
Sbjct:   17 IERTLALIKPDAVHKSDEIEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFF 148          

HSP 3 Score: 107.842 bits (268), Expect = 2.189e-26
Identity = 53/138 (38.41%), Postives = 85/138 (61.59%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 1382
            A +++RTLAL++P A  +  E I E I   GF +  ++   LT E+ + FY +H  K FF  L+  MS G ++AL L ++NA+  WR ++GP + +KA++  P SLRA +  +  + N +HGSD   +A+ E+ +FFP
Sbjct:   14 AIHIERTLALIKPDAVHKSDE-IEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTR-NALHGSDGTVSADKEIHFFFP 149          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Match: EDO26764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB54])

HSP 1 Score: 100.523 bits (249), Expect = 1.425e-25
Identity = 42/76 (55.26%), Postives = 61/76 (80.26%), Query Frame = 3
Query: 1029 ESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVE 1256
            ESI+ KI  AGF++AM KE+ LT+E+A  FY++HKD+ FF+ L+  MS G ++AL L +++A++GWRGMLGPK+VE
Sbjct:    2 ESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKEVE 77          

HSP 2 Score: 78.1814 bits (191), Expect = 8.982e-18
Identity = 34/74 (45.95%), Postives = 50/74 (67.57%), Query Frame = 3
Query: 1431 EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKD 1652
            E I +KI +A F+I   K + + +  AEEFYS+   QE+F+ L+ +M SGP   + L+REDAI GWR ++GPK+
Sbjct:    2 ESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKE 75          

HSP 3 Score: 60.4622 bits (145), Expect = 1.620e-11
Identity = 31/76 (40.79%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  570 VDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPK 797
             + I++K+QE G EI   ++ +LT E+A+EFY    D E F+ L+  ++SGP   L LA+ DA  I  +R ++GPK
Sbjct:    1 TESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDA--IEGWRGMLGPK 74          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme8 (thioredoxin domain-containing protein 6 [Source:NCBI gene;Acc:101170553])

HSP 1 Score: 468.003 bits (1203), Expect = 5.394e-153
Identity = 239/589 (40.58%), Postives = 372/589 (63.16%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIE--REVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGI--IHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIE-NEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGS 1808
            MA KK+E  LQ  I  Q++W++++  +GL VVDVYQ WCGPCK ++   R+VKNE+GD  L+FA A+AD+I+ L+ +RG+C P FL Y    LVGV++ ANPP+L+ TI  +L +E + +    +    K   ++D E +E  +  +K +  +   +  T+A+IKPD V   K +EII K+QE+G EILA +   LT  EA+ FY H A+   F+DL++F++SG   ILVL+  D+ +  +  + E +GP  + EA+   P+ +RA YGT ++ NA+HG++D + A RELAFFFP+F V +      E   V+RTLAL+RP    E RE IL +I+ AGF V++Q+EV LT+E+  L Y QH ++ +F  L++ M+ G + A+ L  + AV  W+ ++GP D++KAK  +P  LRAQF  E+  ++ IHGS+  E AE E+ +FFP + T+A IK + +E + E I  +I D  F + + K + + + LAEE Y +   + +F  L+ ++  G    +VL++E+A+  WR ++GP DP  A++T  +S+RA +G DI +N+V+GS N    +  + LIFG +   E+ S
Sbjct:    1 MAVKKKEATLQVSITNQKQWEKMLATKGLTVVDVYQKWCGPCKPIVKHLRKVKNELGDVLLHFATAEADSIEDLKMFRGKCIPTFLFYADGMLVGVLQRANPPLLQRTIVKQLAKEKQSLNEGGQHKPIKPFCISDDE-NEDGKLGNKQVMSVPAGKSYTVAIIKPDAVSHRKTNEIIMKIQESGFEILAHKKHKLTEAEARRFYQHKAEEPCFQDLVQFMSSGHCHILVLSHTDSSVSVLPAWLEFMGPTDVSEARRAKPECLRAQYGTETLHNAVHGSEDSNHASRELAFFFPNFRVEQDG----EEERVERTLALIRPGLARENREEILARIHKAGFTVSLQREVMLTEEQVRLLYFQHINEDYFPALLQSMTSGPVAAMVLAGKEAVHHWKNIIGPSDLDKAKAENPECLRAQFPVENEPISHIHGSEDQEAAEREISFFFPKQNTLAVIKHEAMEQHRETILEEIRDRGFSVTQQKEMVLSRELAEELYKEHKEKPFFTKLVDYICQGHCLMLVLTKENAVEEWRVMMGPSDPAKAKETSTESLRARFGSDILQNSVHGSSNVQHAEEEIQLIFGDISNEEELS 584          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:101164143])

