Spectrin alpha chain

Overview
NameSpectrin alpha chain
Smed IDSMED30005551
Length (bp)7879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spectrin alpha chain (SMED30005551) t-SNE clustered cells

Violin plots show distribution of expression levels for Spectrin alpha chain (SMED30005551) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spectrin alpha chain (SMED30005551) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spectrin alpha chain (SMED30005551) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005551

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005551SMESG000005289.1 Contig37746uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005551SMESG000005289.1 Contig37746newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005551SMESG000005289.1 Contig6787uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005551SMESG000005289.1 Contig6787newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30005551SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005551SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30005551SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30005551SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30005551SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30005551SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005551SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30005551SMESG000005289.1 dd_Smed_v6_919_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005551SMESG000005289.1 dd_Smed_v4_919_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 2687.91 bits (6966), Expect = 0.000e+0
Identity = 1378/2475 (55.68%), Postives = 1782/2475 (72.00%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEK--IEGI-----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  D+   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   +++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++NQY +LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++  + G+                             I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W+ L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIK+KL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+   HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LV SEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKE-AALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGK-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2452          

HSP 2 Score: 250.751 bits (639), Expect = 1.064e-65
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      ++SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +G   SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++    +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQ--IQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 2682.13 bits (6951), Expect = 0.000e+0
Identity = 1378/2480 (55.56%), Postives = 1782/2480 (71.85%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEK--IEGI-----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  D+   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   +++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++NQY +LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++  + G+                             I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W+ L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIK+KL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+   HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LV SEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKE-AALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGK-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2457          

HSP 2 Score: 250.751 bits (639), Expect = 1.093e-65
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      ++SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +G   SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++    +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQ--IQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 2679.43 bits (6944), Expect = 0.000e+0
Identity = 1378/2495 (55.23%), Postives = 1782/2495 (71.42%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEK--IEGI-----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  D+   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   +++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++NQ                    Y +LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++  + G+                             I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W+ L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIK+KL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+   HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LV SEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKE-AALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGK-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2472          

HSP 2 Score: 251.521 bits (641), Expect = 7.336e-66
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      ++SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +G   SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++    +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQ--IQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 2671.34 bits (6923), Expect = 0.000e+0
Identity = 1378/2500 (55.12%), Postives = 1782/2500 (71.28%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEK--IEGI-----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  D+   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   +++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++NQ                    Y +LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++  + G+                             I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W+ L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIK+KL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+   HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LV SEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKE-AALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGK-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2477          

HSP 2 Score: 251.136 bits (640), Expect = 8.200e-66
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      ++SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +G   SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++    +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQ--IQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. Ensembl Human
Match: SPTAN1 (spectrin alpha, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11273])

HSP 1 Score: 2664.8 bits (6906), Expect = 0.000e+0
Identity = 1379/2521 (54.70%), Postives = 1783/2521 (70.73%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEK--IEGI-----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGI---------------------------GTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  D+   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   +++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++NQ                    Y +LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++  + G+                             I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W+ L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIK+KL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+   HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LV SEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++GI                           GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKE-AALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGK-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGIAYRRVIRVYQYEVGDDLSGRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2498          

HSP 2 Score: 250.751 bits (639), Expect = 1.110e-65
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      ++SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +G   SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++    +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQ--IQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. Ensembl Celegans
Match: spc-1 (SPeCtrin [Source:UniProtKB/TrEMBL;Acc:G4S034])

HSP 1 Score: 2582.75 bits (6693), Expect = 0.000e+0
Identity = 1309/2434 (53.78%), Postives = 1779/2434 (73.09%), Query Frame = 1
Query:   55 KEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQI-TVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLA--NPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISE-SGQPIPDAYDYRAFTGHLFQN 7344
            +EI+ILET +DI +RR++VL  YS FK+ ++ +R +LE+A+++QYFKRDADEL  WILEK+QT  +ENF+D +NLQ+K QKH+A E E+ A ++ +  LDK G  MI+++H+ASE I+ RL++LHALW+KL    K+K   L+  L  + F+R+ DEIL+W +EKET+VT+E+ G DLEHVE+LQ+KF++F+K+L   + +  EI   AD L++E   E + +  K+ DV DA  RL  LA  R++ LF AH++Q+F RD D+T++W+ EK + L+S+D+GRDL +VQAL+RKHE  +RDL ALE K+ QL K+A +L+  HPD  + I  K +   +AW+ LK+K+  R + L+ S+ LHRFL+DYRDL+SW+ DMKAVI ADELAKDVAG EAL+E H EHK EID+R +SF    + G++L+ M  P S ++  KLE+LD E+  L+ LW ERR+LYEQ MDLQLFYRDTEQAE W+ KQEAFL N D+GDSLDSVE LI+KHEDFEKSLAAQEEK   LD  A +L++  HYAA DV ++R  LL R+  L ++A+ R ++L++S+  Q FDRD DE+ +WI EKL TA D++Y +PTN++ K+QKH NF  E+ ANE+R+DD+++ G+ ++DS H  ++ I +R+ +++ LWN+LV A+  K   L +A  +QQF RN+ED+E WL+E+E Q+AS+D GKDL SV NLQKK  L+E+D ++H DR+D   Q A QF +E+HF+A  I +KQ  +  RY  L++PL+KRK KL ++++ +Q +RD +DE  WI EKE +AGSTN GRDLIGVQNLIKK QA+ AEI  H+ +I  V +    MI   H+   +I  K+  +++ W  LK+KA+KR+  LDDSL+A QYL+DA+EA++WM EKEP+VGST++GKDEDS EALLKKH AL++D+EA++ TI+ LR QA  CK QE P+    G++ V+ALYDYQEK+PREVSM+KGDVLTLLN++++DWWKVE+NDRQG VPAAYVK+++   +    +A +Q+ ++  +Q  +E++Y+ L+ LG  R+ +L+++ + YQL+REANDL +W+  +E VA  + I    LE V+  +KK D+F  + K  E +++E+   A  L   GQTE   +I   I  L  ++  LEE T ++ + L   + VQR+HR+ DE ++WI+EKD  L++ D G+DL SVQ L RKH+ +ERDL ALG+++K LD KA  L Q+HP  AE I   Q E+NE WN+LT+KA + K KL +S D Q+FL+DYRDLM WI +MN LVSS ELA DVTGAEALLERH                      +E+  EID+R+ TFQ F+ FG +LL + HYA  +I+ +LQ + +A++ L + W+ R+  LDQCLELQL+ RDCEQA+ WM+ RE+ L  ED     V+SLIKKHEDF++AIN QE+K++ LK FA+ L+++ HYD   +  K  ++L RW  LKE +I  R +LG+ QTLQ F RDADE+E W+ EK Q   +E+Y+DP TNIQ KHQK QAFEAEL AN++R+ +I+ +G  L E  +C G E AV  R+  L DQWD LV  + +KS +L+EAN+Q  + A +KD+EFWLGEVE  L S DYGKD ASV++LL KH +L  DI AH+DR+ ++NE+AD  +E+       I ER+K+I +RY+ VK++A +R   L KA  +H F+R IDDEE+WI+EKK+LVSS+DYGRDL GV+NL++KH+R++ E+ +HEP +  V+ +G EL+  +  A    D+IK+++E LE +W +++ L+  R  +L+ES  +Q FL  VEEEEAW+ EKQ +L S ++G+ +A VQGLLKKHD F+ D+++H+ +  D+ N+G  LI + NH+A  I+QRC+ LR +L  +   A  R   L DNSA+LQFMWK DVVESWIA+KE QV+S+D+GRDLSSVQ LLTK E FD GL +F  EGI+ IT L +QL+ S H QS AI+ R+ N++ RW  L   S+ R+  LLK+Q+++K++EELYL FAKKAS FNSWFENAEEDLTDPVRCNSLEEI+AL +AH  F+ SL +AEEDF  L  LD+ I+S+ VG NPYTWFTM+ALE+TW+NLQRII+ER+ EL RE +RQEEND LR+EFA +A+ FH WL   R  +ME  GTLEEQL+A + K+KE+K  K  L+QIEEKGA+LE  LILDNR+TEHSTVG++QAWDQLDQLAMRM HNLEQQIQARN SGVSEEALREFSMMFKHFDK+K+GRLDH++FKSCLRALG DL  V+EGQ +PEF+ IL +VDPNRDG+VTLQE+MAFMIS+ETEN+QS +E+E AF AL+KE +PY+T +ELYANLT +QAEFC+R M PY+   SG+ I    DY  F   LFQ+
Sbjct:   21 QEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWDKLFFKLKDKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAERRQALLDRRRRLLDRARQRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMG-QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTA--QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTD-LEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALEEQTEQREQQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERH----------------------QEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDP-TNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRQKLLKMQQQFKQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALFQS 2427          
BLAST of Spectrin alpha chain vs. Ensembl Celegans
Match: spc-1 (SPeCtrin [Source:UniProtKB/TrEMBL;Acc:G4S034])

HSP 1 Score: 2576.59 bits (6677), Expect = 0.000e+0
Identity = 1309/2440 (53.65%), Postives = 1780/2440 (72.95%), Query Frame = 1
Query:   55 KEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQI-TVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWV------VEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLA--NPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISE-SGQPIPDAYDYRAFTGHLFQN 7344
            +EI+ILET +DI +RR++VL  YS FK+ ++ +R +LE+A+++QYFKRDADEL  WILEK+QT  +ENF+D +NLQ+K QKH+A E E+ A ++ +  LDK G  MI+++H+ASE I+ RL++LHALW+KL    K+K   L+  L  + F+R+ DEIL+W +EKET+VT+E+ G DLEHVE+LQ+KF++F+K+L   + +  EI   AD L++E   E + +  K+ DV DA  RL  LA  R++ LF AH++Q+F RD D+T++W+ EK + L+S+D+GRDL +VQAL+RKHE  +RDL ALE K+ QL K+A +L+  HPD  + I  K +   +AW+ LK+K+  R + L+ S+ LHRFL+DYRDL+SW+ DMKAVI ADELAKDVAG EAL+E H EHK EID+R +SF    + G++L+ M  P S ++  KLE+LD E+  L+ LW ERR+LYEQ MDLQLFYRDTEQAE W+ KQEAFL N D+GDSLDSVE LI+KHEDFEKSLAAQEEK   LD  A +L++  HYAA DV ++R  LL R+  L ++A+ R ++L++S+  Q FDRD DE+ +WI EKL TA D++Y +PTN++ K+QKH NF  E+ ANE+R+DD+++ G+ ++DS H  ++ I +R+ +++ LWN+LV A+  K   L +A  +QQF RN+ED+E WL+E+E Q+AS+D GKDL SV NLQKK  L+E+D ++H DR+D   Q A QF +E+HF+A  I +KQ  +  RY  L++PL+KRK KL ++++ +Q +RD +DE  WI EKE +AGSTN GRDLIGVQNLIKK QA+ AEI  H+ +I  V +    MI   H+   +I  K+  +++ W  LK+KA+KR+  LDDSL+A QYL+DA+EA++WM EKEP+VGST++GKDEDS EALLKKH AL++D+EA++ TI+ LR QA  CK QE P+    G++ V+ALYDYQEK+PREVSM+KGDVLTLLN++++DWWKVE+NDRQG VPAAYVK+++   +    +A +Q+ ++  +Q  +E++Y+ L+ LG  R+ +L+++ + YQL+REANDL +W+       E+ + A  E+ T   LE V+  +KK D+F  + K  E +++E+   A  L   GQTE   +I   I  L  ++  LEE T ++ + L   + VQR+HR+ DE ++WI+EKD  L++ D G+DL SVQ L RKH+ +ERDL ALG+++K LD KA  L Q+HP  AE I   Q E+NE WN+LT+KA + K KL +S D Q+FL+DYRDLM WI +MN LVSS ELA DVTGAEALLERH                      +E+  EID+R+ TFQ F+ FG +LL + HYA  +I+ +LQ + +A++ L + W+ R+  LDQCLELQL+ RDCEQA+ WM+ RE+ L  ED     V+SLIKKHEDF++AIN QE+K++ LK FA+ L+++ HYD   +  K  ++L RW  LKE +I  R +LG+ QTLQ F RDADE+E W+ EK Q   +E+Y+DP TNIQ KHQK QAFEAEL AN++R+ +I+ +G  L E  +C G E AV  R+  L DQWD LV  + +KS +L+EAN+Q  + A +KD+EFWLGEVE  L S DYGKD ASV++LL KH +L  DI AH+DR+ ++NE+AD  +E+       I ER+K+I +RY+ VK++A +R   L KA  +H F+R IDDEE+WI+EKK+LVSS+DYGRDL GV+NL++KH+R++ E+ +HEP +  V+ +G EL+  +  A    D+IK+++E LE +W +++ L+  R  +L+ES  +Q FL  VEEEEAW+ EKQ +L S ++G+ +A VQGLLKKHD F+ D+++H+ +  D+ N+G  LI + NH+A  I+QRC+ LR +L  +   A  R   L DNSA+LQFMWK DVVESWIA+KE QV+S+D+GRDLSSVQ LLTK E FD GL +F  EGI+ IT L +QL+ S H QS AI+ R+ N++ RW  L   S+ R+  LLK+Q+++K++EELYL FAKKAS FNSWFENAEEDLTDPVRCNSLEEI+AL +AH  F+ SL +AEEDF  L  LD+ I+S+ VG NPYTWFTM+ALE+TW+NLQRII+ER+ EL RE +RQEEND LR+EFA +A+ FH WL   R  +ME  GTLEEQL+A + K+KE+K  K  L+QIEEKGA+LE  LILDNR+TEHSTVG++QAWDQLDQLAMRM HNLEQQIQARN SGVSEEALREFSMMFKHFDK+K+GRLDH++FKSCLRALG DL  V+EGQ +PEF+ IL +VDPNRDG+VTLQE+MAFMIS+ETEN+QS +E+E AF AL+KE +PY+T +ELYANLT +QAEFC+R M PY+   SG+ I    DY  F   LFQ+
Sbjct:   21 QEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWDKLFFKLKDKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAERRQALLDRRRRLLDRARQRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMG-QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTA--QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSRTNMAEEAVAAQQEIGTD--LEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALEEQTEQREQQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERH----------------------QEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDP-TNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRQKLLKMQQQFKQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALFQS 2432          
BLAST of Spectrin alpha chain vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 422.55 bits (1085), Expect = 3.595e-118
Identity = 417/1595 (26.14%), Postives = 753/1595 (47.21%), Query Frame = 1
Query: 1840 ENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL---RTQADACKMQEAPVSDSYGKET-------VMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEIND-RQGHVPAAYVKKVDA-----------MMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEF-VNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTL--DESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLH---NQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSW----FENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNP-YTWFTMEALEETWKNLQRIIQER 6513
            E+ +  + ++  ++K Q    +I A E R   +      L    +++S+ ++    E+   W  L++  + +++ L   +     +R+++ +   L  +E  + + D GK L  V +L  KH+LL+A I++H   +    Q A+ ++  +    D +++K +EV+ +Y  L E    R++ L  A  L QF +D ++E  W+ EKE +  +     D+  V      ++ ++ E+  H  R   +   G++++  +  +  DI++++  M + W  L+   D     L ++  AQQY  DA+EAESW+REK PLV S + G+DE + E+LL++H  L  +I AY+S I  L   ++Q        A  S S  +ET       V   Y+Y E N   VS  KG+VL LL  +  +WW+    D  +G+VPA Y K V               + ++ N  +   VA +Q  + N Y  L  L   RR  L D+++  +  RE ++  +W  E E V++ +  +P H+ A    ++K D+   + +     ++K + D AN L   G  ++  KIE    ++   ++ LE +  ++   LE    V  +   C+ A+EW+  K  +L+ +    D+ S+Q L       ERDL  L +++  L+  AA + + HP EA  I +   E+  +   L  +A++  +    +   + F +  RD++ WI     ++  D    DV  AE LL++H +L  +I ++  +    QE                       G+ LL+      ++++E+LQ++      L + +  R   L Q L+LQL+ R+ E+ +      E+ L    LG+ V+  +V++L+K+H D    ++ QE +++A    AD +++ +H D   I+ + ++VLAR  +++      + +L      Q   R+ADE+  W+ EK +  +  D+S   P+  I  +  KH+AFEAE+ AN  R+Q I   G  L  K     +   VE+ V ++  QW  L  +  +K  +L++A  Q   +  L+D    L E++ +L+S D G D  SV  LL KH VL  ++  + +++ D+  R  +    G  D+D I      + +RY  +K  A+ R   L +++  H     +D E  WI EKK + SS+D GR L    N+ KK ++LE E++ H   I  V  Q  EL+     A+  +IK K   LETAW EL++L  +R+  ++   + Q++L    E E+W+ EK++ L+S DYG+   A + LL KH A   DM  +      +  +  +L++ N  + +  ++R + L  + D L K A  R++ LED     ++M ++  +   I +      S+++  D   ++ L +K + F   +++    G E  TS     N ++  N   +  +  + + L   W+ L    + R   L   +E ++        F +    F  W      N   DL   V+      + +L + H      +  ++     L +  + ++    GGN        + LE+ W+ L+    +R
Sbjct:  447 EHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSV-QETEEVNVPQVEMSYNY-EGNGMRVS--KGEVLALLEKSTPEWWRALKRDGTEGYVPANYCKIVPGETVTVTQTTQKTTTTLEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIE-VSLADEPSPEHVAAF---RRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQS-RKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNP--NDVKSLQNL-------ERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQE----------------------LGRRLLERNPRM-SKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVE--SVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSA-IPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHY--ESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSAS-SQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKN----GSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHR--------FHRDVDEFEQWMADKMANMPRDLGRDVK-----HVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDR 1976          