HSP 1 Score: 149.443 bits (376), Expect = 1.207e-38
Identity = 95/300 (31.67%), Postives = 160/300 (53.33%), Query Frame = 3
Query:  516 EREVTLALIKPDIV-KAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQR----TLALVRPAAYTE-YRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPF-FEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQT 1394
            ++E TLALIKPD+V K G V E++     N I   A+  R L+  +A +FY        F +L++F++SGP   + +   +A  +  +R+L+GP     A+  +PQSIRA +GT+ ++N  HG++  D A REL FFFP       + + H  SN       T  +++P A ++     IL  I+ AGF+++  +   + +  A  FY  +K     +  ++ E+  G  +AL +   +  + +R   GP D E A+ + PN+LRA + K+ ++ N +H +D  E    E++YFF +  T
Sbjct:   88 KKERTLALIKPDVVTKIGDVMELV--YSSNLIVTKAKMTR-LSWSQAADFYMEHQSKSFFNNLVQFMSSGPVVAMEIMGDEATSV--WRKLLGPADSAAARREAPQSIRAHFGTDGLQNVGHGSESLDAAARELEFFFP-------SAIGHGPSNTATFTDCTCCIIKPHAVSDGLTGKILNSISAAGFEISALQMFNMERVNAEEFYEVYKGVVLEYPGMVTELCSGPCMALEIRGTDTPKTFREFCGPADPEIARHLRPNTLRALYGKDKVR-NAVHCTDLPEDGVLEVQYFFKILDT 374          

HSP 2 Score: 146.362 bits (368), Expect = 1.274e-37
Identity = 86/273 (31.50%), Postives = 143/273 (52.38%), Query Frame = 3
Query:  969 ASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP-------------VEQTIAAIKPDGIEN--EEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEY-FNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSD 1739
             S  +RTLAL++P   T+  + ++E + ++   V   K  +L+  +AA FY +H+ K FF  L++ MS G ++A+ +    A   WR +LGP D   A+   P S+RA F  + ++ N+ HGS+S + A  EL++FFP              + T   IKP  + +    +I N I  A F+I  ++   ME+  AEEFY         +  ++  + SGP   + +   D  + +R   GP DP+ A    P+++RA+YG+D  +NAV+ +D
Sbjct:   86 GSKKERTLALIKPDVVTKIGD-VMELVYSSNLIVTKAKMTRLSWSQAADFYMEHQSKSFFNNLVQFMSSGPVVAMEIMGDEATSVWRKLLGPADSAAARREAPQSIRAHFGTDGLQ-NVGHGSESLDAAARELEFFFPSAIGHGPSNTATFTDCTCCIIKPHAVSDGLTGKILNSISAAGFEISALQMFNMERVNAEEFYEVYKGVVLEYPGMVTELCSGPCMALEIRGTDTPKTFREFCGPADPEIARHLRPNTLRALYGKDKVRNAVHCTD 356          

HSP 3 Score: 80.4925 bits (197), Expect = 1.514e-15
Identity = 41/131 (31.30%), Postives = 66/131 (50.38%), Query Frame = 3
Query: 1386 EQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            E+T+A IKPD +    ++   +  +   + K K   +  S A +FY +   + +FN+L+  M SGP   M +  ++A   WR L+GP D   A    P SIRA +G D  +N  +GS++     R +   F
Sbjct:   90 ERTLALIKPDVVTKIGDVMELVYSSNLIVTKAKMTRLSWSQAADFYMEHQSKSFFNNLVQFMSSGPVVAMEIMGDEATSVWRKLLGPADSAAARREAPQSIRAHFGTDGLQNVGHGSESLDAAARELEFFF 220          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 110.538 bits (275), Expect = 2.899e-27
Identity = 58/163 (35.58%), Postives = 100/163 (61.35%), Query Frame = 3
Query:  960 KHEASNVQRTLALVRP--AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIF 1442
            +H +  +Q TLA+++P   A+    E++ +KI +  FK+   K++   ++++  FY +H  + F++ L++ MS G + A  L +++A++ WRG++GP  V +A+  DPNS+RAQF   D + N  HGSDS E+A+ E+ +FFP   T      D +E EE +F
Sbjct:    6 RHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTR-NTTHGSDSPESAQREISFFFPDFHT-----ADWMEKEEPLF 162          

HSP 2 Score: 102.064 bits (253), Expect = 2.163e-24
Identity = 54/135 (40.00%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 1383 VEQTIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            ++ T+A IKPD + +    E +  KILD  FKIV+ K +  E+  +E+FY++ S + ++  L+  M SGP    VL+REDAIR WR L+GP     A  T P+SIRA +G    +N  +GSD+    QR ++  F
Sbjct:   12 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          

HSP 3 Score: 93.2041 bits (230), Expect = 2.594e-21
Identity = 51/139 (36.69%), Postives = 85/139 (61.15%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEII-AKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            ++TLA+IKPD V    + E +  K+ +N  +I+  +D     +++++FY   +    ++ L++F++SGP +  VLA+ DA  I  +R L+GP  +  A+   P SIRA +G     N  HG+D  ++AQRE++FFFPDF
Sbjct:   13 QLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDA--IRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPDF 149          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 110.538 bits (275), Expect = 2.899e-27
Identity = 58/163 (35.58%), Postives = 100/163 (61.35%), Query Frame = 3
Query:  960 KHEASNVQRTLALVRP--AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIF 1442
            +H +  +Q TLA+++P   A+    E++ +KI +  FK+   K++   ++++  FY +H  + F++ L++ MS G + A  L +++A++ WRG++GP  V +A+  DPNS+RAQF   D + N  HGSDS E+A+ E+ +FFP   T      D +E EE +F
Sbjct:    6 RHLSRVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTR-NTTHGSDSPESAQREISFFFPDFHT-----ADWMEKEEPLF 162          

HSP 2 Score: 102.064 bits (253), Expect = 2.163e-24
Identity = 54/135 (40.00%), Postives = 80/135 (59.26%), Query Frame = 3
Query: 1383 VEQTIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            ++ T+A IKPD + +    E +  KILD  FKIV+ K +  E+  +E+FY++ S + ++  L+  M SGP    VL+REDAIR WR L+GP     A  T P+SIRA +G    +N  +GSD+    QR ++  F
Sbjct:   12 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          

HSP 3 Score: 93.2041 bits (230), Expect = 2.594e-21
Identity = 51/139 (36.69%), Postives = 85/139 (61.15%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEII-AKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            ++TLA+IKPD V    + E +  K+ +N  +I+  +D     +++++FY   +    ++ L++F++SGP +  VLA+ DA  I  +R L+GP  +  A+   P SIRA +G     N  HG+D  ++AQRE++FFFPDF
Sbjct:   13 QLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDA--IRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPDF 149          
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 108.997 bits (271), Expect = 7.929e-27
Identity = 57/157 (36.31%), Postives = 97/157 (61.78%), Query Frame = 3
Query:  978 VQRTLALVRP--AAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIF 1442
            +Q TLA+++P   A+    E++ +KI +  FK+   K++   ++++  FY +H  + F++ L++ MS G + A  L +++A++ WRG++GP  V +A+  DPNS+RAQF   D + N  HGSDS E+A+ E+ +FFP   T      D +E EE +F
Sbjct:   10 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTR-NTTHGSDSPESAQREISFFFPDFHT-----ADWMEKEEPLF 160          

HSP 2 Score: 103.219 bits (256), Expect = 9.210e-25
Identity = 57/137 (41.61%), Postives = 81/137 (59.12%), Query Frame = 3
Query: 1380 PVEQ-TIAAIKPDGIENE---EEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 1778
            PV Q T+A IKPD + +    E +  KILD  FKIV+ K +  E+  +E+FY++ S + ++  L+  M SGP    VL+REDAIR WR L+GP     A  T P+SIRA +G    +N  +GSD+    QR ++  F
Sbjct:    8 PVLQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 144          