HSP 2 Score: 401.364 bits (1030), Expect = 1.017e-111
Identity = 274/938 (29.21%), Postives = 491/938 (52.35%), Query Frame = 1
Query:  130 FKEATEERRKKLEDAKKYQYFKRDADELESWI------LEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQE 2925
             ++  E R   L+DA     F  D  ++E+WI      + K Q  S E+   +     + Q HQALE E+ A    ++ + + G + ++N H   +I   R D+L   W +L     ++S  L+   D ++F + V+ +L W  EKE  V++ + G+D+EH  +L ++ +    D    E+   EI    + L+++    ++ +  +++ + +    L       + +L  A E+  F RD + T   ++EK   + S+D+G+D ASV+ L RK  AL+RD+ A+ +K+    KDA ++  K P  ++T+ D  + L  +W  L K +  RNE+L+ S+ L+++L D + +  W   ++  + + +  KD  G   ++E+H+E K+EID R E  +    EG+ L         ++    +R+      L Q W   +   ++ ++  L+  +  Q E W++ +E  +   ++GD+ D+VE LI+ H  FE+++  Q EK   L   A+ LV  G+   AD+  + +++  R + L +  + R   LEDS  Y  F R   E+  WI  KL+ A DE++ + TNL+SK+QKH  F +E+  NE R+  V+ +G+ L+  NH  SE +K ++ EL   W++L + S +K + L +A       R VED+E WL +VE +L+SDD G+D+ S   L KK + L+ +I+   D +   +++A +   +    AD   K+  +V  RY  L EP+  R+  L DA    Q+ + A+++ +W+ ++  +A S   G  L    +L KKH  ++ E+   +  + +    G+ MI   H+A   I+K +D + +    LK     R+ LL ++++A +Y  + +EAE W+RE+ PL  S E G+D+   E+ L++   L  ++E +++ ID L+ +AD    +E
Sbjct: 2181 LRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESI-SIDEKMKRLQTHQALEAEVTANKPVVDQILQRG-NQLKNLHRNPKIA-NRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLARE 3115          

HSP 3 Score: 349.362 bits (895), Expect = 7.618e-96
Identity = 249/843 (29.54%), Postives = 428/843 (50.77%), Query Frame = 1
Query:  373 IENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQE-EKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLK--TASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL 2892
            +E +   S ++  R  ++   + +L  +   + RLL   +  ++F R  DE   W KE E  +  E      EHV   ++KF++   D++     +   I   A+ L+ E   +   +  ++  +    + L+ L K+R  +L     +  F    +    W+  K      E   R+   V++L+     L+RDL  LE+K+  L K A  +   HP+    I+ K   L +  + L +++ E+    + +     F S  RD++ W+   + V+  D    DVA  E L+++H E   +I  +    + C+  G  L+  N P    +  +L+ L  E   L  L+  R  + +Q +DLQLF R++E+ +A     EAFLE +++GDS++SVE L+++H D E  L AQE + +     A+ +++  H  +A + ++R D+L R+  +   A  RK  LE S  YQ   R+ADE+  W+ EK K   + D++   P+ +  ++ KH+ F AEI ANE RI  + + G  L+   H +S ++++ + +++  W DL      K   L QA+ Q+   R +ED    L E+++ L S D G DL SV +L +KH +LE ++  + +++     +  +   + H+DAD I     ++  RY  ++ P  +RK  L+++   HQ   D D E  WI EK+PIA S + GR L    N++KK + ++AE+  H  +I +V  +  ++I   H A   I+ K  +++  WS+LK     R+ ++D  ++ QQYL DA+E ESWM EK   + S ++G DED+   LL KH AL  D+  YR  ++ L
Sbjct:  896 LEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEP---SPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKF-----EQLDRNPNDVKSLQN----LERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERN-PRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKL 1725          

HSP 4 Score: 322.398 bits (825), Expect = 1.117e-87
Identity = 433/1887 (22.95%), Postives = 850/1887 (45.05%), Query Frame = 1
Query:  763 LKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTK-------DADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPL-SEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFL-------AEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAE-VESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFG----------KDEDSTEA------------------LLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYD-------YQEKNPREVSMRKG---DVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSD-IDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPG--HLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEA---VEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPN-EAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEK---LQNTLDESYKDPTTNIQAKH-QKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKV-KQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFM-WKTDVV--ESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERY 6204
            LK LA  R++ L +  ++ +F+R+ D+   W  E  + L  E     +A   A +RK + L+ D+     K N  T+         D +S  H  S+  I+ ++  + + W +L++   +R  +L+ +  +  F +       W+  +      D    DV  ++ L       + +I + ++   + K         +HP  +  I  K+  L      L++   E+ +L EQ    ++F         WI K    +  +     +   E L++KH +  + +  ++ + +    +  RL+E  +   + V ++  +L+   ++L +  + R + L+   + QLF+R+++ I A       T   E + E  NL   V+  +N L       A++ A E+R++       +++ + H  S  I++R  ++      +  A+  ++K L  +   Q+  R  +++  W+ E  +  ++ DD     +++ +   KH   EA+I +++ RI     + D  V ++H+++  ++K   +V+ ++  L++ +  + ++L  A       R  +D    + E +    S + G DL  V++L++KH  ++ E+  +  ++ ++ N G+KM    HY    I   +  +   ++ +K  A +RK  LD+S    Q + D      W+ EK+P+  S + G          K ++  EA                  L+K+H +  + I+A  S +++  ++          V D +G +    L+D         EK     S   G   D    L S H+   +     RQ      +++K++    + ++ N P       +Q  L  +++ L  L  DRR+ L+D+V  Y+ +RE+ DL Q + E   VA++E       HL+ +QS   K DEF  + K   E+    +  AN + R     A   V+K E + T      E +E   ++    L     + R+HR+ DE ++W+ +K A +   D+G+D+  V  L++ H+AL++++     R+  L  +A  L +T+P   AE I   Q+ + + W +L    +D K  L  + DL  F    RDL++W +   + + SD    D+  AE L   H  L+                       E+DAR   F    + G++++   HYA  EIK K   +  A E+L  EW  R   L Q ++   + R+ +Q    +  + ++L    +G  V D  V+S  K+ + F +A++  +++   L   A++L++  H +   I      V      L++++ A  + L D   L +F  D  ++E WI+EK   ++   D S +  + + + K  Q HQA EAE+ AN   +  IL  G +LK     + +   +  R ++L+ +W+ L     D+S  L+EA     +   ++++  W+ E E  +S+ D GKD      LL +     +D    E  + ++N   ++ ++ G    D +++ ++ +NE++  +  QLA  R   L  A ++H F R ++D +  I EK   + S+DYG+D   V  L +K   LE ++ A    + + +K   +++ E +    + +   L+ LE +W +L + + +R  KL  S +  K+LD V++ E W  + ++ ++S          + +L++H   + ++    ++   +  EGQ L  +   +   +++  + ++     LR+     K  L+     L++M W  + V  E W++DKETQV   + G    +V+ L+  H  F+  +   + E I+ +T   + L+   +     I  R + +  R   L  +S  ++ H+L+  ++Y
Sbjct:  920 LKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPEHVA---AFRRKFDKLEADM-----KTNGGTQLKHINDIANDLISEGHGQSR-KIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWM--LSKFEQLDRNPNDVKSLQNLERDLKPLEDKIAALEKLAAAVKK--------DHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLER-NPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDA------ATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVD-WGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQ------WLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQS---KFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSK----LAVAEELHRFHRDVDEFEQWMADKMANM-PRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLS----------------------HEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVAD--VESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKN----LHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLA-AMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKIL-EKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQK---LLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRK-QSEKIDALTKNADALVSGGNNYRADIVTRSEEVTAR-HALLLKSMEKRGHMLEDSKKY 2730          

HSP 5 Score: 306.22 bits (783), Expect = 9.797e-83
Identity = 245/944 (25.95%), Postives = 457/944 (48.41%), Query Frame = 1
Query: 3583 VQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKT--VDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEG--IEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAE--------EDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAE 6378
            V  ++R+ ++  E I EK A + + D GKD  SV+ L RK  ALERD+ A+ +++   D  A ++++  P   E ++   +++ E W +L+  AE    KL  S  L K+L D + +  W N +   ++S +  KD  GA  +LE+H                       E  AEID RS   +   + G+ L +     + E++   + + +++ QL + W + K  L + LE  L+  +  Q E W++ +E+ +   ++ D T  V+ LIK H  F   +  Q +K+ AL + AD LV   +  +  I  + +EV AR   L ++M      L D +    FIR   E+ IWI  KLQ   DES+ D  TN+++K QKH AF++EL  N +RL ++   G++L      M ++  V+ ++ +L   WD L  KS  K+++L+EA         ++DIE WL +VE  LSS D+G+D  S + L+ K   L T+I    D + ++ ++A E    G+  +D   ++ + +  RY  + +  + R   L  A+    + +  +++  W+ ++ +L SS + G  L    +L+KKH  LE E+   +  +   E++G +++ +   A+   I++ L+ L +A + L++   +R+  L+E+ +  ++     E E W+ E+  L  S + G   A  +  L++    + ++++ +++ + +      L+   +H+A +I  +   L      L +   RR+  + D S + +F+ + D +  W+ +KE    ++DYG+DL   Q ++   E F++ +      G  +  +      L+ S H    +I  +  ++   W  +   +  RK  L   ++ ++        F ++A    +W ++ E        EDL+       L  +KA  + H  F + +KA E
Sbjct: 2412 VHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQH----------------------HERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLD-HTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQ--VKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFAST-HIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQII---EQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHR--------FDQEADQILNWLQDKEATGVAMEQEDLSRA----DLASVKAQLQRHDEFMHGMKAVE 3314          

HSP 6 Score: 223.402 bits (568), Expect = 1.125e-57
Identity = 224/943 (23.75%), Postives = 442/943 (46.87%), Query Frame = 1
Query:  154 RKKLEDAKKYQYFKRDADELESWILEKIQTY-SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHL---------LQEDFPEQESLINKK-KDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRV---LYEQNM----DLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKV---QKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTE----FGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD 2907
            R +L  A +   F RD ++ +  I EK+    SD+  KD  +++   +K  ALE +++A  + L A DK+   ++E      E +   L +L   WE+L    + ++  L  +    ++L  V ++  W  +    +TS +  +D           N   K LE   E+ AEI  +++ L         L ++ PE ++ + +  K V+++  +L+   +  +  L +  E   +  +  +   W+++K   +   + G    +V+ L + H A +  +    EK++ LTK+AD L +   + +  I  + E + +  + L K   +R   L+ S   H F+    +L+ W+T  K  +A DE   D   + + +++H    SE+   ++   + + +GE+L+T NH +SE +  +L       V L   W+E R    L  Q +    +L    R  E  E W+ K E  L ++D G  + S E LI+K +  +  +A + +    +   A  L   G  AA D  K+ + +  R S L+E  ++R+ +L D+  +  + + A+E   W+ +++  AS  + +   +LQS +   +KH     E+   +S ++D + RG++++   H  S  I++ ++ L      L  +  ++   L +A    ++     + E WL E      S + G+D     +  ++  +L+ ++   ++ ID   ++AD  +  +H DA  I  KQ ++   +  L     +R+ ++ DA K H+F R ADD  DW+ EKE  A + + G+DL   Q +I++ ++   E+     R+  V    + ++ + H     I  K  D++ +W+ +   A++RKQ L+ + +  ++  +A +  +W+++KE    + E       D  S +A L++HD  M  ++A    +  L  +A+
Sbjct: 2403 RTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKD----------SNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWIT-AKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQL-------VELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLAS--SGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAE 3325          

HSP 7 Score: 211.075 bits (536), Expect = 5.671e-54
Identity = 175/800 (21.88%), Postives = 375/800 (46.88%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA-----SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAG 2469
            DI  R E+V  R++   ++ E+R   LED+KKY  F R   EL  WI  K+Q   DE+F D TNL+SK QKH A + E+    + L+ +++ G  ++ ++H+ SE ++ +L +L + W++L      K++ L+   +     R+V++I  W  + E  ++S++ G+D+   E+L KK +    ++  + +   E+  KA  L  +     +  + + + VE     L    + R++ L +A    ++ +  ++ + W++++ +  +S + G  L S  +L++KH  L+++L   +  +N   +   ++  +   +   IQ   + L SA   LK+    R + L  +   H + ++  +   WL +   +  + E+ +D AG E+ + R      E++         K   + L+   H  +  I  K  +L+     L +    RR           F R  +    W+ ++E      D G  L+  + +I + E   + LAA  E+   +      L+ +GH   A +  K  D+    +++ E A  RK +L  +     FD++AD+I  W+ +K  T       D +  +  ++++++Q+H  F+  + A E ++ ++ +  + L +S  +    ++ R  ++++   D++ A+K   + L      Q + +   +M  W+  ++S + S+   +D+ S  +L ++H+    ++   +  +D F +Q  + +   H  +  I++K + +   +  L E    R     +   + ++ ++A+  + W+ E+  + G
Sbjct: 2698 DIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLG 3497          

HSP 8 Score: 208.764 bits (530), Expect = 2.844e-53
Identity = 219/963 (22.74%), Postives = 445/963 (46.21%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWI---LEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPL-TSEDFGRDLASV-QALKR--KHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLD-KERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDE-QHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSD 2940
            E I  R++ +   +   K AT++R+  L  A     F     +L +W    +  IQ  SD +  DL   +    +H  L  E+ A+      L  +G  MI   HYASE I+ +   L +  E+L + +  ++  L   + +  F R   +I+     K T + S   G  +  VE   K+ + F K L   +E+ A +   A+ L++    E +++   + +V + L+ L+   + R   L +A  +  F  D  +  +W++EK+  +  ++D   +  S+ + +KR   H+AL+ ++ A +  V+Q+ +  ++L N H + K  I ++ + L   W+ L     +++  L+ +  L RF     ++L+W+ + + +++  ++ KD+     L+ER +  +S+    +++       GE+L+       + +  + + L+ K R++L QL + R  L    M++  F RD E  +  I ++ A ++++D G    SVE L+RK    E+ ++A  +K    D  A +++E        V      L      L + A+LR   L  S     +  D  +++ W  + + K  S +  K+    +  +++H    AEI      +  +   GQ L         +++   + +    + L    + ++  L +      +       E WL++ E+Q+A  + G   ++V  L K H+  E  +    ++ID+  + AD  V    ++ AD I  +  EV+ R+  L + ++KR   L D+ K H+F R   +   WI  K  +A   +   D   +++ ++KH A  +E++ +E R+  V  +G++++  +H+    ++ ++ ++++ W +L+ K+  + Q L ++ E         + E W+ + E  + S + G+D  STE L+KK D L  +I      +  +  +A   ++Q +  +D
Sbjct: 1953 EQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQ--SDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNPK--IANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAA-MEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRAD-IVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF-LDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAAD 2908          

HSP 9 Score: 206.068 bits (523), Expect = 2.099e-52
Identity = 216/970 (22.27%), Postives = 438/970 (45.15%), Query Frame = 1
Query:   64 KILETPEDIQERREQVLNRYSAFKE-------ATEERRKKLEDAKKYQYFKRDADELESWILE-KIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDM-IENHHYASEI------IQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEA---WIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA-SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGST---NVGR-DLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQA 2904
            KILE    +   RE VL+     +E       A E R +KL  + K   +  D  ++E W  + + +  S +  KD    +   ++H   + EI  +SE L  L + G  +  E   + +E+      +Q    QL   WE       EK  L KL L+++ +     +   W  +KET V   E G   + VE+L K  + F + +  Q EK   +   AD L+      +  ++ + ++V      L    +KR   L ++ +  +F R   + I W+  K + L  ++   D  ++++  +KH A D +L+  E++++ + +  ++L   +    + ++ +   L S W  L+ KS  + ++L  ++ LH       D+  WL  ++  +++D+  +D+   E L+++ +  ++EI  R ++      +  EL       ++D + + E+++     L +    RR   E  +D Q F++  + AE    W++ +     + + GDSL S  +L +KH   EK L  ++      +     ++   H+A+  + K  D L      L+E   LR+  L+++ +   +  +  E + W+ E++  A S E  ++    +S +++      E+   ++ ID +K R   LL   H+ +  I  +  +L+ L+ DL      +   +  AS   +FVR  +D+  WL E E   +++D G+DL     + ++      ++++  +R+ +  +  +  +   H     I  K  +V   +  + E  ++RK  LN A ++H+F ++AD   +W+ +KE    +    ++ R DL  V+  +++H      +   E ++ E+C+E +++ N+       +E +  DM+    D+   A K  + L      Q Y  +  E   WM+  +  + S +  +D  S E+L+++HD    +++  +  +D    Q 
Sbjct: 2475 KILEKRPPL---RETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWES------EKGTLQKL-LEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAK-LQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRR---ENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQG 3430          

HSP 10 Score: 204.142 bits (518), Expect = 7.588e-52
Identity = 195/921 (21.17%), Postives = 438/921 (47.56%), Query Frame = 1
Query:   73 ETPE---DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTN-LQSKNQKHQALELEIAAQSENLNALDKNGYDMIEN-HHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQK--KFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQ---LASDDCGK-DLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQ----FVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVG 2787
            E PE   ++Q   ++V N     ++  E  +  L+   ++  +  +A + E W+ +K    +     D T+ ++   + H A E  +  QSE ++AL KN   ++   ++Y ++I+ TR +++ A    LL   +++  +L+ +  Y +F+R+  E++ W   K      E F   L+H  +  K  K   F  +L   E++ + +  + + L+ ++    E +  +  ++    + L+  +  + Q+L EA E+    R  +    W+++    L+S+D GRD+ S + L +K + L  ++    + V ++ K A EL  +   + D    + E + + +S L +    R E L  + +  +++    + L WL+D   + ++ E    +    +L ++H   + E+D+R  +    +  G+++I   H  S  I   L+RL    + L +    RR L ++ +D   +Y +  +AE W+ +Q     + ++G      E+ +R+    +K +   + +  RL   A+ L+   H+ A  +  K+  L     +L  +   R++ + D+  Y  F R AD++  W+ EK ++AS E+Y +   + Q  +++ ++ + E+AA   R+  V+   ++LL S H     I  +  ++ +LW  +   +  +++ L  A    +F +  + +  WL + E+    +  +D  + DL SV    ++H+     + + + ++     +A++    F D +H     ++ ++ ++  +   + E   K   KL     L  ++++  +   W+   +    S  + RD+   ++L+++H     E+ G +P + +   +G++MI + H   ++I++K+D ++  W+ L      R +L +++++ Q++  +A + +SW+ E+  L+G
Sbjct: 2585 EQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIV-TRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF---LDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHH----LEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLG 3497          