HSP 3 Score: 93.5893 bits (231), Expect = 1.937e-21
Identity = 51/139 (36.69%), Postives = 85/139 (61.15%), Query Frame = 3
Query:  522 EVTLALIKPDIVKAGKVDEII-AKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDF 935
            ++TLA+IKPD V    + E +  K+ +N  +I+  +D     +++++FY   +    ++ L++F++SGP +  VLA+ DA  I  +R L+GP  +  A+   P SIRA +G     N  HG+D  ++AQRE++FFFPDF
Sbjct:   11 QLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDA--IRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPDF 147          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 1645.17 bits (4259), Expect = 0.000e+0
Identity = 871/881 (98.86%), Postives = 871/881 (98.86%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVXXXXXXXXXXXXXXXXXXXXXXXXRESPKAEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTXXXXXXXXXXXXXXXXPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRDEIDTNEKSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQT 2699
            MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESNKESINIEETQQETEVTDEKQRESPKAEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNER          SRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQT
Sbjct:    1 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESNKESINIEETQQETEVTDEKQRESPKAEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNER----------SRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQT 871          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 1636.31 bits (4236), Expect = 0.000e+0
Identity = 870/892 (97.53%), Postives = 871/892 (97.65%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVXXXXXXXXXXXXXXXXXXXXXXXXRESPK-----------AEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTXXXXXXXXXXXXXXXXPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRDEIDTNEKSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQT 2699
            MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESNKESINIEETQQETEVTDEKQRESP+           AEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNER          SRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQT
Sbjct:    1 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESNKESINIEETQQETEVTDEKQRESPRLFNSSERIMMEAEVSETLEDEDLKNKSQITQENEETNVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPDSTQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNER----------SRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKTQNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENPDKTESENVDVDIDQTNNNLNADETENTKDQT 882          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000065659.1 (SMESG000065659.1)

HSP 1 Score: 540.421 bits (1391), Expect = 1.749e-180
Identity = 277/576 (48.09%), Postives = 388/576 (67.36%), Query Frame = 3
Query:   84 LQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1811
             Q  INT++EW+ELI  EGL V+DVYQDW  PCK ++ F  R+K ++ D  LNFAVAK++TI+SLEKYRGRCEPCFLIYG   LVGVIRG NPP LE  IK KLEEEH  MKG  ER E KD F    E  +  +E+ KD EE   E+ L +IKP I+  GK+ EII+ + +NGI IL ++++ +T EEA + Y H+ +++    LIKFI S     ++L K +  II+E R L+GPK LD+AK   P SIRA+Y  +++ENAIH  +DR++ +REL+ F+PDF+ P I   ++   N+Q T+A++RP+AY E++E I+  I    F++  Q E + T+ EA  FY  +    + E+LI EM +G  L L L +++AV  WR ++G KD+  A + +P  LRA +SK +I +NLIHGSDS ETAE ELKYFFP+EQTI AIKPD  +N +EI   I +  FKI   K + + K   +  Y    ++ Y++DL+ +M  G + F++LS++DA++ WR++IGP DP+ A +  PD  RA+YGRDI +NA+YGS ++ EV  +M +IFG L FN+DGS+
Sbjct:    7 FQKLINTEDEWEELIFNEGLQVIDVYQDWSSPCKPIVKFLWRLKTQLNDKILNFAVAKSNTIESLEKYRGRCEPCFLIYGNGILVGVIRGCNPPSLEILIKTKLEEEHLAMKGLGERMEIKDPFFKYMEELKLEEEMAKDFEEAPAEIVLVIIKPGIIYEGKLPEIISIIVDNGITILKEEEKYMTEEEAGQLYEHLQNTDFHHGLIKFITSENCYFMILMKENE-IINELRNLVGPKSLDDAKTFYPNSIRALYAKSTLENAIHCGEDRESCERELSIFYPDFVAPLIKLRRNLMENIQTTVAIIRPSAYKEFKEKIINSIVENEFEILRQDEFKFTRNEAEKFYEVNMMGDYLEDLILEMIEGPFLVLLLSRKDAVNKWRTLIGSKDLTFASKCEPECLRALYSKSNIFINLIHGSDSVETAEKELKYFFPIEQTIGAIKPDSYDNRDEIIELINEFGFKISMTKELILTKEQIDTMYQKDKYKSYYSDLVRYMTGGKSLFLILSKQDAVKEWRNVIGPTDPEVAVEENPDYFRALYGRDILENAIYGSSDKEEVSTMMKMIFGDLIFNDDGSI 581          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000006982.1 (SMESG000006982.1)

HSP 1 Score: 350.903 bits (899), Expect = 4.672e-107
Identity = 208/589 (35.31%), Postives = 318/589 (53.99%), Query Frame = 3
Query:   57 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKD-KPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLG---PKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1811
            M  KK +      +  QE WD+L+K +GL V D+YQ+W GPCK+V++ F ++  E+  D + FA  K D++ SL  Y+G+CEP FLI GG  LVGVIRG+N P++  T   K  EE KVM+GEMER   +DS +   E  E V   +   E  E E+T A+IKPD +   K++E+I  ++E    I+ ++ R L+ EE    Y      +I E+   F+ SG   I+ L       + + RE+ GPK ++ AK +SP S+RAIYG    +NAIH A+ R+ A + ++  FPD +  K      ++   +R + L+    Y E + SI+ +  +A  KV  Q E  L K      Y +  + +  FEE ++E +      +  E +N +     MLG   P+D       D +  +      DI  +L++ S   E A+ +  YFFP++ T A IKPD  E  +EI   I    F +  +  I +  + AEE Y +     YF+ +I ++ S  +  MVLS+ DAIR WR  IG  +P+ A +  PD +R I+G  I +NA++GS +  +V R +NL+FG  +F+E G+L
Sbjct:    1 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVL-AETVYEFTEGEMTFAIIKPDAIVNNKMNEMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDS---ERVVILLPERIYIEDKNSIINQFTDADLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEETNGSVFYVICFECKNCINIVNYMLGLYIPED-------DMDYRKLTVRDMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNL 577          
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000006982.1 (SMESG000006982.1)

HSP 1 Score: 328.176 bits (840), Expect = 5.175e-99
Identity = 197/559 (35.24%), Postives = 301/559 (53.85%), Query Frame = 3
Query:  147 VVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVXXXXXXXXXXXXHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQH-KDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLG---PKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 1811
            V D+YQ+W GPCK+V++ F ++  E+  D + FA  K D++ SL  Y+G+CEP FLI GG  LVGVIRG+N P++  T   K  EE KVM+GEMER   +DS +   E  E V   +   E  E E+T A+IKPD +   K++E+I  ++E    I+ ++ R L+ EE    Y      +I E+   F+ SG   I+ L       + + RE+ GPK ++ AK +SP S+RAIYG    +NAIH A+ R+ A + ++  FPD +  K      ++   +R + L+    Y E + SI+ +  +A  KV  Q E  L K      Y +    +  FEE ++E +      +  E +N +     MLG   P+D       D +  +      DI  +L++ S   E A+ +  YFFP++ T A IKPD  E  +EI   I    F +  +  I +  + AEE Y +     YF+ +I ++ S  +  MVLS+ DAIR WR  IG  +P+ A +  PD +R I+G  I +NA++GS +  +V R +NL+FG  +F+E G+L
Sbjct:    5 VADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVL-AETVYEFTEGEMTFAIIKPDAIVNNKMNEMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDS---ERVVILLPERIYIEDKNSIINQFTDADLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEETNGSVFYVICFECKNCINIVNYMLGLYIPED-------DMDYRKLTVRDMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNL 551          
The following BLAST results are available for this feature:
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NME81.582e-11034.39NME/NM23 family member 8 [Source:HGNC Symbol;Acc:H... [more]
NME81.582e-11034.39NME/NM23 family member 8 [Source:HGNC Symbol;Acc:H... [more]
NME93.543e-8348.00NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
NME91.781e-6040.29NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
NME91.781e-6040.29NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndk-18.992e-1428.47Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-18.992e-1428.47Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-18.992e-1428.47Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-18.992e-1428.47Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
Y48G8AL.159.802e-829.55pep chromosome:WBcel235:I:1254770:1258258:1 gene:W... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG181301.441e-2039.81gene:FBgn0030359 transcript:FBtr0073581[more]
nmdyn-D63.987e-2037.59gene:FBgn0030573 transcript:FBtr0073933[more]
CG142211.288e-1633.01gene:FBgn0031042 transcript:FBtr0332485[more]
awd4.050e-1328.26gene:FBgn0000150 transcript:FBtr0346150[more]
awd4.050e-1328.26gene:FBgn0000150 transcript:FBtr0339146[more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme88.163e-14947.20NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme74.589e-3632.73NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme51.170e-2337.78NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme69.403e-2134.06NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme2b.21.009e-1633.79NME/NM23 nucleoside diphosphate kinase 2b, tandem ... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme91.113e-17946.17NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme91.403e-17946.17NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme92.021e-17645.39NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme91.849e-16343.30NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme76.977e-4336.00NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nme88.713e-10433.05NME/NM23 family member 8 [Source:MGI Symbol;Acc:MG... [more]