HSP 11 Score: 193.741 bits (491), Expect = 1.149e-48
Identity = 260/1342 (19.37%), Postives = 580/1342 (43.22%), Query Frame = 1
Query:   58 EIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWI------AKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWI--VEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVT---EVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSD-ELAKDVTGAEALLERHRDLAVEI 4044
            ++K L     I  R +++  +++    A  ++   LE+A+    FK+  + + +WI EK +   + +  KD+ + +   ++      +     + L+ +++ G  +++    + + +Q     L+  W  LL         L   ++   F R V++      EK   + S+++G+D   VE+L +K +   +D+    +K       A  +L++  P +E++++  K +E++ E+L   A+ R +KL  + ++ K+  D  K   W N+    +TS    +D    + +  +H     ++    E++  L ++   L+ + P+ K  +Q   + + ++   L++        L        +  +      WL+D +  +A  EL      VE L++ H+  +  +  + E   +     + L++  +    DIV + E +     +L++   +R  + E +     F R   +   WI      A  E+FL++ ++   L       +KH  F+  L   E++   ++    +LV + H+ +  V  +  +L      L  K+ L+   L ++       R  ++I+ W+  VE  + +SD++ ++  + +  ++K      EIA     + ++  + + L       ++D  ++ E+++  ++ L    +++ +NL  A    Q+V+  E+   WL++     +S + G  L S  +LQKKH  LE ++ + Q  ++   Q+    + ++HF +  I+K  + +S+  + L+E    R+  L +A   H++Y +  + E W+ E+ P+A S  +GRD  G ++ +++   +  E+   +  I  +      ++  +H+    I  K   ++ ++ DL  +  +R+  + D+ +  +++  A +   W+REKE    + ++G+D +  + +          IE + ST+  L                +   E V A+   QE           D+L                 R GH    Y   + A  +D+         VA+++K   N                  + Q ++  +EA+ +  W+ +KE   V    E ++   L +V+++ ++ DEF++  K  E+++ EL  +A +L  S   +    +E     ++++ + + E   + ++ L    ++Q Y +E  E  +W++   + + +  + +D+ S + L R+HD    ++      V     +   ++Q+    ++ I +  + + + W  L    +D       ++D+QK+  +   L SW+     L+  D  +   V  AE  L    D  V +
Sbjct: 2265 QLKNLHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKL-------QKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEG-ELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQI----------IEQFESTVREL----------------AAAGERVAAVQRAQE-----------DLL-----------------RSGH---PYGASITAKGADVQRLWTHVNEVANERKQALN-----------------GARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSF-PDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGDDWRMVDSVEMAETHLRDFDDFLVTL 3523          

HSP 12 Score: 179.874 bits (455), Expect = 1.719e-44
Identity = 205/950 (21.58%), Postives = 417/950 (43.89%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTY--SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDS-NHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDE----DSTEALLKKHDALMADIEAYRSTIDSLRTQADACK 2916
            I++RR  VL R  A + A  +R+K+LE + +YQ  +R+ADE+  W+ EK +     D++    + +  +  KH+A E EI A    +  ++  G  ++   HY S  ++  + Q++A W  L      K   L+   D     R +++      E +T + S++ G DL  V+ L +K     +++     K ++I ++   +  +   + + + +    +      +K  A++R+  L E+    +   D D  + W+ EK    +S+D GR L     + +K E L+ ++     +++++   A EL  +H  +   I+ K   L +AWS LKK    R   +D      ++L D  ++ SW+ + +  +A+++   D      L+ +H     ++ +  +  +  + +  EL+  N P  E    + + L +E   L +L  +RR   E  + L  + R++      I +      + +  +  + ++ L  K ++F++ +    E+    +  AN ++      A DV KK++ L    + L E  + R S L  +     F RD DE + W+ +K+     +  ++  ++ S  Q H+    EI  ++ R+  +    + L  +     +E I  R + L++ W +L +A+  ++  L  A     F   V D+  W     S + SD    DL     LQ +H+ L  ++ + +      +   ++ +  QH+ ++ IK K + + +   +L+     R   L+ A + H F R+A      I  K     S  VG  +  V++  K+    +  +   + R   + +   +++ A H   ++I     ++      L+   + R  +L D+     + +D ++ E+W+ EK   V   +    E    D     L+ H AL A++ A +  +D +  + +  K
Sbjct: 1318 IEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLK 2267          

HSP 13 Score: 173.711 bits (439), Expect = 1.398e-42
Identity = 207/954 (21.70%), Postives = 430/954 (45.07%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKK-YQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMI-ENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFP--EQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWI-AKQEAFLENNDVGD---SLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK-LKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHR-DIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADA 2910
            E  Q+R+++++  + A  +  E+RR  LEDA   Y+Y +  AD  +S I E ++    E F +D  +L+    K    + ++   SE   + +     ++  N  +A ++++ + + L   W  L    + +   L +  +  +F R VDE   W  +K   +   + G+D++HV  L +      K++   + + A++  +A+  L++ +P    E +  +++ +E   E LKN    R+  L  A ++  F       ++W +     + S+    DL   + L+ +H  L  ++ A E +  +L  D +++      + + I++K   L SA   L+ +   RN  L  +   H F  + + +++ +   +  + +  +   VA VE+  +R +  +  + + DE   +  +   EL+   H  S++I      + +E  +L Q    R  + +    L  F  D  Q EAWI  K     +  D+     S+D     ++ H+  E  + A +    ++    N+L +N H      N+  D+L  + + L      +  +LE++ +   F +  + + AWI EK +  ++ +  K+  + +  +++     ++   +E  +D++   G+ L+    +  + +++  + L++ W  L+         L  A     F R+VED +  + E  + + SDD GKD  SV  L +K + LE D+S+   ++ +  + A + ++++    + +     ++   + +L +  + R  KLN ++KL+++  D    E W ++      S    +D  G + ++++H   +AEI G    +  +  EGQ + N +   H+ ++++    ++N    L+   +  K  L   LE   +  +A + E W+ +KE  V   E G   D+ E L+K H A    +      ID+L   ADA
Sbjct: 1741 ERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQS-IEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQ-EALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANM-PRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAER-LKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQL-KNLHRNPKIANRC-DELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQAL-NQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADA 2687          

HSP 14 Score: 171.785 bits (434), Expect = 5.585e-42
Identity = 208/947 (21.96%), Postives = 416/947 (43.93%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNL-------QSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQD--LEHVEVLQK--KFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELS-NKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDE-QHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTID 2886
            ++E+ + +++  ++ ++    R   L+     Q F R+++ +++       T   E F +  NL       ++  ++H+ LE ++ AQ   L A  +   DMI+  H  S  I+ R   + A  E +     ++ + L+ +L+Y +  R  DE++ W  EK   V S   G D  L    +  +  K   F  ++   E +  +I S+ D L+ +   E  ++    + V      LK     +  +L +A + +   R  +   + ++E    L S+D G DL SV+ L +KH  L++++     K++ +     +++ + H D+ D I      LL  ++ +K  +  R   LD S   H+ + D    L W+ + K + ++ +  + +     ++++  + ++E++           +  ELI  +H  S  I  K   L+     L +L   RR + +  +  Q +  D  + E+W+ ++   L + D G+  D+   L+ KH    + +    +  ++L+     LVE+         K++D+L+     L + A+ R+++LED+     + R++ ++   I E L+ A  E + E   +L+    K   F  ++     R    +     +L  N   + D+ ++ E L   WN L    + ++  L  A    +F R+V++ E W+A+  + +   D G+D+  V +L + H  L+ +I + Q R+   +++A++        +A+ I  +Q  +   + +L+   D RK  L  A+ LH F     D   W         S     DL   + L  +H  +  E+   EP    + N+G+KMI A HYA  +I+ K   +K+    L+++   R   L  +++   +  +A +  + +  K   + S   G      E+  K+ D      E   ST+D
Sbjct: 1212 VEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDA------ATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMS---GDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDA-DRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPR-DLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTF----EKALSTLD 2143          

HSP 15 Score: 169.474 bits (428), Expect = 2.752e-41
Identity = 210/961 (21.85%), Postives = 442/961 (45.99%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSEN-LNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQK---FFRDTDKTISWVNEKSIPLTSEDF-GRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIA-KQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA--SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRI--LEV-CNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVS 2937
            + +R+ ++ N Y   K   + RR+ L D  K   F R+ DE E W  E   + +DE   +  ++ +  +K   LE ++       L  ++    D+I   H  S  I+ R  +++A+W+ L  + K++   L+ T     F    +    W   K      E+  ++   V+ LQ       +DL+  E+K A +  K    +++D PE+ + I +K     AL    +L ++ Q+K+  A + Q    F       I W+ EK+  +  ED    D+A  + L +KH  L   +   + +V    +    L  ++P     ++++ + L+S  + L+     R+  L     L  F  +   + +     +A +  D L   V  VE L++RH + ++++D+++   ++     +++I   H  S  I  +   +   R  + +   +R+   E +++ Q   R+ ++   W+  K +  +  +D   +  ++   + KHE FE  + A E + Q++++  + LV   HY + +V K    +  +  +L+++   +   L  + + +  DR  ++  A  +++++TA  S +   +  +++  +QKH     E+    +++ D++NRG+ +    H  ++ I   + +L + +  +   ++ ++ +L ++    Q V +V+    W+AE +   +S DCG+ L    N+ KK   LEA+++ H  +ID  L QA + +   H  +  IK K +E+   + +L++ L  R+  ++   K  Q+  DA + E W++EK     S + G D    + L+ KH+A+  ++  +   +  LEV C E   ++ ++       +K+ D++   +  L   A+ R+  L+D++   +Y+ ++++    + E   +  S EF +D +  + L  K D     ++       S  T A+A   +  P +
Sbjct:  906 VADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPE--HVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSK-----FEQLDRNPNDVKSLQN----LERDLKPLEDKIAAL-EKLAAAVKKDHPEEAAAIERKIAELRALH--ADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWI-EKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNP-RMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHA-KLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVE---LVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFA 1846          

HSP 16 Score: 158.688 bits (400), Expect = 5.121e-38
Identity = 192/937 (20.49%), Postives = 412/937 (43.97%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYA-SEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSN-KHPDSKDTIQDKKEALLSAWSH-------LKKKSVE-RNEQLDVSYSLHRFLSDYRDLLSWLTD-MKAVIAADELAKDVAGVEALMERHNEHK---SEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDAL 2850
            D+ +++E +   ++   E  E R  KL  A++   F RD DE E W+ +K+     +  +D+ ++ S  Q H+AL+ EI      L  L +    + + +    +E I  R   L   WE+L N   ++  +L+   D   F  +V ++L WT    + + S+    DL+  E LQ + +    +++ +E + A + +  + ++       E + NK   ++ ALERL++    R   L +A +   F R+  + I+ +  K   L S   G  +A V++  ++ +  ++ L  L+E+   L   A+EL   +H +SK+         +S W         L ++ +E R+  L  +++L  F SD   + +W+ +    V  A +L+ +   ++  M+R   H+   +E+ +           G +L  ++   +  I N+ + L  +   L     ++ +  E+  DL  F +  E   AWI ++E  +   D+G  ++    L+ + +         E+    ++ +  +LV+ G  +   V K++  L  +   L  +    ++ L  +     F+RD ++    I EK+     ++Y K+  +++  V+K      +++A   ++       Q +L+      E + + +++L++ W  L  A++++ + L ++    +++ +V+ +E W  +V +++ S    KD N    + ++H+  +A+I    + +    ++      EQ      +++    V N   +L++  +  K  L    +   +  +A   E W+ +KE       +G     V+ LIK H A +  +     +I  +      +++  +    DI  + +++    + L    +KR  +L+DS +  +++    E   W+  K  L     F  D  +  + L+KH A 
Sbjct: 1848 DVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKN---------ISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHR--NPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF-LDHTNLRSKLQKHMAF 2772          

HSP 17 Score: 131.339 bits (329), Expect = 8.671e-30
Identity = 107/400 (26.75%), Postives = 193/400 (48.25%), Query Frame = 1
Query: 4891 KSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMN--ESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIES 6084
            + EKL++  ++    A L+D   WL  V+  L   ++G+ ++ V+  L K Q + TDI A EDR K L    +E       +SD +R  ++ I +R+ ++  L E R   L     L    R ID     +   +  V + D G+ LIGV +L  KH  L+ +I+AH  ++  + +  +  +   E Q    D ++RKL+ +   +  L +L   R+  LE +    +F+   EEE AW+ EK+ L ++      ++AV      +   E +M+ H  +   +   G++L+  N  + + I++R   +  + + LR A     + L +     Q+    +  ESWI +K   VKSDD GRD  + ++LL +H   +  + +++ + I  +  + +QL  S
Sbjct:  414 RQEKLEQLAQRFHKKAKLRD--SWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQF---DVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLV-QNGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSD-ISRLEEMQSQLANS 806          

HSP 18 Score: 125.561 bits (314), Expect = 5.470e-28
Identity = 127/545 (23.30%), Postives = 239/545 (43.85%), Query Frame = 1
Query: 4984 LSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFR--IEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAEL-IRETKRQEENDVLRQEFAHMADKFHQWL 6609
            +S  D     +++   L KH+    +I A+E RI+ +N   D  +     +S  + +  + +N ++  +K+   N+ + L +A       R ++D  A + E +  ++S+D G DL  V++L +KH  LE E+  +   +  +E +G ++  +    + D I   +  L   +  ++  +  RK  L+ES  + + +  V+ E  WI EK+ + SS D G TL     ++KK +  E ++  H  + + +  +  +LI  ++  +  I+ +   L      L+K    R+  ++      Q+++    VESW+ +K   + S+DYG D  + + LL+KH      + ++R  +E +EV      +L+ESN    +  + R   L+  +D L + ++ R++ L       +    LY    + A    S  EN    +++       E +K L      FK  +K   E F         I               EAL   W  L   I+ RD++L + E   +   DV         D+F QW+
Sbjct: 1371 MSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHY-DADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCV---ELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNAL-------EDAVCLYEYMRESADLGQSIEENLRVAMSEEF-AEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDV---------DEFEQWM 1894          

HSP 19 Score: 102.449 bits (254), Expect = 5.137e-21
Identity = 174/843 (20.64%), Postives = 363/843 (43.06%), Query Frame = 1
Query: 3565 LEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIR---ESSLLGEDVDD-KTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAF--EAELAAN-AERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKK---ILVSSEDYGR-DLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQ-LAN--PDEIKRKLEHLETAWVELQ-QLSSIRKT------KLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESF 6030
            LED      + R+C E   WI  K  +L   +   D T+++   +KH A + +LV   +R+  ++ +  +LV  +   +E +     E+   W++L TK+     +L  + +L        D+  W++ +   +SSD+  +D+   E L+++   L  EIA R+                  DA     +      +EL   G  A ++  ++ + +      L+E    R++ L        +++  E+  +W++ R    SS  GE  D  ++  SL KKH    + ++ ++  M   ++    ++   H+    I+     + +   +LKE+    R  L +      +  +  E E W+ E++   + +         ++  ++      E EL  N  +RL+     G   +E    M    ++  +  KL   +  L  +   +  ++ +A++   +     D+  WL E E S S+ DYG+D      ++ + +    ++ A  +R+  +    ++ + SG     +I  +   +   +  V ++A  R   L  A+++H F +  D    W+++K+   + +  ED  R DL  V   K + QR +  +H     +++VEKQ  EL +E++ L N  PD       HLE   ++++ QL  I +       KL      Q +     E   W+   Q  ++S      +A+ + L+++HD +  +M+  +   +D   +G+++I  ++  ++ I+++ + L +   +L +    R    E+N    ++    + ++SW+ ++   +  DD+ R + SV+   T    FD  L + 
Sbjct: 2724 LEDSKKYHEFIRQCGELIIWITAK-LQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRS------------------DAVVEMMKK----ARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASS--GESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKK-RADGLLAREHHDAM----SIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASV---KAQLQRHDEFMHG----MKAVEKQVAELCHEAERLWNSFPD----TRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEER-AGLLGDDW-RMVDSVEMAETHLRDFDDFLVTL 3523          

HSP 20 Score: 94.3597 bits (233), Expect = 1.270e-18
Identity = 160/777 (20.59%), Postives = 314/777 (40.41%), Query Frame = 1
Query:  523 EILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFM---KDLEYQEEKAAE-----IYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHE--------IQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLK-TASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQAS-GQQQFVRNVEDMEIWLA----EVESQLASDDC----GKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPR-ILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREK 2772
            E+L W +     + S  F   L  +     KFN+F    K  +Y+E+   E     I +K   + ++ +   + L     D+E A  +L     +RQ  +    +         Q+F +      SW+    + L   + GR  + V+   +K +A+  D++A E++   LT   +EL  +     D ++  +  ++  W+ L     +R   L     L   L D   L + L  ++  +   ++ K + GVE L+ +H+   ++I++               I       + +  KL+ +  +   L++L   RR+  E+   L  F +D E+  AW+A++E           + +V      +++ E  +     +++ +     RLV+NG  +  D+ ++   +  R   L        + L ++ + Q + +DA+E ++WI EK+    SD+  ++    +S +Q+H     EI A +S I  ++     L +S  + +    + ++E +++    V  S   E N  + S G+   +      E W A      E  + ++ C    G+ +      QK    LE + +           ++    D QH           ++SN Y +L+   D R+  L+D  KL +FYR+ D+ E W  E E           +   +    K +A      G + + I ++ N+   +I+  H   R IE +   +  +W +L+    +R   L+ +     +      A  WM  K
Sbjct:  311 ELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLF--MHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQNGQ-SKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTA-TTSQSVQETEEVNVPQVEMSYNYEGNGMRVSKGEVLALLEKSTPEWWRALKRDGTEGYVPANYCKIVPGETVTVTQTTQKTTTTLEGNET-----------KSSVVADRQH-----------KISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIAND---LISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSK 1058          

HSP 21 Score: 80.4925 bits (197), Expect = 2.416e-14
Identity = 55/236 (23.31%), Postives = 111/236 (47.03%), Query Frame = 1
Query: 2086 QQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGST 2793
            Q+F +  +  + WL  V+  L   + G+  + V    KK   +  DI + +DR        ++   E++ ++D ++  + E+ +R+ +L   L++RK  L     L    RD D   + ++  EP   + +VG+ LIGV++L+ KH  + A+I  H   + ++       I         +++K+D++   ++ L      R+  L+ +    Q++ D  E  +W+ EKE L  + 
Sbjct:  423 QRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTA 658          

HSP 22 Score: 73.559 bits (179), Expect = 2.474e-12
Identity = 69/320 (21.56%), Postives = 147/320 (45.94%), Query Frame = 1
Query:  106 QVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADEL--ESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEA 1059
            ++++R++      E+R++ L          RD D L  E + LE      D   K L  ++    KH  L+ +I A    L+ L ++  + I +     +++Q +LD++ A +  L+ + + +   L+      QF++  +E + W  EKE   T+     D+  V      +     +++    ++  + +  + L+Q +   +E +  +   +    ERL+         L EA   Q++F+D ++  SW+ EK   + S+D GRD  + ++L ++H  L+ ++ A +  +++L +   +L+N    +  T Q  +E 
Sbjct:  503 EIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVG-KHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSVQET 820          

HSP 23 Score: 69.707 bits (169), Expect = 3.936e-11
Identity = 91/423 (21.51%), Postives = 181/423 (42.79%), Query Frame = 1
Query: 3496 GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRE----SSLLGEDVDDKTVDSLIKKHEDFNRAINMQED--KMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAA 4746
             II +LQ++ E+LE++              QR+H++      W+      L   + G+  + V++  +K  A+  D++A  +R K+L +   EL     +E++ +   + EI + W +L T  E  K  L +  DL   L D   L + + ++   V + ++ K + G E LL +H DL            +D         A+I+A               ++      + ++ KL  +      L E   +R+  L++   L  +++D E+   W+  +E    ++L   D+      +L+ K    N  + MQ    + + +    ++LV++    +D I+ +  ++  RW  L+  + A  + L + +  Q + +DA+E E WI EK+     +         ++  Q+H   E E+ A
Sbjct:  407 AIIAELQRQ-EKLEQL-------------AQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKH-DL------------LD---------AQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYK----NVEMEMQTHWARSKGMIAGGERLVQNGQSKED-IQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRA 788          
BLAST of Spectrin alpha chain vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 422.165 bits (1084), Expect = 4.079e-118
Identity = 417/1595 (26.14%), Postives = 753/1595 (47.21%), Query Frame = 1
Query: 1840 ENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL---RTQADACKMQEAPVSDSYGKET-------VMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEIND-RQGHVPAAYVKKVDA-----------MMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEF-VNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTL--DESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLH---NQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSW----FENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNP-YTWFTMEALEETWKNLQRIIQER 6513
            E+ +  + ++  ++K Q    +I A E R   +      L    +++S+ ++    E+   W  L++  + +++ L   +     +R+++ +   L  +E  + + D GK L  V +L  KH+LL+A I++H   +    Q A+ ++  +    D +++K +EV+ +Y  L E    R++ L  A  L QF +D ++E  W+ EKE +  +     D+  V      ++ ++ E+  H  R   +   G++++  +  +  DI++++  M + W  L+   D     L ++  AQQY  DA+EAESW+REK PLV S + G+DE + E+LL++H  L  +I AY+S I  L   ++Q        A  S S  +ET       V   Y+Y E N   VS  KG+VL LL  +  +WW+    D  +G+VPA Y K V               + ++ N  +   VA +Q  + N Y  L  L   RR  L D+++  +  RE ++  +W  E E V++ +  +P H+ A    ++K D+   + +     ++K + D AN L   G  ++  KIE    ++   ++ LE +  ++   LE    V  +   C+ A+EW+  K  +L+ +    D+ S+Q L       ERDL  L +++  L+  AA + + HP EA  I +   E+  +   L  +A++  +    +   + F +  RD++ WI     ++  D    DV  AE LL++H +L  +I ++  +    QE                       G+ LL+      ++++E+LQ++      L + +  R   L Q L+LQL+ R+ E+ +      E+ L    LG+ V+  +V++L+K+H D    ++ QE +++A    AD +++ +H D   I+ + ++VLAR  +++      + +L      Q   R+ADE+  W+ EK +  +  D+S   P+  I  +  KH+AFEAE+ AN  R+Q I   G  L  K     +   VE+ V ++  QW  L  +  +K  +L++A  Q   +  L+D    L E++ +L+S D G D  SV  LL KH VL  ++  + +++ D+  R  +    G  D+D I      + +RY  +K  A+ R   L +++  H     +D E  WI EKK + SS+D GR L    N+ KK ++LE E++ H   I  V  Q  EL+     A+  +IK K   LETAW EL++L  +R+  ++   + Q++L    E E+W+ EK++ L+S DYG+   A + LL KH A   DM  +      +  +  +L++ N  + +  ++R + L  + D L K A  R++ LED     ++M ++  +   I +      S+++  D   ++ L +K + F   +++    G E  TS     N ++  N   +  +  + + L   W+ L    + R   L   +E ++        F +    F  W      N   DL   V+      + +L + H      +  ++     L +  + ++    GGN        + LE+ W+ L+    +R
Sbjct:  447 EHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSV-QETEEVNVPQVEMSYNY-EGNGMRVS--KGEVLALLEKSTPEWWRALKRDGTEGYVPANYCKIVPGETVTVTQTTQKTTTTLEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIE-VSLADEPSPEHVAAF---RRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQS-RKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNP--NDVKSLQNL-------ERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQE----------------------LGRRLLERNPRM-SKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVE--SVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSA-IPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHY--ESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSAS-SQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKN----GSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHR--------FHRDVDEFEQWMADKMANMPRDLGRDVK-----HVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDR 1976          

HSP 2 Score: 400.979 bits (1029), Expect = 1.346e-111
Identity = 274/938 (29.21%), Postives = 491/938 (52.35%), Query Frame = 1
Query:  130 FKEATEERRKKLEDAKKYQYFKRDADELESWI------LEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQE 2925
             ++  E R   L+DA     F  D  ++E+WI      + K Q  S E+   +     + Q HQALE E+ A    ++ + + G + ++N H   +I   R D+L   W +L     ++S  L+   D ++F + V+ +L W  EKE  V++ + G+D+EH  +L ++ +    D    E+   EI    + L+++    ++ +  +++ + +    L       + +L  A E+  F RD + T   ++EK   + S+D+G+D ASV+ L RK  AL+RD+ A+ +K+    KDA ++  K P  ++T+ D  + L  +W  L K +  RNE+L+ S+ L+++L D + +  W   ++  + + +  KD  G   ++E+H+E K+EID R E  +    EG+ L         ++    +R+      L Q W   +   ++ ++  L+  +  Q E W++ +E  +   ++GD+ D+VE LI+ H  FE+++  Q EK   L   A+ LV  G+   AD+  + +++  R + L +  + R   LEDS  Y  F R   E+  WI  KL+ A DE++ + TNL+SK+QKH  F +E+  NE R+  V+ +G+ L+  NH  SE +K ++ EL   W++L + S +K + L +A       R VED+E WL +VE +L+SDD G+D+ S   L KK + L+ +I+   D +   +++A +   +    AD   K+  +V  RY  L EP+  R+  L DA    Q+ + A+++ +W+ ++  +A S   G  L    +L KKH  ++ E+   +  + +    G+ MI   H+A   I+K +D + +    LK     R+ LL ++++A +Y  + +EAE W+RE+ PL  S E G+D+   E+ L++   L  ++E +++ ID L+ +AD    +E
Sbjct: 2181 LRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESI-SIDEKMKRLQTHQALEAEVTANKPVVDQILQRG-NQLKNLHRNPKIA-NRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLARE 3115          

HSP 3 Score: 348.591 bits (893), Expect = 1.169e-95
Identity = 249/843 (29.54%), Postives = 428/843 (50.77%), Query Frame = 1
Query:  373 IENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQE-EKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLK--TASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL 2892
            +E +   S ++  R  ++   + +L  +   + RLL   +  ++F R  DE   W KE E  +  E      EHV   ++KF++   D++     +   I   A+ L+ E   +   +  ++  +    + L+ L K+R  +L     +  F    +    W+  K      E   R+   V++L+     L+RDL  LE+K+  L K A  +   HP+    I+ K   L +  + L +++ E+    + +     F S  RD++ W+   + V+  D    DVA  E L+++H E   +I  +    + C+  G  L+  N P    +  +L+ L  E   L  L+  R  + +Q +DLQLF R++E+ +A     EAFLE +++GDS++SVE L+++H D E  L AQE + +     A+ +++  H  +A + ++R D+L R+  +   A  RK  LE S  YQ   R+ADE+  W+ EK K   + D++   P+ +  ++ KH+ F AEI ANE RI  + + G  L+   H +S ++++ + +++  W DL      K   L QA+ Q+   R +ED    L E+++ L S D G DL SV +L +KH +LE ++  + +++     +  +   + H+DAD I     ++  RY  ++ P  +RK  L+++   HQ   D D E  WI EK+PIA S + GR L    N++KK + ++AE+  H  +I +V  +  ++I   H A   I+ K  +++  WS+LK     R+ ++D  ++ QQYL DA+E ESWM EK   + S ++G DED+   LL KH AL  D+  YR  ++ L
Sbjct:  896 LEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEP---SPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKF-----EQLDRNPNDVKSLQN----LERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERN-PRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKL 1725          

HSP 4 Score: 322.783 bits (826), Expect = 8.183e-88
Identity = 433/1887 (22.95%), Postives = 850/1887 (45.05%), Query Frame = 1
Query:  763 LKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTK-------DADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPL-SEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFL-------AEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAE-VESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFG----------KDEDSTEA------------------LLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYD-------YQEKNPREVSMRKG---DVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSD-IDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPG--HLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEA---VEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPN-EAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEK---LQNTLDESYKDPTTNIQAKH-QKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKV-KQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFM-WKTDVV--ESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERY 6204
            LK LA  R++ L +  ++ +F+R+ D+   W  E  + L  E     +A   A +RK + L+ D+     K N  T+         D +S  H  S+  I+ ++  + + W +L++   +R  +L+ +  +  F +       W+  +      D    DV  ++ L       + +I + ++   + K         +HP  +  I  K+  L      L++   E+ +L EQ    ++F         WI K    +  +     +   E L++KH +  + +  ++ + +    +  RL+E  +   + V ++  +L+   ++L +  + R + L+   + QLF+R+++ I A       T   E + E  NL   V+  +N L       A++ A E+R++       +++ + H  S  I++R  ++      +  A+  ++K L  +   Q+  R  +++  W+ E  +  ++ DD     +++ +   KH   EA+I +++ RI     + D  V ++H+++  ++K   +V+ ++  L++ +  + ++L  A       R  +D    + E +    S + G DL  V++L++KH  ++ E+  +  ++ ++ N G+KM    HY    I   +  +   ++ +K  A +RK  LD+S    Q + D      W+ EK+P+  S + G          K ++  EA                  L+K+H +  + I+A  S +++  ++          V D +G +    L+D         EK     S   G   D    L S H+   +     RQ      +++K++    + ++ N P       +Q  L  +++ L  L  DRR+ L+D+V  Y+ +RE+ DL Q + E   VA++E       HL+ +QS   K DEF  + K   E+    +  AN + R     A   V+K E + T      E +E   ++    L     + R+HR+ DE ++W+ +K A +   D+G+D+  V  L++ H+AL++++     R+  L  +A  L +T+P   AE I   Q+ + + W +L    +D K  L  + DL  F    RDL++W +   + + SD    D+  AE L   H  L+                       E+DAR   F    + G++++   HYA  EIK K   +  A E+L  EW  R   L Q ++   + R+ +Q    +  + ++L    +G  V D  V+S  K+ + F +A++  +++   L   A++L++  H +   I      V      L++++ A  + L D   L +F  D  ++E WI+EK   ++   D S +  + + + K  Q HQA EAE+ AN   +  IL  G +LK     + +   +  R ++L+ +W+ L     D+S  L+EA     +   ++++  W+ E E  +S+ D GKD      LL +     +D    E  + ++N   ++ ++ G    D +++ ++ +NE++  +  QLA  R   L  A ++H F R ++D +  I EK   + S+DYG+D   V  L +K   LE ++ A    + + +K   +++ E +    + +   L+ LE +W +L + + +R  KL  S +  K+LD V++ E W  + ++ ++S          + +L++H   + ++    ++   +  EGQ L  +   +   +++  + ++     LR+     K  L+     L++M W  + V  E W++DKETQV   + G    +V+ L+  H  F+  +   + E I+ +T   + L+   +     I  R + +  R   L  +S  ++ H+L+  ++Y
Sbjct:  920 LKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPEHVA---AFRRKFDKLEADM-----KTNGGTQLKHINDIANDLISEGHGQSR-KIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWM--LSKFEQLDRNPNDVKSLQNLERDLKPLEDKIAALEKLAAAVKK--------DHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLER-NPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDA------ATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVD-WGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQ------WLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQS---KFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSK----LAVAEELHRFHRDVDEFEQWMADKMANM-PRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLS----------------------HEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVAD--VESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKN----LHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLA-AMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKIL-EKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQ---KLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRK-QSEKIDALTKNADALVSGGNNYRADIVTRSEEVTAR-HALLLKSMEKRGHMLEDSKKY 2730          

HSP 5 Score: 305.834 bits (782), Expect = 1.015e-82
Identity = 245/944 (25.95%), Postives = 457/944 (48.41%), Query Frame = 1
Query: 3583 VQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKT--VDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEG--IEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAE--------EDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAE 6378
            V  ++R+ ++  E I EK A + + D GKD  SV+ L RK  ALERD+ A+ +++   D  A ++++  P   E ++   +++ E W +L+  AE    KL  S  L K+L D + +  W N +   ++S +  KD  GA  +LE+H                       E  AEID RS   +   + G+ L +     + E++   + + +++ QL + W + K  L + LE  L+  +  Q E W++ +E+ +   ++ D T  V+ LIK H  F   +  Q +K+ AL + AD LV   +  +  I  + +EV AR   L ++M      L D +    FIR   E+ IWI  KLQ   DES+ D  TN+++K QKH AF++EL  N +RL ++   G++L      M ++  V+ ++ +L   WD L  KS  K+++L+EA         ++DIE WL +VE  LSS D+G+D  S + L+ K   L T+I    D + ++ ++A E    G+  +D   ++ + +  RY  + +  + R   L  A+    + +  +++  W+ ++ +L SS + G  L    +L+KKH  LE E+   +  +   E++G +++ +   A+   I++ L+ L +A + L++   +R+  L+E+ +  ++     E E W+ E+  L  S + G   A  +  L++    + ++++ +++ + +      L+   +H+A +I  +   L      L +   RR+  + D S + +F+ + D +  W+ +KE    ++DYG+DL   Q ++   E F++ +      G  +  +      L+ S H    +I  +  ++   W  +   +  RK  L   ++ ++        F ++A    +W ++ E        EDL+       L  +KA  + H  F + +KA E
Sbjct: 2412 VHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQH----------------------HERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLD-HTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQ--VKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFAST-HIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQII---EQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHR--------FDQEADQILNWLQDKEATGVAMEQEDLSRA----DLASVKAQLQRHDEFMHGMKAVE 3314          

HSP 6 Score: 223.016 bits (567), Expect = 1.397e-57
Identity = 224/943 (23.75%), Postives = 442/943 (46.87%), Query Frame = 1
Query:  154 RKKLEDAKKYQYFKRDADELESWILEKIQTY-SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHL---------LQEDFPEQESLINKK-KDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRV---LYEQNM----DLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKV---QKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTE----FGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD 2907
            R +L  A +   F RD ++ +  I EK+    SD+  KD  +++   +K  ALE +++A  + L A DK+   ++E      E +   L +L   WE+L    + ++  L  +    ++L  V ++  W  +    +TS +  +D           N   K LE   E+ AEI  +++ L         L ++ PE ++ + +  K V+++  +L+   +  +  L +  E   +  +  +   W+++K   +   + G    +V+ L + H A +  +    EK++ LTK+AD L +   + +  I  + E + +  + L K   +R   L+ S   H F+    +L+ W+T  K  +A DE   D   + + +++H    SE+   ++   + + +GE+L+T NH +SE +  +L       V L   W+E R    L  Q +    +L    R  E  E W+ K E  L ++D G  + S E LI+K +  +  +A + +    +   A  L   G  AA D  K+ + +  R S L+E  ++R+ +L D+  +  + + A+E   W+ +++  AS  + +   +LQS +   +KH     E+   +S ++D + RG++++   H  S  I++ ++ L      L  +  ++   L +A    ++     + E WL E      S + G+D     +  ++  +L+ ++   ++ ID   ++AD  +  +H DA  I  KQ ++   +  L     +R+ ++ DA K H+F R ADD  DW+ EKE  A + + G+DL   Q +I++ ++   E+     R+  V    + ++ + H     I  K  D++ +W+ +   A++RKQ L+ + +  ++  +A +  +W+++KE    + E       D  S +A L++HD  M  ++A    +  L  +A+
Sbjct: 2403 RTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKD----------SNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWIT-AKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQL-------VELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLAS--SGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAE 3325          

HSP 7 Score: 211.075 bits (536), Expect = 6.430e-54
Identity = 175/800 (21.88%), Postives = 375/800 (46.88%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA-----SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAG 2469
            DI  R E+V  R++   ++ E+R   LED+KKY  F R   EL  WI  K+Q   DE+F D TNL+SK QKH A + E+    + L+ +++ G  ++ ++H+ SE ++ +L +L + W++L      K++ L+   +     R+V++I  W  + E  ++S++ G+D+   E+L KK +    ++  + +   E+  KA  L  +     +  + + + VE     L    + R++ L +A    ++ +  ++ + W++++ +  +S + G  L S  +L++KH  L+++L   +  +N   +   ++  +   +   IQ   + L SA   LK+    R + L  +   H + ++  +   WL +   +  + E+ +D AG E+ + R      E++         K   + L+   H  +  I  K  +L+     L +    RR           F R  +    W+ ++E      D G  L+  + +I + E   + LAA  E+   +      L+ +GH   A +  K  D+    +++ E A  RK +L  +     FD++AD+I  W+ +K  T       D +  +  ++++++Q+H  F+  + A E ++ ++ +  + L +S  +    ++ R  ++++   D++ A+K   + L      Q + +   +M  W+  ++S + S+   +D+ S  +L ++H+    ++   +  +D F +Q  + +   H  +  I++K + +   +  L E    R     +   + ++ ++A+  + W+ E+  + G
Sbjct: 2698 DIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLG 3497          