Nme85.288e-8033.83NME/NM23 family member 8 [Source:MGI Symbol;Acc:MG... [more]
Nme91.232e-7445.30NME/NM23 family member 9 [Source:MGI Symbol;Acc:MG... [more]
Nme71.178e-3730.22NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
Nme71.178e-3730.22NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95YJ5|TXND3_CIOIN0.000e+045.03Thioredoxin domain-containing protein 3 homolog OS... [more]
sp|P90666|TXND3_HELCR2.634e-13047.03Thioredoxin domain-containing protein 3 homolog OS... [more]
sp|Q8N427|TXND3_HUMAN7.597e-11034.39Thioredoxin domain-containing protein 3 OS=Homo sa... [more]
sp|Q715S9|TXND3_RAT2.655e-10334.23Thioredoxin domain-containing protein 3 OS=Rattus ... [more]
sp|Q715T0|TXND3_MOUSE6.095e-10333.05Thioredoxin domain-containing protein 3 OS=Mus mus... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203037300.000e+054.16tr|A0A1S3IQQ0|A0A1S3IQQ0_LINUN thioredoxin domain-... [more]
gnl|BL_ORD_ID|234951430.000e+053.56tr|A0A210QRC6|A0A210QRC6_MIZYE Thioredoxin domain-... [more]
gnl|BL_ORD_ID|203337600.000e+053.05tr|A0A1S3ISM9|A0A1S3ISM9_LINUN thioredoxin domain-... [more]
gnl|BL_ORD_ID|203236860.000e+052.87tr|A0A1S3IRI1|A0A1S3IRI1_LINUN thioredoxin domain-... [more]
gnl|BL_ORD_ID|203070030.000e+052.87tr|A0A1S3IR48|A0A1S3IR48_LINUN thioredoxin domain-... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme80.000e+047.28thioredoxin domain-containing protein 3 homolog [S... [more]
nme84.683e-16644.56thioredoxin domain-containing protein 3 homolog [S... [more]
nme81.963e-15248.69thioredoxin domain-containing protein 3 homolog [S... [more]
nme79.422e-4033.45NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
nme74.369e-3933.45NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008106.12.244e-2738.33pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 ... [more]
nme66.730e-2334.53NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme31.804e-1630.83NME/NM23 nucleoside diphosphate kinase 3 [Source:Z... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YNK15.967e-1829.71Nucleoside diphosphate kinase; catalyzes the trans... [more]
TRX12.460e-629.67Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422341.738e-17748.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345026.136e-4334.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500652.854e-3035.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392011.061e-2840.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267641.425e-2555.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme85.394e-15340.58thioredoxin domain-containing protein 6 [Source:NC... [more]
nme71.207e-3831.67NME/NM23 family member 7 [Source:NCBI gene;Acc:101... [more]
nme62.899e-2735.58NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme62.899e-2735.58NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme67.929e-2736.31NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043677.10.000e+098.86SMESG000043677.1[more]
SMESG000043677.10.000e+097.53SMESG000043677.1[more]
SMESG000065659.11.749e-18048.09SMESG000065659.1[more]
SMESG000006982.14.672e-10735.31SMESG000006982.1[more]
SMESG000006982.15.175e-9935.24SMESG000006982.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005553 ID=SMED30005553|Name=Thioredoxin domain-containing protein 3-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3159bp
GGCTTTTATTGTAATTATCTTAAATTTATCAAATAGAATTTTTTTCAATT
TAAATAATGGCAAGAAAGAAGCAAGAAATCGCATTACAAGCAGAGATTAA
TACTCAAGAAGAATGGGATGAATTAATAAAAAAGGAAGGATTACTTGTTG
TTGACGTTTATCAAGATTGGTGTGGCCCATGCAAAGCAGTAATAAATTTT
TTCAGGAGAGTAAAAAATGAAATTGGTGACGATTTTCTCAATTTTGCAGT
GGCAAAAGCAGATACGATAGATTCACTAGAGAAATATCGCGGAAGATGTG
AACCATGCTTTTTAATTTATGGAGGTAGATCTTTGGTTGGAGTTATAAGA
GGAGCAAACCCCCCGGTTCTGGAAACAACAATTAAATTAAAGTTAGAGGA
AGAGCATAAAGTGATGAAAGGGGAAATGGAAAGAAATGAAACTAAAGATT
CTTTCTTAGCAGATTTCGAAACTGACGAAAAAGTCCAAGAAGTCGACAAA
GATTTAGAAGAAATCGAACGAGAAGTGACTCTGGCTCTCATCAAGCCTGA
CATTGTCAAAGCGGGAAAGGTCGACGAAATAATAGCTAAATTACAAGAGA
ACGGAATTGAAATTTTGGCTCAACAGGATCGTAATTTGACTATCGAAGAA
GCCAAAGAATTTTATCATCACATGGCTGACTCGGAGATCTTTGAGGATTT
AATCAAATTCATTGCGTCAGGCCCGAGTAAAATATTGGTCCTTGCCAAAG
GGGACGCCGGAATAATTCACGAATTCAGAGAACTCATTGGCCCGAAATTT
CTCGACGAAGCTAAAGAAAATTCACCACAAAGTATTCGAGCTATTTATGG
CACAAATTCCATTGAAAACGCAATTCACGGAGCTGATGACAGAGATACTG
CACAACGGGAGTTGGCATTTTTCTTTCCTGACTTCATGGTTCCAAAAATT
GCACGTGTAAAGCACGAAGCAAGCAATGTTCAAAGAACTTTAGCGCTTGT
TCGGCCTGCAGCTTACACAGAGTATCGTGAAAGTATTCTAGAGAAAATCA
ACAACGCTGGGTTTAAAGTTGCAATGCAAAAAGAAGTTCAACTTACCAAA
GAAGAAGCAGCTTTATTTTACAATCAACACAAAGACAAACCCTTCTTTGA
AGAGTTGATTAAAGAAATGTCCAAAGGAACATTGTTGGCACTTGCATTGG
AAAAACAAAATGCAGTTCAAGGCTGGAGAGGAATGTTAGGGCCAAAAGAC
GTCGAAAAAGCAAAGGAAATTGATCCGAATTCACTGCGAGCACAATTTTC
TAAAGAAGACATTAAAGTCAATTTGATTCACGGTTCAGATTCAGATGAAA
CAGCAGAGACTGAATTGAAATATTTCTTCCCAGTTGAACAAACAATTGCT
GCAATTAAGCCCGATGGAATAGAAAATGAAGAGGAGATCTTTAACAAGAT
TCTCGATGCTAAATTCAAAATCGTTAAAATTAAAAGAATTACTATGGAAA
AATCGCTTGCTGAAGAGTTCTATTCTGATCAGTCTCATCAAGAATATTTC
AATGATCTCATTGCTCACATGGAGAGTGGACCAACATACTTTATGGTTTT
ATCTCGAGAAGATGCCATTAGAGGATGGAGATCCCTCATTGGACCTAAAG
ATCCTAAAACAGCAGAAGATACATATCCTGATAGTATTCGAGCTATTTAT
GGACGAGATATCAATAAAAATGCAGTATATGGAAGTGACAATGAAAGTGA
AGTTCAAAGAGTTATGAACTTGATATTTGGCAAATTGGAATTCAACGAAG
ACGGAAGTTTGTTACCAGAATATGAAGACAAACTCGAAGTTGTTGAAGAA
TCAAATAAAGAATCGATAAATATCGAAGAGACCCAACAAGAGACAGAAGT
TACTGATGAAAAACAAAGAGAATCTCCAAAGGCTGAAGTGTCGGAAACAT
TAGAAGATGAAGATTTGAAAAATAAATCCCAAATTACACAAGAAAATGAA
GAAACAAATGTAGGAGAAAAAGAAAATTCCGAAGAACCTGATTCAACACA
TTTAGAAACTACAGAAAATGTTGAGGACAGCCAGGAAACCTCTCATAAAA
CAGACGAAAATAAAAGTTCGAATGAAAAATCTGAAAAATCAGAGGATAAA
CCTGATTCAACACAAGATGAAACGAAAAATAATGAAAGTCACGAAGAGTT
AGTAAAAGAGCAAACAACTAATGAAACAAAAGAGGAAATTACAGTGGCTG
ATGATTCGGTTGTAAGTGAATTGGAAACTAAAGGCAGTAATGAAAGGTCT
AGAGATGAAATTGATACAAATGAAAAGTCCCGAGACGAAATTGATACAAA
TGAAAAGTCTCGAGACGAAATTGATACAGATGAAAAGTTTCGAGACGAAA
TTGACACAAATGAAAAGTCTCAAGACGAAATTGATACAAATGAAAGAAGT
AAAACTCAAAACGATAGCAAGGAACAAGAGGAAAGTGACGTAACCGCTAA
AAATGAAAGTACGAATAGAGATGAGAAAGACTTAGACGAATCTGCGGTAG
AAAATTCTGAAATCGAAAATGCTACTAGTAATGTAATACAAGAGACGGAA
AATCCTGATAAAACGGAAAGTGAAAACGTAGATGTGGATATAGATCAGAC
TAATAATAACTTGAATGCTGATGAAACGGAAAACACCAAAGATCAAACAG
AAGTGGATGATGAGGAATATTCTGAAAATAATGAGTCTGAAATAATAGGC
GACGATGATGTAGAAAACCTTGAATCAGTGAAAGATGACGATGAATCCAG
TGAAAAAAATGATAAATCTGTTAAAGATCAGGACAATGAAAACCAAATTG
ATAACGATAATATGGTTCAAATTGATGAAGAAGAAGAAAAATTGACATCA
TTGGAAGATGATAATGCGGTTCCATTGGATAACGACGGAATCGAGTCGGA
CAATTTATTGTCCGACACTTCGTTAAACGATGAAAGAGTTGACCTTACCG
AAGGTGGGATACGAATTCGATTTGGATGTAGTTCAGTTTACTCACTTCTA
CTAAAAATAGTTTTATGAATATCTAGATGTGTTCATTGAATTTAGATTGA
ATATTATAATAATTATAATCGTGTTTTAATTAATTTTAATTAAATTTTTA
TTTATGTTT
back to top