HSP 8 Score: 208.764 bits (530), Expect = 3.225e-53
Identity = 224/976 (22.95%), Postives = 450/976 (46.11%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWI---LEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPL-TSEDFGRDLASV-QALKR--KHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLD-KERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDE-QHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGK--ETVMALY 2973
            E I  R++ +   +   K AT++R+  L  A     F     +L +W    +  IQ  SD +  DL   +    +H  L  E+ A+      L  +G  MI   HYASE I+ +   L +  E+L + +  ++  L   + +  F R   +I+     K T + S   G  +  VE   K+ + F K L   +E+ A +   A+ L++    E +++   + +V + L+ L+   + R   L +A  +  F  D  +  +W++EK+  +  ++D   +  S+ + +KR   H+AL+ ++ A +  V+Q+ +  ++L N H + K  I ++ + L   W+ L     +++  L+ +  L RF     ++L+W+ + + +++  ++ KD+     L+ER +  +S+    +++       GE+L+       + +  + + L+ K R++L QL + R  L    M++  F RD E  +  I ++ A ++++D G    SVE L+RK    E+ ++A  +K    D  A +++E        V      L      L + A+LR   L  S     +  D  +++ W  + + K  S +  K+    +  +++H    AEI      +  +   GQ L         +++   + +    + L    + ++  L +      +       E WL++ E+Q+A  + G   ++V  L K H+  E  +    ++ID+  + AD  V    ++ AD I  +  EV+ R+  L + ++KR   L D+ K H+F R   +   WI  K  +A   +   D   +++ ++KH A  +E++ +E R+  V  +G++++  +H+    ++ ++ ++++ W +L+ K+  + Q L ++ E         + E W+ + E  + S + G+D  STE L+KK D L  +I      +  +  +A   ++Q +  +D   K  E V A Y
Sbjct: 1953 EQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQ--SDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNPK--IANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAA-MEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRAD-IVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF-LDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARY 2921          

HSP 9 Score: 205.682 bits (522), Expect = 2.546e-52
Identity = 216/970 (22.27%), Postives = 438/970 (45.15%), Query Frame = 1
Query:   64 KILETPEDIQERREQVLNRYSAFKE-------ATEERRKKLEDAKKYQYFKRDADELESWILE-KIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDM-IENHHYASEI------IQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEA---WIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA-SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGST---NVGR-DLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQA 2904
            KILE    +   RE VL+     +E       A E R +KL  + K   +  D  ++E W  + + +  S +  KD    +   ++H   + EI  +SE L  L + G  +  E   + +E+      +Q    QL   WE       EK  L KL L+++ +     +   W  +KET V   E G   + VE+L K  + F + +  Q EK   +   AD L+      +  ++ + ++V      L    +KR   L ++ +  +F R   + I W+  K + L  ++   D  ++++  +KH A D +L+  E++++ + +  ++L   +    + ++ +   L S W  L+ KS  + ++L  ++ LH       D+  WL  ++  +++D+  +D+   E L+++ +  ++EI  R ++      +  EL       ++D + + E+++     L +    RR   E  +D Q F++  + AE    W++ +     + + GDSL S  +L +KH   EK L  ++      +     ++   H+A+  + K  D L      L+E   LR+  L+++ +   +  +  E + W+ E++  A S E  ++    +S +++      E+   ++ ID +K R   LL   H+ +  I  +  +L+ L+ DL      +   +  AS   +FVR  +D+  WL E E   +++D G+DL     + ++      ++++  +R+ +  +  +  +   H     I  K  +V   +  + E  ++RK  LN A ++H+F ++AD   +W+ +KE    +    ++ R DL  V+  +++H      +   E ++ E+C+E +++ N+       +E +  DM+    D+   A K  + L      Q Y  +  E   WM+  +  + S +  +D  S E+L+++HD    +++  +  +D    Q 
Sbjct: 2475 KILEKRPPL---RETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWES------EKGTLQKL-LEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAK-LQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRR---ENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQG 3430          

HSP 10 Score: 203.756 bits (517), Expect = 9.360e-52
Identity = 195/921 (21.17%), Postives = 438/921 (47.56%), Query Frame = 1
Query:   73 ETPE---DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTN-LQSKNQKHQALELEIAAQSENLNALDKNGYDMIEN-HHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQK--KFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQ---LASDDCGK-DLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQ----FVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVG 2787
            E PE   ++Q   ++V N     ++  E  +  L+   ++  +  +A + E W+ +K    +     D T+ ++   + H A E  +  QSE ++AL KN   ++   ++Y ++I+ TR +++ A    LL   +++  +L+ +  Y +F+R+  E++ W   K      E F   L+H  +  K  K   F  +L   E++ + +  + + L+ ++    E +  +  ++    + L+  +  + Q+L EA E+    R  +    W+++    L+S+D GRD+ S + L +K + L  ++    + V ++ K A EL  +   + D    + E + + +S L +    R E L  + +  +++    + L WL+D   + ++ E    +    +L ++H   + E+D+R  +    +  G+++I   H  S  I   L+RL    + L +    RR L ++ +D   +Y +  +AE W+ +Q     + ++G      E+ +R+    +K +   + +  RL   A+ L+   H+ A  +  K+  L     +L  +   R++ + D+  Y  F R AD++  W+ EK ++AS E+Y +   + Q  +++ ++ + E+AA   R+  V+   ++LL S H     I  +  ++ +LW  +   +  +++ L  A    +F +  + +  WL + E+    +  +D  + DL SV    ++H+     + + + ++     +A++    F D +H     ++ ++ ++  +   + E   K   KL     L  ++++  +   W+   +    S  + RD+   ++L+++H     E+ G +P + +   +G++MI + H   ++I++K+D ++  W+ L      R +L +++++ Q++  +A + +SW+ E+  L+G
Sbjct: 2585 EQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIV-TRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF---LDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHH----LEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLG 3497          

HSP 11 Score: 194.126 bits (492), Expect = 9.161e-49
Identity = 260/1342 (19.37%), Postives = 580/1342 (43.22%), Query Frame = 1
Query:   58 EIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWI------AKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWI--VEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVT---EVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSD-ELAKDVTGAEALLERHRDLAVEI 4044
            ++K L     I  R +++  +++    A  ++   LE+A+    FK+  + + +WI EK +   + +  KD+ + +   ++      +     + L+ +++ G  +++    + + +Q     L+  W  LL         L   ++   F R V++      EK   + S+++G+D   VE+L +K +   +D+    +K       A  +L++  P +E++++  K +E++ E+L   A+ R +KL  + ++ K+  D  K   W N+    +TS    +D    + +  +H     ++    E++  L ++   L+ + P+ K  +Q   + + ++   L++        L        +  +      WL+D +  +A  EL      VE L++ H+  +  +  + E   +     + L++  +    DIV + E +     +L++   +R  + E +     F R   +   WI      A  E+FL++ ++   L       +KH  F+  L   E++   ++    +LV + H+ +  V  +  +L      L  K+ L+   L ++       R  ++I+ W+  VE  + +SD++ ++  + +  ++K      EIA     + ++  + + L       ++D  ++ E+++  ++ L    +++ +NL  A    Q+V+  E+   WL++     +S + G  L S  +LQKKH  LE ++ + Q  ++   Q+    + ++HF +  I+K  + +S+  + L+E    R+  L +A   H++Y +  + E W+ E+ P+A S  +GRD  G ++ +++   +  E+   +  I  +      ++  +H+    I  K   ++ ++ DL  +  +R+  + D+ +  +++  A +   W+REKE    + ++G+D +  + +          IE + ST+  L                +   E V A+   QE           D+L                 R GH    Y   + A  +D+         VA+++K   N                  + Q ++  +EA+ +  W+ +KE   V    E ++   L +V+++ ++ DEF++  K  E+++ EL  +A +L  S   +    +E     ++++ + + E   + ++ L    ++Q Y +E  E  +W++   + + +  + +D+ S + L R+HD    ++      V     +   ++Q+    ++ I +  + + + W  L    +D       ++D+QK+  +   L SW+     L+  D  +   V  AE  L    D  V +
Sbjct: 2265 QLKNLHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKL-------QKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEG-ELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQI----------IEQFESTVREL----------------AAAGERVAAVQRAQE-----------DLL-----------------RSGH---PYGASITAKGADVQRLWTHVNEVANERKQALN-----------------GARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSF-PDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGDDWRMVDSVEMAETHLRDFDDFLVTL 3523          

HSP 12 Score: 179.489 bits (454), Expect = 2.177e-44
Identity = 205/950 (21.58%), Postives = 417/950 (43.89%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTY--SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDS-NHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDE----DSTEALLKKHDALMADIEAYRSTIDSLRTQADACK 2916
            I++RR  VL R  A + A  +R+K+LE + +YQ  +R+ADE+  W+ EK +     D++    + +  +  KH+A E EI A    +  ++  G  ++   HY S  ++  + Q++A W  L      K   L+   D     R +++      E +T + S++ G DL  V+ L +K     +++     K ++I ++   +  +   + + + +    +      +K  A++R+  L E+    +   D D  + W+ EK    +S+D GR L     + +K E L+ ++     +++++   A EL  +H  +   I+ K   L +AWS LKK    R   +D      ++L D  ++ SW+ + +  +A+++   D      L+ +H     ++ +  +  +  + +  EL+  N P  E    + + L +E   L +L  +RR   E  + L  + R++      I +      + +  +  + ++ L  K ++F++ +    E+    +  AN ++      A DV KK++ L    + L E  + R S L  +     F RD DE + W+ +K+     +  ++  ++ S  Q H+    EI  ++ R+  +    + L  +     +E I  R + L++ W +L +A+  ++  L  A     F   V D+  W     S + SD    DL     LQ +H+ L  ++ + +      +   ++ +  QH+ ++ IK K + + +   +L+     R   L+ A + H F R+A      I  K     S  VG  +  V++  K+    +  +   + R   + +   +++ A H   ++I     ++      L+   + R  +L D+     + +D ++ E+W+ EK   V   +    E    D     L+ H AL A++ A +  +D +  + +  K
Sbjct: 1318 IEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLK 2267          

HSP 13 Score: 173.711 bits (439), Expect = 1.436e-42
Identity = 207/954 (21.70%), Postives = 430/954 (45.07%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKK-YQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMI-ENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFP--EQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWI-AKQEAFLENNDVGD---SLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK-LKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHR-DIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADA 2910
            E  Q+R+++++  + A  +  E+RR  LEDA   Y+Y +  AD  +S I E ++    E F +D  +L+    K    + ++   SE   + +     ++  N  +A ++++ + + L   W  L    + +   L +  +  +F R VDE   W  +K   +   + G+D++HV  L +      K++   + + A++  +A+  L++ +P    E +  +++ +E   E LKN    R+  L  A ++  F       ++W +     + S+    DL   + L+ +H  L  ++ A E +  +L  D +++      + + I++K   L SA   L+ +   RN  L  +   H F  + + +++ +   +  + +  +   VA VE+  +R +  +  + + DE   +  +   EL+   H  S++I      + +E  +L Q    R  + +    L  F  D  Q EAWI  K     +  D+     S+D     ++ H+  E  + A +    ++    N+L +N H      N+  D+L  + + L      +  +LE++ +   F +  + + AWI EK +  ++ +  K+  + +  +++     ++   +E  +D++   G+ L+    +  + +++  + L++ W  L+         L  A     F R+VED +  + E  + + SDD GKD  SV  L +K + LE D+S+   ++ +  + A + ++++    + +     ++   + +L +  + R  KLN ++KL+++  D    E W ++      S    +D  G + ++++H   +AEI G    +  +  EGQ + N +   H+ ++++    ++N    L+   +  K  L   LE   +  +A + E W+ +KE  V   E G   D+ E L+K H A    +      ID+L   ADA
Sbjct: 1741 ERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQS-IEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQ-EALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANM-PRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAER-LKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQL-KNLHRNPKIANRC-DELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQAL-NQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADA 2687          

HSP 14 Score: 171.4 bits (433), Expect = 6.617e-42
Identity = 208/947 (21.96%), Postives = 416/947 (43.93%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNL-------QSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQD--LEHVEVLQK--KFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELS-NKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDE-QHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTID 2886
            ++E+ + +++  ++ ++    R   L+     Q F R+++ +++       T   E F +  NL       ++  ++H+ LE ++ AQ   L A  +   DMI+  H  S  I+ R   + A  E +     ++ + L+ +L+Y +  R  DE++ W  EK   V S   G D  L    +  +  K   F  ++   E +  +I S+ D L+ +   E  ++    + V      LK     +  +L +A + +   R  +   + ++E    L S+D G DL SV+ L +KH  L++++     K++ +     +++ + H D+ D I      LL  ++ +K  +  R   LD S   H+ + D    L W+ + K + ++ +  + +     ++++  + ++E++           +  ELI  +H  S  I  K   L+     L +L   RR + +  +  Q +  D  + E+W+ ++   L + D G+  D+   L+ KH    + +    +  ++L+     LVE+         K++D+L+     L + A+ R+++LED+     + R++ ++   I E L+ A  E + E   +L+    K   F  ++     R    +     +L  N   + D+ ++ E L   WN L    + ++  L  A    +F R+V++ E W+A+  + +   D G+D+  V +L + H  L+ +I + Q R+   +++A++        +A+ I  +Q  +   + +L+   D RK  L  A+ LH F     D   W         S     DL   + L  +H  +  E+   EP    + N+G+KMI A HYA  +I+ K   +K+    L+++   R   L  +++   +  +A +  + +  K   + S   G      E+  K+ D      E   ST+D
Sbjct: 1212 VEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDA------ATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMS---GDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDA-DRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPR-DLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTF----EKALSTLD 2143          

HSP 15 Score: 169.088 bits (427), Expect = 3.049e-41
Identity = 210/961 (21.85%), Postives = 442/961 (45.99%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQ-SENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQK---FFRDTDKTISWVNEKSIPLTSEDF-GRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIA-KQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA--SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRI--LEV-CNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVS 2937
            + +R+ ++ N Y   K   + RR+ L D  K   F R+ DE E W  E   + +DE   +  ++ +  +K   LE ++       L  ++    D+I   H  S  I+ R  +++A+W+ L  + K++   L+ T     F    +    W   K      E+  ++   V+ LQ       +DL+  E+K A +  K    +++D PE+ + I +K     AL    +L ++ Q+K+  A + Q    F       I W+ EK+  +  ED    D+A  + L +KH  L   +   + +V    +    L  ++P     ++++ + L+S  + L+     R+  L     L  F  +   + +     +A +  D L   V  VE L++RH + ++++D+++   ++     +++I   H  S  I  +   +   R  + +   +R+   E +++ Q   R+ ++   W+  K +  +  +D   +  ++   + KHE FE  + A E + Q++++  + LV   HY + +V K    +  +  +L+++   +   L  + + +  DR  ++  A  +++++TA  S +   +  +++  +QKH     E+    +++ D++NRG+ +    H  ++ I   + +L + +  +   ++ ++ +L ++    Q V +V+    W+AE +   +S DCG+ L    N+ KK   LEA+++ H  +ID  L QA + +   H  +  IK K +E+   + +L++ L  R+  ++   K  Q+  DA + E W++EK     S + G D    + L+ KH+A+  ++  +   +  LEV C E   ++ ++       +K+ D++   +  L   A+ R+  L+D++   +Y+ ++++    + E   +  S EF +D +  + L  K D     ++       S  T A+A   +  P +
Sbjct:  906 VADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPE--HVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSK-----FEQLDRNPNDVKSLQN----LERDLKPLEDKIAAL-EKLAAAVKKDHPEEAAAIERKIAELRALH--ADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWI-EKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNP-RMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHA-KLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVE---LVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFA 1846          

HSP 16 Score: 158.303 bits (399), Expect = 5.821e-38
Identity = 192/937 (20.49%), Postives = 412/937 (43.97%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYA-SEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSN-KHPDSKDTIQDKKEALLSAWSH-------LKKKSVE-RNEQLDVSYSLHRFLSDYRDLLSWLTD-MKAVIAADELAKDVAGVEALMERHNEHK---SEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDAL 2850
            D+ +++E +   ++   E  E R  KL  A++   F RD DE E W+ +K+     +  +D+ ++ S  Q H+AL+ EI      L  L +    + + +    +E I  R   L   WE+L N   ++  +L+   D   F  +V ++L WT    + + S+    DL+  E LQ + +    +++ +E + A + +  + ++       E + NK   ++ ALERL++    R   L +A +   F R+  + I+ +  K   L S   G  +A V++  ++ +  ++ L  L+E+   L   A+EL   +H +SK+         +S W         L ++ +E R+  L  +++L  F SD   + +W+ +    V  A +L+ +   ++  M+R   H+   +E+ +           G +L  ++   +  I N+ + L  +   L     ++ +  E+  DL  F +  E   AWI ++E  +   D+G  ++    L+ + +         E+    ++ +  +LV+ G  +   V K++  L  +   L  +    ++ L  +     F+RD ++    I EK+     ++Y K+  +++  V+K      +++A   ++       Q +L+      E + + +++L++ W  L  A++++ + L ++    +++ +V+ +E W  +V +++ S    KD N    + ++H+  +A+I    + +    ++      EQ      +++    V N   +L++  +  K  L    +   +  +A   E W+ +KE       +G     V+ LIK H A +  +     +I  +      +++  +    DI  + +++    + L    +KR  +L+DS +  +++    E   W+  K  L     F  D  +  + L+KH A 
Sbjct: 1848 DVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKN---------ISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHR--NPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF-LDHTNLRSKLQKHMAF 2772          

HSP 17 Score: 131.339 bits (329), Expect = 8.999e-30
Identity = 107/400 (26.75%), Postives = 193/400 (48.25%), Query Frame = 1
Query: 4891 KSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMN--ESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIES 6084
            + EKL++  ++    A L+D   WL  V+  L   ++G+ ++ V+  L K Q + TDI A EDR K L    +E       +SD +R  ++ I +R+ ++  L E R   L     L    R ID     +   +  V + D G+ LIGV +L  KH  L+ +I+AH  ++  + +  +  +   E Q    D ++RKL+ +   +  L +L   R+  LE +    +F+   EEE AW+ EK+ L ++      ++AV      +   E +M+ H  +   +   G++L+  N  + + I++R   +  + + LR A     + L +     Q+    +  ESWI +K   VKSDD GRD  + ++LL +H   +  + +++ + I  +  + +QL  S
Sbjct:  414 RQEKLEQLAQRFHKKAKLRD--SWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQF---DVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLV-QNGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSD-ISRLEEMQSQLANS 806          