protein sequence of SMED30005553-orf-1

>SMED30005553-orf-1 ID=SMED30005553-orf-1|Name=SMED30005553-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1004bp
MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFR
RVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGA
NPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDL
EEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAK
EFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLD
EAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIAR
VKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEE
AALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVE
KAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAI
KPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFND
LIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGR
DINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSLLPEYEDKLEVVEESN
KESINIEETQQETEVTDEKQRESPKAEVSETLEDEDLKNKSQITQENEET
NVGEKENSEEPDSTHLETTENVEDSQETSHKTDENKSSNEKSEKSEDKPD
STQDETKNNESHEELVKEQTTNETKEEITVADDSVVSELETKGSNERSRD
EIDTNEKSRDEIDTNEKSRDEIDTDEKFRDEIDTNEKSQDEIDTNERSKT
QNDSKEQEESDVTAKNESTNRDEKDLDESAVENSEIENATSNVIQETENP
DKTESENVDVDIDQTNNNLNADETENTKDQTEVDDEEYSENNESEIIGDD
DVENLESVKDDDESSEKNDKSVKDQDNENQIDNDNMVQIDEEEEKLTSLE
DDNAVPLDNDGIESDNLLSDTSLNDERVDLTEGGIRIRFGCSSVYSLLLK
IVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR034907NDK-like_dom
IPR036850NDK-like_dom_sf
IPR036249Thioredoxin-like_sf
IPR011528NERD
IPR001564Nucleoside_diP_kinase
IPR012336Thioredoxin-like_fold
IPR013766Thioredoxin_domain
IPR017937Thioredoxin_CS
Vocabulary: molecular function
TermDefinition
GO:0004550nucleoside diphosphate kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006165nucleoside diphosphate phosphorylation
GO:0006183GTP biosynthetic process
GO:0006241CTP biosynthetic process
GO:0006228UTP biosynthetic process
GO:0045454cell redox homeostasis
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 110..130
NoneNo IPR availableCOILSCoilCoilcoord: 143..163
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 739..818
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 850..864
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 823..838
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 599..732
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 868..899
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 599..958
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 900..920
NoneNo IPR availablePANTHERPTHR46135FAMILY NOT NAMEDcoord: 1..579
NoneNo IPR availableCDDcd02948TRX_NDPKcoord: 11..109
e-value: 1.00665E-45
score: 157.112
NoneNo IPR availableCDDcd04416NDPk_TXcoord: 309..441
e-value: 6.45257E-46
score: 158.913
IPR001564Nucleoside diphosphate kinasePRINTSPR01243NUCDPKINASEcoord: 158..180
score: 41.23
coord: 202..221
score: 28.23
coord: 271..290
score: 45.56
IPR034907Nucleoside diphosphate kinase-like domainSMARTSM00562ndk_5coord: 443..581
e-value: 1.1E-44
score: 164.4
coord: 308..442
e-value: 1.9E-45
score: 167.0
coord: 155..297
e-value: 5.7E-44
score: 162.1
IPR034907Nucleoside diphosphate kinase-like domainPFAMPF00334NDKcoord: 309..442
e-value: 4.0E-36
score: 124.0
coord: 444..578
e-value: 9.3E-35
score: 119.6
coord: 156..292
e-value: 1.4E-33
score: 115.7
IPR036850Nucleoside diphosphate kinase-like domain superfamilyGENE3DG3DSA:3.30.70.141coord: 146..301
e-value: 6.8E-41
score: 141.5
coord: 302..443
e-value: 4.7E-44
score: 151.7
coord: 444..584
e-value: 4.5E-42
score: 145.3
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 442..580
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 308..442
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 155..293
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 14..102
e-value: 5.6E-9
score: 35.9
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 1..184
score: 8.511
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 3..121
e-value: 3.1E-15
score: 57.8
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 13..106
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 31..49