HSP 18 Score: 125.561 bits (314), Expect = 5.310e-28
Identity = 127/545 (23.30%), Postives = 239/545 (43.85%), Query Frame = 1
Query: 4984 LSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFR--IEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAEL-IRETKRQEENDVLRQEFAHMADKFHQWL 6609
            +S  D     +++   L KH+    +I A+E RI+ +N   D  +     +S  + +  + +N ++  +K+   N+ + L +A       R ++D  A + E +  ++S+D G DL  V++L +KH  LE E+  +   +  +E +G ++  +    + D I   +  L   +  ++  +  RK  L+ES  + + +  V+ E  WI EK+ + SS D G TL     ++KK +  E ++  H  + + +  +  +LI  ++  +  I+ +   L      L+K    R+  ++      Q+++    VESW+ +K   + S+DYG D  + + LL+KH      + ++R  +E +EV      +L+ESN    +  + R   L+  +D L + ++ R++ L       +    LY    + A    S  EN    +++       E +K L      FK  +K   E F         I               EAL   W  L   I+ RD++L + E   +   DV         D+F QW+
Sbjct: 1371 MSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHY-DADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCV---ELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNAL-------EDAVCLYEYMRESADLGQSIEENLRVAMSEEF-AEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDV---------DEFEQWM 1894          

HSP 19 Score: 102.834 bits (255), Expect = 4.014e-21
Identity = 174/843 (20.64%), Postives = 363/843 (43.06%), Query Frame = 1
Query: 3565 LEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIR---ESSLLGEDVDD-KTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAF--EAELAAN-AERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKK---ILVSSEDYGR-DLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQ-LAN--PDEIKRKLEHLETAWVELQ-QLSSIRKT------KLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESF 6030
            LED      + R+C E   WI  K  +L   +   D T+++   +KH A + +LV   +R+  ++ +  +LV  +   +E +     E+   W++L TK+     +L  + +L        D+  W++ +   +SSD+  +D+   E L+++   L  EIA R+                  DA     +      +EL   G  A ++  ++ + +      L+E    R++ L        +++  E+  +W++ R    SS  GE  D  ++  SL KKH    + ++ ++  M   ++    ++   H+    I+     + +   +LKE+    R  L +      +  +  E E W+ E++   + +         ++  ++      E EL  N  +RL+     G   +E    M    ++  +  KL   +  L  +   +  ++ +A++   +     D+  WL E E S S+ DYG+D      ++ + +    ++ A  +R+  +    ++ + SG     +I  +   +   +  V ++A  R   L  A+++H F +  D    W+++K+   + +  ED  R DL  V   K + QR +  +H     +++VEKQ  EL +E++ L N  PD       HLE   ++++ QL  I +       KL      Q +     E   W+   Q  ++S      +A+ + L+++HD +  +M+  +   +D   +G+++I  ++  ++ I+++ + L +   +L +    R    E+N    ++    + ++SW+ ++   +  DD+ R + SV+   T    FD  L + 
Sbjct: 2724 LEDSKKYHEFIRQCGELIIWITAK-LQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRS------------------DAVVEMMKK----ARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASS--GESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKK-RADGLLAREHHDAM----SIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASV---KAQLQRHDEFMHG----MKAVEKQVAELCHEAERLWNSFPD----TRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEER-AGLLGDDW-RMVDSVEMAETHLRDFDDFLVTL 3523          

HSP 20 Score: 93.9745 bits (232), Expect = 1.601e-18
Identity = 160/777 (20.59%), Postives = 314/777 (40.41%), Query Frame = 1
Query:  523 EILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFM---KDLEYQEEKAAE-----IYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHE--------IQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLK-TASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQAS-GQQQFVRNVEDMEIWLA----EVESQLASDDC----GKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPR-ILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREK 2772
            E+L W +     + S  F   L  +     KFN+F    K  +Y+E+   E     I +K   + ++ +   + L     D+E A  +L     +RQ  +    +         Q+F +      SW+    + L   + GR  + V+   +K +A+  D++A E++   LT   +EL  +     D ++  +  ++  W+ L     +R   L     L   L D   L + L  ++  +   ++ K + GVE L+ +H+   ++I++               I       + +  KL+ +  +   L++L   RR+  E+   L  F +D E+  AW+A++E           + +V      +++ E  +     +++ +     RLV+NG  +  D+ ++   +  R   L        + L ++ + Q + +DA+E ++WI EK+    SD+  ++    +S +Q+H     EI A +S I  ++     L +S  + +    + ++E +++    V  S   E N  + S G+   +      E W A      E  + ++ C    G+ +      QK    LE + +           ++    D QH           ++SN Y +L+   D R+  L+D  KL +FYR+ D+ E W  E E           +   +    K +A      G + + I ++ N+   +I+  H   R IE +   +  +W +L+    +R   L+ +     +      A  WM  K
Sbjct:  311 ELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLF--MHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQNGQ-SKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTA-TTSQSVQETEEVNVPQVEMSYNYEGNGMRVSKGEVLALLEKSTPEWWRALKRDGTEGYVPANYCKIVPGETVTVTQTTQKTTTTLEGNET-----------KSSVVADRQH-----------KISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIAND---LISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSK 1058          

HSP 21 Score: 80.4925 bits (197), Expect = 2.390e-14
Identity = 55/236 (23.31%), Postives = 111/236 (47.03%), Query Frame = 1
Query: 2086 QQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGST 2793
            Q+F +  +  + WL  V+  L   + G+  + V    KK   +  DI + +DR        ++   E++ ++D ++  + E+ +R+ +L   L++RK  L     L    RD D   + ++  EP   + +VG+ LIGV++L+ KH  + A+I  H   + ++       I         +++K+D++   ++ L      R+  L+ +    Q++ D  E  +W+ EKE L  + 
Sbjct:  423 QRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTA 658          

HSP 22 Score: 73.1738 bits (178), Expect = 3.255e-12
Identity = 69/320 (21.56%), Postives = 147/320 (45.94%), Query Frame = 1
Query:  106 QVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADEL--ESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEA 1059
            ++++R++      E+R++ L          RD D L  E + LE      D   K L  ++    KH  L+ +I A    L+ L ++  + I +     +++Q +LD++ A +  L+ + + +   L+      QF++  +E + W  EKE   T+     D+  V      +     +++    ++  + +  + L+Q +   +E +  +   +    ERL+         L EA   Q++F+D ++  SW+ EK   + S+D GRD  + ++L ++H  L+ ++ A +  +++L +   +L+N    +  T Q  +E 
Sbjct:  503 EIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVG-KHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSVQET 820          

HSP 23 Score: 69.3218 bits (168), Expect = 4.926e-11
Identity = 91/423 (21.51%), Postives = 181/423 (42.79%), Query Frame = 1
Query: 3496 GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRE----SSLLGEDVDDKTVDSLIKKHEDFNRAINMQED--KMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAA 4746
             II +LQ++ E+LE++              QR+H++      W+      L   + G+  + V++  +K  A+  D++A  +R K+L +   EL     +E++ +   + EI + W +L T  E  K  L +  DL   L D   L + + ++   V + ++ K + G E LL +H DL            +D         A+I+A               ++      + ++ KL  +      L E   +R+  L++   L  +++D E+   W+  +E    ++L   D+      +L+ K    N  + MQ    + + +    ++LV++    +D I+ +  ++  RW  L+  + A  + L + +  Q + +DA+E E WI EK+     +         ++  Q+H   E E+ A
Sbjct:  407 AIIAELQRQ-EKLEQL-------------AQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKH-DL------------LD---------AQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYK----NVEMEMQTHWARSKGMIAGGERLVQNGQSKED-IQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRA 788          
BLAST of Spectrin alpha chain vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 422.165 bits (1084), Expect = 4.431e-118
Identity = 418/1595 (26.21%), Postives = 753/1595 (47.21%), Query Frame = 1
Query: 1840 ENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL---RTQADACKMQEAPVSDSYGKET-------VMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEIND-RQGHVPAAYVKKVDA-----------MMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEF-VNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEK--LQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLH---NQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSW----FENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNP-YTWFTMEALEETWKNLQRIIQER 6513
            E+ +  + ++  ++K Q    +I A E R   +      L    +++S+ ++    E+   W  L++  + +++ L   +     +R+++ +   L  +E  + + D GK L  V +L  KH+LL+A I++H   +    Q A+ ++  +    D +++K +EV+ +Y  L E    R++ L  A  L QF +D ++E  W+ EKE +  +     D+  V      ++ ++ E+  H  R   +   G++++  +  +  DI++++  M + W  L+   D     L ++  AQQY  DA+EAESW+REK PLV S + G+DE + E+LL++H  L  +I AY+S I  L   ++Q        A  S S  +ET       V   Y+Y E N   VS  KG+VL LL  +  +WW+    D  +G+VPA Y K V               + ++ N  +   VA +Q  + N Y  L  L   RR  L D+++  +  RE ++  +W  E E V++ +  +P H+ A    ++K D+   + +     ++K + D AN L   G  ++  KIE    ++   ++ LE +  ++   LE    V  +   C+ A+EW+  K  +L+ +    D+ S+Q L       ERDL  L +++  L+  AA + + HP EA  I +   E+  +   L  +A++  +    +   + F +  RD++ WI     ++  D    DV  AE LL++H +L  +I ++  +    QE                       G+ LL+      ++++E+LQ++      L + +  R   L Q L+LQL+ R+ E+ +      E+ L    LG+ V+  +V++L+K+H D    ++ QE +++A    AD +++ +H D   I+ + ++VLAR  +++      + +L      Q   R+ADE+  W+ EK  L  + D+S   P+  I  +  KH+AFEAE+ AN  R+Q I   G  L  K     +   VE+ V ++  QW  L  +  +K  +L++A  Q   +  L+D    L E++ +L+S D G D  SV  LL KH VL  ++  + +++ D+  R  +    G  D+D I      + +RY  +K  A+ R   L +++  H     +D E  WI EKK + SS+D GR L    N+ KK ++LE E++ H   I  V  Q  EL+     A+  +IK K   LETAW EL++L  +R+  ++   + Q++L    E E+W+ EK++ L+S DYG+   A + LL KH A   DM  +      +  +  +L++ N  + +  ++R + L  + D L K A  R++ LED     ++M ++  +   I +      S+++  D   ++ L +K + F   +++    G E  TS     N ++  N   +  +  + + L   W+ L    + R   L   +E ++        F +    F  W      N   DL   V+      + +L + H      +  ++     L +  + ++    GGN        + LE+ W+ L+    +R
Sbjct:  550 EHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSV-QETEEVNVPQVEMSYNY-EGNGMRVS--KGEVLALLEKSTPEWWRALKRDGTEGYVPANYCKIVPGETVTVTQTTQKTTTTLEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIE-VSLADEPSPEHVAAF---RRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQS-RKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNP--NDVKSLQNL-------ERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQE----------------------LGRRLLERNPRM-SKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVE--SVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSA-IPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHY--ESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSAS-SQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKN----GSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHR--------FHRDVDEFEQWMADKMANMPRDLGRDVK-----HVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDR 2079          

HSP 2 Score: 401.364 bits (1030), Expect = 1.012e-111
Identity = 274/938 (29.21%), Postives = 491/938 (52.35%), Query Frame = 1
Query:  130 FKEATEERRKKLEDAKKYQYFKRDADELESWI------LEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQE 2925
             ++  E R   L+DA     F  D  ++E+WI      + K Q  S E+   +     + Q HQALE E+ A    ++ + + G + ++N H   +I   R D+L   W +L     ++S  L+   D ++F + V+ +L W  EKE  V++ + G+D+EH  +L ++ +    D    E+   EI    + L+++    ++ +  +++ + +    L       + +L  A E+  F RD + T   ++EK   + S+D+G+D ASV+ L RK  AL+RD+ A+ +K+    KDA ++  K P  ++T+ D  + L  +W  L K +  RNE+L+ S+ L+++L D + +  W   ++  + + +  KD  G   ++E+H+E K+EID R E  +    EG+ L         ++    +R+      L Q W   +   ++ ++  L+  +  Q E W++ +E  +   ++GD+ D+VE LI+ H  FE+++  Q EK   L   A+ LV  G+   AD+  + +++  R + L +  + R   LEDS  Y  F R   E+  WI  KL+ A DE++ + TNL+SK+QKH  F +E+  NE R+  V+ +G+ L+  NH  SE +K ++ EL   W++L + S +K + L +A       R VED+E WL +VE +L+SDD G+D+ S   L KK + L+ +I+   D +   +++A +   +    AD   K+  +V  RY  L EP+  R+  L DA    Q+ + A+++ +W+ ++  +A S   G  L    +L KKH  ++ E+   +  + +    G+ MI   H+A   I+K +D + +    LK     R+ LL ++++A +Y  + +EAE W+RE+ PL  S E G+D+   E+ L++   L  ++E +++ ID L+ +AD    +E
Sbjct: 2284 LRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESI-SIDEKMKRLQTHQALEAEVTANKPVVDQILQRG-NQLKNLHRNPKIA-NRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLARE 3218          

HSP 3 Score: 348.977 bits (894), Expect = 8.078e-96
Identity = 249/843 (29.54%), Postives = 428/843 (50.77%), Query Frame = 1
Query:  373 IENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQE-EKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLK--TASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL 2892
            +E +   S ++  R  ++   + +L  +   + RLL   +  ++F R  DE   W KE E  +  E      EHV   ++KF++   D++     +   I   A+ L+ E   +   +  ++  +    + L+ L K+R  +L     +  F    +    W+  K      E   R+   V++L+     L+RDL  LE+K+  L K A  +   HP+    I+ K   L +  + L +++ E+    + +     F S  RD++ W+   + V+  D    DVA  E L+++H E   +I  +    + C+  G  L+  N P    +  +L+ L  E   L  L+  R  + +Q +DLQLF R++E+ +A     EAFLE +++GDS++SVE L+++H D E  L AQE + +     A+ +++  H  +A + ++R D+L R+  +   A  RK  LE S  YQ   R+ADE+  W+ EK K   + D++   P+ +  ++ KH+ F AEI ANE RI  + + G  L+   H +S ++++ + +++  W DL      K   L QA+ Q+   R +ED    L E+++ L S D G DL SV +L +KH +LE ++  + +++     +  +   + H+DAD I     ++  RY  ++ P  +RK  L+++   HQ   D D E  WI EK+PIA S + GR L    N++KK + ++AE+  H  +I +V  +  ++I   H A   I+ K  +++  WS+LK     R+ ++D  ++ QQYL DA+E ESWM EK   + S ++G DED+   LL KH AL  D+  YR  ++ L
Sbjct:  999 LEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEP---SPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKF-----EQLDRNPNDVKSLQN----LERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERN-PRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKL 1828          

HSP 4 Score: 322.013 bits (824), Expect = 1.330e-87
Identity = 433/1887 (22.95%), Postives = 850/1887 (45.05%), Query Frame = 1
Query:  763 LKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTK-------DADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPL-SEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFL-------AEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAE-VESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFG----------KDEDSTEA------------------LLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYD-------YQEKNPREVSMRKG---DVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSD-IDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPG--HLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEA---VEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPN-EAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEK---LQNTLDESYKDPTTNIQAKH-QKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKV-KQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFM-WKTDVV--ESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERY 6204
            LK LA  R++ L +  ++ +F+R+ D+   W  E  + L  E     +A   A +RK + L+ D+     K N  T+         D +S  H  S+  I+ ++  + + W +L++   +R  +L+ +  +  F +       W+  +      D    DV  ++ L       + +I + ++   + K         +HP  +  I  K+  L      L++   E+ +L EQ    ++F         WI K    +  +     +   E L++KH +  + +  ++ + +    +  RL+E  +   + V ++  +L+   ++L +  + R + L+   + QLF+R+++ I A       T   E + E  NL   V+  +N L       A++ A E+R++       +++ + H  S  I++R  ++      +  A+  ++K L  +   Q+  R  +++  W+ E  +  ++ DD     +++ +   KH   EA+I +++ RI     + D  V ++H+++  ++K   +V+ ++  L++ +  + ++L  A       R  +D    + E +    S + G DL  V++L++KH  ++ E+  +  ++ ++ N G+KM    HY    I   +  +   ++ +K  A +RK  LD+S    Q + D      W+ EK+P+  S + G          K ++  EA                  L+K+H +  + I+A  S +++  ++          V D +G +    L+D         EK     S   G   D    L S H+   +     RQ      +++K++    + ++ N P       +Q  L  +++ L  L  DRR+ L+D+V  Y+ +RE+ DL Q + E   VA++E       HL+ +QS   K DEF  + K   E+    +  AN + R     A   V+K E + T      E +E   ++    L     + R+HR+ DE ++W+ +K A +   D+G+D+  V  L++ H+AL++++     R+  L  +A  L +T+P   AE I   Q+ + + W +L    +D K  L  + DL  F    RDL++W +   + + SD    D+  AE L   H  L+                       E+DAR   F    + G++++   HYA  EIK K   +  A E+L  EW  R   L Q ++   + R+ +Q    +  + ++L    +G  V D  V+S  K+ + F +A++  +++   L   A++L++  H +   I      V      L++++ A  + L D   L +F  D  ++E WI+EK   ++   D S +  + + + K  Q HQA EAE+ AN   +  IL  G +LK     + +   +  R ++L+ +W+ L     D+S  L+EA     +   ++++  W+ E E  +S+ D GKD      LL +     +D    E  + ++N   ++ ++ G    D +++ ++ +NE++  +  QLA  R   L  A ++H F R ++D +  I EK   + S+DYG+D   V  L +K   LE ++ A    + + +K   +++ E +    + +   L+ LE +W +L + + +R  KL  S +  K+LD V++ E W  + ++ ++S          + +L++H   + ++    ++   +  EGQ L  +   +   +++  + ++     LR+     K  L+     L++M W  + V  E W++DKETQV   + G    +V+ L+  H  F+  +   + E I+ +T   + L+   +     I  R + +  R   L  +S  ++ H+L+  ++Y
Sbjct: 1023 LKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPEHVA---AFRRKFDKLEADM-----KTNGGTQLKHINDIANDLISEGHGQSR-KIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWM--LSKFEQLDRNPNDVKSLQNLERDLKPLEDKIAALEKLAAAVKK--------DHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLER-NPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDA------ATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVD-WGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQ------WLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQS---KFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSK----LAVAEELHRFHRDVDEFEQWMADKMANM-PRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLS----------------------HEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVAD--VESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKN----LHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLA-AMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKIL-EKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQ---KLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRK-QSEKIDALTKNADALVSGGNNYRADIVTRSEEVTAR-HALLLKSMEKRGHMLEDSKKY 2833          

HSP 5 Score: 306.22 bits (783), Expect = 9.127e-83
Identity = 245/944 (25.95%), Postives = 457/944 (48.41%), Query Frame = 1
Query: 3583 VQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKT--VDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEG--IEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAE--------EDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAE 6378
            V  ++R+ ++  E I EK A + + D GKD  SV+ L RK  ALERD+ A+ +++   D  A ++++  P   E ++   +++ E W +L+  AE    KL  S  L K+L D + +  W N +   ++S +  KD  GA  +LE+H                       E  AEID RS   +   + G+ L +     + E++   + + +++ QL + W + K  L + LE  L+  +  Q E W++ +E+ +   ++ D T  V+ LIK H  F   +  Q +K+ AL + AD LV   +  +  I  + +EV AR   L ++M      L D +    FIR   E+ IWI  KLQ   DES+ D  TN+++K QKH AF++EL  N +RL ++   G++L      M ++  V+ ++ +L   WD L  KS  K+++L+EA         ++DIE WL +VE  LSS D+G+D  S + L+ K   L T+I    D + ++ ++A E    G+  +D   ++ + +  RY  + +  + R   L  A+    + +  +++  W+ ++ +L SS + G  L    +L+KKH  LE E+   +  +   E++G +++ +   A+   I++ L+ L +A + L++   +R+  L+E+ +  ++     E E W+ E+  L  S + G   A  +  L++    + ++++ +++ + +      L+   +H+A +I  +   L      L +   RR+  + D S + +F+ + D +  W+ +KE    ++DYG+DL   Q ++   E F++ +      G  +  +      L+ S H    +I  +  ++   W  +   +  RK  L   ++ ++        F ++A    +W ++ E        EDL+       L  +KA  + H  F + +KA E
Sbjct: 2515 VHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQH----------------------HERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLD-HTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQ--VKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFAST-HIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQII---EQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHR--------FDQEADQILNWLQDKEATGVAMEQEDLSRA----DLASVKAQLQRHDEFMHGMKAVE 3417          

HSP 6 Score: 223.402 bits (568), Expect = 1.213e-57
Identity = 224/943 (23.75%), Postives = 442/943 (46.87%), Query Frame = 1
Query:  154 RKKLEDAKKYQYFKRDADELESWILEKIQTY-SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHL---------LQEDFPEQESLINKK-KDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRV---LYEQNM----DLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKV---QKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTE----FGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD 2907
            R +L  A +   F RD ++ +  I EK+    SD+  KD  +++   +K  ALE +++A  + L A DK+   ++E      E +   L +L   WE+L    + ++  L  +    ++L  V ++  W  +    +TS +  +D           N   K LE   E+ AEI  +++ L         L ++ PE ++ + +  K V+++  +L+   +  +  L +  E   +  +  +   W+++K   +   + G    +V+ L + H A +  +    EK++ LTK+AD L +   + +  I  + E + +  + L K   +R   L+ S   H F+    +L+ W+T  K  +A DE   D   + + +++H    SE+   ++   + + +GE+L+T NH +SE +  +L       V L   W+E R    L  Q +    +L    R  E  E W+ K E  L ++D G  + S E LI+K +  +  +A + +    +   A  L   G  AA D  K+ + +  R S L+E  ++R+ +L D+  +  + + A+E   W+ +++  AS  + +   +LQS +   +KH     E+   +S ++D + RG++++   H  S  I++ ++ L      L  +  ++   L +A    ++     + E WL E      S + G+D     +  ++  +L+ ++   ++ ID   ++AD  +  +H DA  I  KQ ++   +  L     +R+ ++ DA K H+F R ADD  DW+ EKE  A + + G+DL   Q +I++ ++   E+     R+  V    + ++ + H     I  K  D++ +W+ +   A++RKQ L+ + +  ++  +A +  +W+++KE    + E       D  S +A L++HD  M  ++A    +  L  +A+
Sbjct: 2506 RTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKD----------SNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWIT-AKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQL-------VELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLAS--SGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAE 3428          

HSP 7 Score: 211.075 bits (536), Expect = 6.113e-54
Identity = 175/800 (21.88%), Postives = 375/800 (46.88%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA-----SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAG 2469
            DI  R E+V  R++   ++ E+R   LED+KKY  F R   EL  WI  K+Q   DE+F D TNL+SK QKH A + E+    + L+ +++ G  ++ ++H+ SE ++ +L +L + W++L      K++ L+   +     R+V++I  W  + E  ++S++ G+D+   E+L KK +    ++  + +   E+  KA  L  +     +  + + + VE     L    + R++ L +A    ++ +  ++ + W++++ +  +S + G  L S  +L++KH  L+++L   +  +N   +   ++  +   +   IQ   + L SA   LK+    R + L  +   H + ++  +   WL +   +  + E+ +D AG E+ + R      E++         K   + L+   H  +  I  K  +L+     L +    RR           F R  +    W+ ++E      D G  L+  + +I + E   + LAA  E+   +      L+ +GH   A +  K  D+    +++ E A  RK +L  +     FD++AD+I  W+ +K  T       D +  +  ++++++Q+H  F+  + A E ++ ++ +  + L +S  +    ++ R  ++++   D++ A+K   + L      Q + +   +M  W+  ++S + S+   +D+ S  +L ++H+    ++   +  +D F +Q  + +   H  +  I++K + +   +  L E    R     +   + ++ ++A+  + W+ E+  + G
Sbjct: 2801 DIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLG 3600          

HSP 8 Score: 208.764 bits (530), Expect = 3.118e-53
Identity = 219/963 (22.74%), Postives = 445/963 (46.21%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWI---LEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPL-TSEDFGRDLASV-QALKR--KHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLD-KERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDE-QHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSD 2940
            E I  R++ +   +   K AT++R+  L  A     F     +L +W    +  IQ  SD +  DL   +    +H  L  E+ A+      L  +G  MI   HYASE I+ +   L +  E+L + +  ++  L   + +  F R   +I+     K T + S   G  +  VE   K+ + F K L   +E+ A +   A+ L++    E +++   + +V + L+ L+   + R   L +A  +  F  D  +  +W++EK+  +  ++D   +  S+ + +KR   H+AL+ ++ A +  V+Q+ +  ++L N H + K  I ++ + L   W+ L     +++  L+ +  L RF     ++L+W+ + + +++  ++ KD+     L+ER +  +S+    +++       GE+L+       + +  + + L+ K R++L QL + R  L    M++  F RD E  +  I ++ A ++++D G    SVE L+RK    E+ ++A  +K    D  A +++E        V      L      L + A+LR   L  S     +  D  +++ W  + + K  S +  K+    +  +++H    AEI      +  +   GQ L         +++   + +    + L    + ++  L +      +       E WL++ E+Q+A  + G   ++V  L K H+  E  +    ++ID+  + AD  V    ++ AD I  +  EV+ R+  L + ++KR   L D+ K H+F R   +   WI  K  +A   +   D   +++ ++KH A  +E++ +E R+  V  +G++++  +H+    ++ ++ ++++ W +L+ K+  + Q L ++ E         + E W+ + E  + S + G+D  STE L+KK D L  +I      +  +  +A   ++Q +  +D
Sbjct: 2056 EQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQ--SDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNPK--IANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAA-MEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRAD-IVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF-LDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAAD 3011          

HSP 9 Score: 206.068 bits (523), Expect = 2.169e-52
Identity = 216/970 (22.27%), Postives = 438/970 (45.15%), Query Frame = 1
Query:   64 KILETPEDIQERREQVLNRYSAFKE-------ATEERRKKLEDAKKYQYFKRDADELESWILE-KIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDM-IENHHYASEI------IQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEA---WIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA-SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGST---NVGR-DLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQA 2904
            KILE    +   RE VL+     +E       A E R +KL  + K   +  D  ++E W  + + +  S +  KD    +   ++H   + EI  +SE L  L + G  +  E   + +E+      +Q    QL   WE       EK  L KL L+++ +     +   W  +KET V   E G   + VE+L K  + F + +  Q EK   +   AD L+      +  ++ + ++V      L    +KR   L ++ +  +F R   + I W+  K + L  ++   D  ++++  +KH A D +L+  E++++ + +  ++L   +    + ++ +   L S W  L+ KS  + ++L  ++ LH       D+  WL  ++  +++D+  +D+   E L+++ +  ++EI  R ++      +  EL       ++D + + E+++     L +    RR   E  +D Q F++  + AE    W++ +     + + GDSL S  +L +KH   EK L  ++      +     ++   H+A+  + K  D L      L+E   LR+  L+++ +   +  +  E + W+ E++  A S E  ++    +S +++      E+   ++ ID +K R   LL   H+ +  I  +  +L+ L+ DL      +   +  AS   +FVR  +D+  WL E E   +++D G+DL     + ++      ++++  +R+ +  +  +  +   H     I  K  +V   +  + E  ++RK  LN A ++H+F ++AD   +W+ +KE    +    ++ R DL  V+  +++H      +   E ++ E+C+E +++ N+       +E +  DM+    D+   A K  + L      Q Y  +  E   WM+  +  + S +  +D  S E+L+++HD    +++  +  +D    Q 
Sbjct: 2578 KILEKRPPL---RETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWES------EKGTLQKL-LEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAK-LQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRR---ENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQG 3533          

HSP 10 Score: 203.756 bits (517), Expect = 9.671e-52
Identity = 195/921 (21.17%), Postives = 438/921 (47.56%), Query Frame = 1
Query:   73 ETPE---DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTN-LQSKNQKHQALELEIAAQSENLNALDKNGYDMIEN-HHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQK--KFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQ---LASDDCGK-DLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQ----FVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVG 2787
            E PE   ++Q   ++V N     ++  E  +  L+   ++  +  +A + E W+ +K    +     D T+ ++   + H A E  +  QSE ++AL KN   ++   ++Y ++I+ TR +++ A    LL   +++  +L+ +  Y +F+R+  E++ W   K      E F   L+H  +  K  K   F  +L   E++ + +  + + L+ ++    E +  +  ++    + L+  +  + Q+L EA E+    R  +    W+++    L+S+D GRD+ S + L +K + L  ++    + V ++ K A EL  +   + D    + E + + +S L +    R E L  + +  +++    + L WL+D   + ++ E    +    +L ++H   + E+D+R  +    +  G+++I   H  S  I   L+RL    + L +    RR L ++ +D   +Y +  +AE W+ +Q     + ++G      E+ +R+    +K +   + +  RL   A+ L+   H+ A  +  K+  L     +L  +   R++ + D+  Y  F R AD++  W+ EK ++AS E+Y +   + Q  +++ ++ + E+AA   R+  V+   ++LL S H     I  +  ++ +LW  +   +  +++ L  A    +F +  + +  WL + E+    +  +D  + DL SV    ++H+     + + + ++     +A++    F D +H     ++ ++ ++  +   + E   K   KL     L  ++++  +   W+   +    S  + RD+   ++L+++H     E+ G +P + +   +G++MI + H   ++I++K+D ++  W+ L      R +L +++++ Q++  +A + +SW+ E+  L+G
Sbjct: 2688 EQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIV-TRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF---LDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHH----LEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLG 3600          

HSP 11 Score: 193.356 bits (490), Expect = 1.357e-48
Identity = 260/1342 (19.37%), Postives = 580/1342 (43.22%), Query Frame = 1
Query:   58 EIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWI------AKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWI--VEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVT---EVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSD-ELAKDVTGAEALLERHRDLAVEI 4044
            ++K L     I  R +++  +++    A  ++   LE+A+    FK+  + + +WI EK +   + +  KD+ + +   ++      +     + L+ +++ G  +++    + + +Q     L+  W  LL         L   ++   F R V++      EK   + S+++G+D   VE+L +K +   +D+    +K       A  +L++  P +E++++  K +E++ E+L   A+ R +KL  + ++ K+  D  K   W N+    +TS    +D    + +  +H     ++    E++  L ++   L+ + P+ K  +Q   + + ++   L++        L        +  +      WL+D +  +A  EL      VE L++ H+  +  +  + E   +     + L++  +    DIV + E +     +L++   +R  + E +     F R   +   WI      A  E+FL++ ++   L       +KH  F+  L   E++   ++    +LV + H+ +  V  +  +L      L  K+ L+   L ++       R  ++I+ W+  VE  + +SD++ ++  + +  ++K      EIA     + ++  + + L       ++D  ++ E+++  ++ L    +++ +NL  A    Q+V+  E+   WL++     +S + G  L S  +LQKKH  LE ++ + Q  ++   Q+    + ++HF +  I+K  + +S+  + L+E    R+  L +A   H++Y +  + E W+ E+ P+A S  +GRD  G ++ +++   +  E+   +  I  +      ++  +H+    I  K   ++ ++ DL  +  +R+  + D+ +  +++  A +   W+REKE    + ++G+D +  + +          IE + ST+  L                +   E V A+   QE           D+L                 R GH    Y   + A  +D+         VA+++K   N                  + Q ++  +EA+ +  W+ +KE   V    E ++   L +V+++ ++ DEF++  K  E+++ EL  +A +L  S   +    +E     ++++ + + E   + ++ L    ++Q Y +E  E  +W++   + + +  + +D+ S + L R+HD    ++      V     +   ++Q+    ++ I +  + + + W  L    +D       ++D+QK+  +   L SW+     L+  D  +   V  AE  L    D  V +
Sbjct: 2368 QLKNLHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKL-------QKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEG-ELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQI----------IEQFESTVREL----------------AAAGERVAAVQRAQE-----------DLL-----------------RSGH---PYGASITAKGADVQRLWTHVNEVANERKQALN-----------------GARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSF-PDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGDDWRMVDSVEMAETHLRDFDDFLVTL 3626          

HSP 12 Score: 179.874 bits (455), Expect = 1.686e-44
Identity = 205/950 (21.58%), Postives = 417/950 (43.89%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTY--SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDS-NHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDE----DSTEALLKKHDALMADIEAYRSTIDSLRTQADACK 2916
            I++RR  VL R  A + A  +R+K+LE + +YQ  +R+ADE+  W+ EK +     D++    + +  +  KH+A E EI A    +  ++  G  ++   HY S  ++  + Q++A W  L      K   L+   D     R +++      E +T + S++ G DL  V+ L +K     +++     K ++I ++   +  +   + + + +    +      +K  A++R+  L E+    +   D D  + W+ EK    +S+D GR L     + +K E L+ ++     +++++   A EL  +H  +   I+ K   L +AWS LKK    R   +D      ++L D  ++ SW+ + +  +A+++   D      L+ +H     ++ +  +  +  + +  EL+  N P  E    + + L +E   L +L  +RR   E  + L  + R++      I +      + +  +  + ++ L  K ++F++ +    E+    +  AN ++      A DV KK++ L    + L E  + R S L  +     F RD DE + W+ +K+     +  ++  ++ S  Q H+    EI  ++ R+  +    + L  +     +E I  R + L++ W +L +A+  ++  L  A     F   V D+  W     S + SD    DL     LQ +H+ L  ++ + +      +   ++ +  QH+ ++ IK K + + +   +L+     R   L+ A + H F R+A      I  K     S  VG  +  V++  K+    +  +   + R   + +   +++ A H   ++I     ++      L+   + R  +L D+     + +D ++ E+W+ EK   V   +    E    D     L+ H AL A++ A +  +D +  + +  K
Sbjct: 1421 IEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLK 2370          

HSP 13 Score: 173.711 bits (439), Expect = 1.492e-42
Identity = 207/954 (21.70%), Postives = 430/954 (45.07%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKK-YQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMI-ENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFP--EQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWI-AKQEAFLENNDVGD---SLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK-LKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHR-DIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADA 2910
            E  Q+R+++++  + A  +  E+RR  LEDA   Y+Y +  AD  +S I E ++    E F +D  +L+    K    + ++   SE   + +     ++  N  +A ++++ + + L   W  L    + +   L +  +  +F R VDE   W  +K   +   + G+D++HV  L +      K++   + + A++  +A+  L++ +P    E +  +++ +E   E LKN    R+  L  A ++  F       ++W +     + S+    DL   + L+ +H  L  ++ A E +  +L  D +++      + + I++K   L SA   L+ +   RN  L  +   H F  + + +++ +   +  + +  +   VA VE+  +R +  +  + + DE   +  +   EL+   H  S++I      + +E  +L Q    R  + +    L  F  D  Q EAWI  K     +  D+     S+D     ++ H+  E  + A +    ++    N+L +N H      N+  D+L  + + L      +  +LE++ +   F +  + + AWI EK +  ++ +  K+  + +  +++     ++   +E  +D++   G+ L+    +  + +++  + L++ W  L+         L  A     F R+VED +  + E  + + SDD GKD  SV  L +K + LE D+S+   ++ +  + A + ++++    + +     ++   + +L +  + R  KLN ++KL+++  D    E W ++      S    +D  G + ++++H   +AEI G    +  +  EGQ + N +   H+ ++++    ++N    L+   +  K  L   LE   +  +A + E W+ +KE  V   E G   D+ E L+K H A    +      ID+L   ADA
Sbjct: 1844 ERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQS-IEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQ-EALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANM-PRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAER-LKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQL-KNLHRNPKIANRC-DELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQAL-NQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADA 2790          

HSP 14 Score: 171.4 bits (433), Expect = 6.872e-42
Identity = 208/947 (21.96%), Postives = 416/947 (43.93%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNL-------QSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQD--LEHVEVLQK--KFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELS-NKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDE-QHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTID 2886
            ++E+ + +++  ++ ++    R   L+     Q F R+++ +++       T   E F +  NL       ++  ++H+ LE ++ AQ   L A  +   DMI+  H  S  I+ R   + A  E +     ++ + L+ +L+Y +  R  DE++ W  EK   V S   G D  L    +  +  K   F  ++   E +  +I S+ D L+ +   E  ++    + V      LK     +  +L +A + +   R  +   + ++E    L S+D G DL SV+ L +KH  L++++     K++ +     +++ + H D+ D I      LL  ++ +K  +  R   LD S   H+ + D    L W+ + K + ++ +  + +     ++++  + ++E++           +  ELI  +H  S  I  K   L+     L +L   RR + +  +  Q +  D  + E+W+ ++   L + D G+  D+   L+ KH    + +    +  ++L+     LVE+         K++D+L+     L + A+ R+++LED+     + R++ ++   I E L+ A  E + E   +L+    K   F  ++     R    +     +L  N   + D+ ++ E L   WN L    + ++  L  A    +F R+V++ E W+A+  + +   D G+D+  V +L + H  L+ +I + Q R+   +++A++        +A+ I  +Q  +   + +L+   D RK  L  A+ LH F     D   W         S     DL   + L  +H  +  E+   EP    + N+G+KMI A HYA  +I+ K   +K+    L+++   R   L  +++   +  +A +  + +  K   + S   G      E+  K+ D      E   ST+D
Sbjct: 1315 VEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDA------ATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMS---GDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDA-DRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPR-DLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTF----EKALSTLD 2246          

HSP 15 Score: 169.474 bits (428), Expect = 2.677e-41
Identity = 210/961 (21.85%), Postives = 442/961 (45.99%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSEN-LNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQK---FFRDTDKTISWVNEKSIPLTSEDF-GRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIA-KQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA--SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRI--LEV-CNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVS 2937
            + +R+ ++ N Y   K   + RR+ L D  K   F R+ DE E W  E   + +DE   +  ++ +  +K   LE ++       L  ++    D+I   H  S  I+ R  +++A+W+ L  + K++   L+ T     F    +    W   K      E+  ++   V+ LQ       +DL+  E+K A +  K    +++D PE+ + I +K     AL    +L ++ Q+K+  A + Q    F       I W+ EK+  +  ED    D+A  + L +KH  L   +   + +V    +    L  ++P     ++++ + L+S  + L+     R+  L     L  F  +   + +     +A +  D L   V  VE L++RH + ++++D+++   ++     +++I   H  S  I  +   +   R  + +   +R+   E +++ Q   R+ ++   W+  K +  +  +D   +  ++   + KHE FE  + A E + Q++++  + LV   HY + +V K    +  +  +L+++   +   L  + + +  DR  ++  A  +++++TA  S +   +  +++  +QKH     E+    +++ D++NRG+ +    H  ++ I   + +L + +  +   ++ ++ +L ++    Q V +V+    W+AE +   +S DCG+ L    N+ KK   LEA+++ H  +ID  L QA + +   H  +  IK K +E+   + +L++ L  R+  ++   K  Q+  DA + E W++EK     S + G D    + L+ KH+A+  ++  +   +  LEV C E   ++ ++       +K+ D++   +  L   A+ R+  L+D++   +Y+ ++++    + E   +  S EF +D +  + L  K D     ++       S  T A+A   +  P +
Sbjct: 1009 VADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPE--HVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSK-----FEQLDRNPNDVKSLQN----LERDLKPLEDKIAAL-EKLAAAVKKDHPEEAAAIERKIAELRALH--ADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWI-EKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNP-RMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHA-KLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVE---LVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFA 1949          

HSP 16 Score: 158.303 bits (399), Expect = 5.506e-38
Identity = 192/937 (20.49%), Postives = 412/937 (43.97%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYA-SEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSN-KHPDSKDTIQDKKEALLSAWSH-------LKKKSVE-RNEQLDVSYSLHRFLSDYRDLLSWLTD-MKAVIAADELAKDVAGVEALMERHNEHK---SEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDAL 2850
            D+ +++E +   ++   E  E R  KL  A++   F RD DE E W+ +K+     +  +D+ ++ S  Q H+AL+ EI      L  L +    + + +    +E I  R   L   WE+L N   ++  +L+   D   F  +V ++L WT    + + S+    DL+  E LQ + +    +++ +E + A + +  + ++       E + NK   ++ ALERL++    R   L +A +   F R+  + I+ +  K   L S   G  +A V++  ++ +  ++ L  L+E+   L   A+EL   +H +SK+         +S W         L ++ +E R+  L  +++L  F SD   + +W+ +    V  A +L+ +   ++  M+R   H+   +E+ +           G +L  ++   +  I N+ + L  +   L     ++ +  E+  DL  F +  E   AWI ++E  +   D+G  ++    L+ + +         E+    ++ +  +LV+ G  +   V K++  L  +   L  +    ++ L  +     F+RD ++    I EK+     ++Y K+  +++  V+K      +++A   ++       Q +L+      E + + +++L++ W  L  A++++ + L ++    +++ +V+ +E W  +V +++ S    KD N    + ++H+  +A+I    + +    ++      EQ      +++    V N   +L++  +  K  L    +   +  +A   E W+ +KE       +G     V+ LIK H A +  +     +I  +      +++  +    DI  + +++    + L    +KR  +L+DS +  +++    E   W+  K  L     F  D  +  + L+KH A 
Sbjct: 1951 DVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKN---------ISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHR--NPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESF-LDHTNLRSKLQKHMAF 2875          

HSP 17 Score: 131.339 bits (329), Expect = 9.875e-30
Identity = 107/400 (26.75%), Postives = 193/400 (48.25%), Query Frame = 1
Query: 4891 KSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMN--ESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIES 6084
            + EKL++  ++    A L+D   WL  V+  L   ++G+ ++ V+  L K Q + TDI A EDR K L    +E       +SD +R  ++ I +R+ ++  L E R   L     L    R ID     +   +  V + D G+ LIGV +L  KH  L+ +I+AH  ++  + +  +  +   E Q    D ++RKL+ +   +  L +L   R+  LE +    +F+   EEE AW+ EK+ L ++      ++AV      +   E +M+ H  +   +   G++L+  N  + + I++R   +  + + LR A     + L +     Q+    +  ESWI +K   VKSDD GRD  + ++LL +H   +  + +++ + I  +  + +QL  S
Sbjct:  517 RQEKLEQLAQRFHKKAKLRD--SWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQF---DVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLV-QNGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSD-ISRLEEMQSQLANS 909          

HSP 18 Score: 125.561 bits (314), Expect = 5.355e-28
Identity = 127/545 (23.30%), Postives = 239/545 (43.85%), Query Frame = 1
Query: 4984 LSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFR--IEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAEL-IRETKRQEENDVLRQEFAHMADKFHQWL 6609
            +S  D     +++   L KH+    +I A+E RI+ +N   D  +     +S  + +  + +N ++  +K+   N+ + L +A       R ++D  A + E +  ++S+D G DL  V++L +KH  LE E+  +   +  +E +G ++  +    + D I   +  L   +  ++  +  RK  L+ES  + + +  V+ E  WI EK+ + SS D G TL     ++KK +  E ++  H  + + +  +  +LI  ++  +  I+ +   L      L+K    R+  ++      Q+++    VESW+ +K   + S+DYG D  + + LL+KH      + ++R  +E +EV      +L+ESN    +  + R   L+  +D L + ++ R++ L       +    LY    + A    S  EN    +++       E +K L      FK  +K   E F         I               EAL   W  L   I+ RD++L + E   +   DV         D+F QW+
Sbjct: 1474 MSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHY-DADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCV---ELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNAL-------EDAVCLYEYMRESADLGQSIEENLRVAMSEEF-AEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDV---------DEFEQWM 1997          

HSP 19 Score: 102.449 bits (254), Expect = 4.431e-21
Identity = 174/843 (20.64%), Postives = 363/843 (43.06%), Query Frame = 1
Query: 3565 LEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIR---ESSLLGEDVDD-KTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAF--EAELAAN-AERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKK---ILVSSEDYGR-DLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQ-LAN--PDEIKRKLEHLETAWVELQ-QLSSIRKT------KLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESF 6030
            LED      + R+C E   WI  K  +L   +   D T+++   +KH A + +LV   +R+  ++ +  +LV  +   +E +     E+   W++L TK+     +L  + +L        D+  W++ +   +SSD+  +D+   E L+++   L  EIA R+                  DA     +      +EL   G  A ++  ++ + +      L+E    R++ L        +++  E+  +W++ R    SS  GE  D  ++  SL KKH    + ++ ++  M   ++    ++   H+    I+     + +   +LKE+    R  L +      +  +  E E W+ E++   + +         ++  ++      E EL  N  +RL+     G   +E    M    ++  +  KL   +  L  +   +  ++ +A++   +     D+  WL E E S S+ DYG+D      ++ + +    ++ A  +R+  +    ++ + SG     +I  +   +   +  V ++A  R   L  A+++H F +  D    W+++K+   + +  ED  R DL  V   K + QR +  +H     +++VEKQ  EL +E++ L N  PD       HLE   ++++ QL  I +       KL      Q +     E   W+   Q  ++S      +A+ + L+++HD +  +M+  +   +D   +G+++I  ++  ++ I+++ + L +   +L +    R    E+N    ++    + ++SW+ ++   +  DD+ R + SV+   T    FD  L + 
Sbjct: 2827 LEDSKKYHEFIRQCGELIIWITAK-LQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRS------------------DAVVEMMKK----ARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASS--GESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKK-RADGLLAREHHDAM----SIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASV---KAQLQRHDEFMHG----MKAVEKQVAELCHEAERLWNSFPD----TRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEER-AGLLGDDW-RMVDSVEMAETHLRDFDDFLVTL 3626          

HSP 20 Score: 94.7449 bits (234), Expect = 1.095e-18
Identity = 160/777 (20.59%), Postives = 314/777 (40.41%), Query Frame = 1
Query:  523 EILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFM---KDLEYQEEKAAE-----IYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHE--------IQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLK-TASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQAS-GQQQFVRNVEDMEIWLA----EVESQLASDDC----GKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPR-ILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREK 2772
            E+L W +     + S  F   L  +     KFN+F    K  +Y+E+   E     I +K   + ++ +   + L     D+E A  +L     +RQ  +    +         Q+F +      SW+    + L   + GR  + V+   +K +A+  D++A E++   LT   +EL  +     D ++  +  ++  W+ L     +R   L     L   L D   L + L  ++  +   ++ K + GVE L+ +H+   ++I++               I       + +  KL+ +  +   L++L   RR+  E+   L  F +D E+  AW+A++E           + +V      +++ E  +     +++ +     RLV+NG  +  D+ ++   +  R   L        + L ++ + Q + +DA+E ++WI EK+    SD+  ++    +S +Q+H     EI A +S I  ++     L +S  + +    + ++E +++    V  S   E N  + S G+   +      E W A      E  + ++ C    G+ +      QK    LE + +           ++    D QH           ++SN Y +L+   D R+  L+D  KL +FYR+ D+ E W  E E           +   +    K +A      G + + I ++ N+   +I+  H   R IE +   +  +W +L+    +R   L+ +     +      A  WM  K
Sbjct:  414 ELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLF--MHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQNGQ-SKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTA-TTSQSVQETEEVNVPQVEMSYNYEGNGMRVSKGEVLALLEKSTPEWWRALKRDGTEGYVPANYCKIVPGETVTVTQTTQKTTTTLEGNET-----------KSSVVADRQH-----------KISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPSPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIAND---LISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSK 1161          

HSP 21 Score: 80.1073 bits (196), Expect = 2.817e-14
Identity = 55/236 (23.31%), Postives = 111/236 (47.03%), Query Frame = 1
Query: 2086 QQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGST 2793
            Q+F +  +  + WL  V+  L   + G+  + V    KK   +  DI + +DR        ++   E++ ++D ++  + E+ +R+ +L   L++RK  L     L    RD D   + ++  EP   + +VG+ LIGV++L+ KH  + A+I  H   + ++       I         +++K+D++   ++ L      R+  L+ +    Q++ D  E  +W+ EKE L  + 
Sbjct:  526 QRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTA 761          

HSP 22 Score: 73.559 bits (179), Expect = 2.673e-12
Identity = 69/320 (21.56%), Postives = 147/320 (45.94%), Query Frame = 1
Query:  106 QVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADEL--ESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEA 1059
            ++++R++      E+R++ L          RD D L  E + LE      D   K L  ++    KH  L+ +I A    L+ L ++  + I +     +++Q +LD++ A +  L+ + + +   L+      QF++  +E + W  EKE   T+     D+  V      +     +++    ++  + +  + L+Q +   +E +  +   +    ERL+         L EA   Q++F+D ++  SW+ EK   + S+D GRD  + ++L ++H  L+ ++ A +  +++L +   +L+N    +  T Q  +E 
Sbjct:  606 EIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVG-KHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQ-NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSVQET 923          

HSP 23 Score: 69.707 bits (169), Expect = 3.814e-11
Identity = 91/423 (21.51%), Postives = 181/423 (42.79%), Query Frame = 1
Query: 3496 GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRE----SSLLGEDVDDKTVDSLIKKHEDFNRAINMQED--KMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAA 4746
             II +LQ++ E+LE++              QR+H++      W+      L   + G+  + V++  +K  A+  D++A  +R K+L +   EL     +E++ +   + EI + W +L T  E  K  L +  DL   L D   L + + ++   V + ++ K + G E LL +H DL            +D         A+I+A               ++      + ++ KL  +      L E   +R+  L++   L  +++D E+   W+  +E    ++L   D+      +L+ K    N  + MQ    + + +    ++LV++    +D I+ +  ++  RW  L+  + A  + L + +  Q + +DA+E E WI EK+     +         ++  Q+H   E E+ A
Sbjct:  510 AIIAELQRQ-EKLEQL-------------AQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKH-DL------------LD---------AQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYK----NVEMEMQTHWARSKGMIAGGERLVQNGQSKED-IQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRA 891          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: alpha-Spec (gene:FBgn0250789 transcript:FBtr0332879)

HSP 1 Score: 2786.52 bits (7222), Expect = 0.000e+0
Identity = 1403/2447 (57.34%), Postives = 1836/2447 (75.03%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIG-------------EEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYI-SESGQPIPDAYDYRAFTGHLFQN 7344
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q  S+E+++D TNLQ+K QKHQA E E++A S  + +LD  G +MI   H+ASE IQ RLD+LH LWE LL+   EK   L+  L  VQFLR+ +E++FW K+KETFVT++EFGQDLEHVEVLQ+KF+EF KD+  QE +  E+   AD L+Q+  PE++++  +K+++ +A +RLK LA  RQ+KLF AHEIQ+F RD D+T++W+ EK + L+S+D+GRDLASVQAL+RKHE ++RDL ALE+KV+ L  +A  L + H D  D I+DK+  + + W  L  K+ ER ++LD SY LHRFL+D+RDL+SW+  MKA+I+ADELAKDVAG EAL+ERH EHK EID+R++SFK     G++L+   H  + +I  KL  L+ ++  L+ LW +RR+LYEQ MDLQLFYRDTEQA+ W+AKQEAFL N D+GDSLDSVEALI+KHEDFEKSLAAQEEK + LD  A +L++  HYAA DV ++R  LL R++ L+EK+  R+  LEDS+ YQ F+RD DE K WI EKLK A+D++Y +PTNL  K+QKHQNF  E+ AN+SRI+D+ N G  L++  H  ++ I  R++E+  LW  LV AS  K   L +A  QQQF R +ED+E+WL+E+E QL S+D GKDL SV NLQKKH LLEAD+ +HQDRI+S    A++F++  HFDAD I+ K+  +S RY  L  P+ +RK  L D+ ++ Q +RD +DE  WI EKEPIA STN GRDLIGVQNLIKKHQA+ AEI  HE R+L V + G+ M+    +A  DI ++++ ++  W+ LK K+ +RKQ LDDSL+A QY ADA+EAESWMREKEP+   +++GKDEDS+EALLKKH+AL++D+EA+ +TI +L+ QA  C+ QE PV D  GKE V+ALYDY EK+PREVSM+KGDVLTLLNSN+KDWWKVE+NDRQG VPAAY+KK+DA +S    N  +  ++A +Q  + +QY+NLL+L R+R+++L ++V+AY LVREA DL QW+ +KE  A    +    LE V+  +KK D+F ++ K  E ++  + + A +L   GQTEA  KI+  +  L +K+  L+ +T  K   L   + VQR+HR+ DE K+WI EK   LN  D+GKDL SVQ L RKH+ +ERDL AL ++++ LD  A  L+Q+HP+ AE     Q+EINEMW+++ TK+   K KL +S DLQ+FL+DYRDL++WIN+M +LV+SDELA DVTGAEAL+ERH+    EI       GI   P               EEH  EIDAR+GTF  FE FG ELL+  HYA  EIKEK++ +A A+E L + W  R+ QL+Q L+LQLY+RDCE AE WM+ RE+ L  +D  +    V++LIKKHEDF++AIN  E K+ AL+  ADQL+   HY  + + +K ++VL RW  LKE +I  RSRLGD QTLQ F RDADE+E WI EKLQ   +ESYKDP  NIQ+KHQKHQAFEAELAANA+R+QS+L  G  L +K QC G E+AV++R+ ++ADQW+YL +K+ +KS KL+EAN+Q  Y A +KD++FWLGEVE  L++ D GKD ASV +L+ KHQ++  DI AHEDRIKD+N +AD  +ESG  D+  I+E+++ INERYE++  LA +R   L +A  LH F+R I DEE+WI+EKK+LV S+DYGRDL GV+NLKKKH+RLE E+ +HEP IQ+V++ G +LM+ S L  P EI+++L+ L  AW EL+ L++ R  KL+ES  YQ+FL  VEEEEAWI EKQ LLS  DYGD++AAVQGLLKKHDAFETD   H+D+C+ IC++G +L++  NH+ ++I QRC+ LR KLD L   A RRK  L DNSA+LQFMWK DVVESWI DKE  V+SD++GRDLS+VQTLLTK ETFD GL +F  EGI  IT+L +QLI ++HAQS AI  R+ +++ RW KL+  S  RKD LL +QE+++++EELYLTFAKKASAFNSWFENAEEDLTDPVRCNS+EEI+AL +AH+ F+ SL +AE DF  L+ LD++I+S+ VG NPYTWFTMEALEETW+NLQ+II+ERD EL +E KRQEEND LR+EFA  A+ FHQWL   R+++MEG G+LE+QLEA + K+ EV+ R++DLK+IEE GA+LEE LILDNR+TEHSTVGL+Q WDQLDQL+MRM HNLEQQIQARN SGVSE++L+EFSMMFKHFDKDKSG+L+H+EFKSCLRALG DL  VEEGQ DPEFE IL VVDPNRDG+V+LQE++AFMIS+ETENVQS +E+E AF A+T   +PY+TK+ELY NLTKD A++C++ M P+    SGQPI DA DY  FT  LFQN
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDELHKLWELLLSRLAEKGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRKEELNEAWQRLKQLAIVRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAEIANYWQSLTTKARERKQKLDESYYLHRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAALENDKSSLLSLWEDRRILYEQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETLVQASDKKGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGVQNLIKKHQAVLAEINNHEARLLNVISSGENMLKDQPFASDDIRQRLEALQEQWNTLKEKSSQRKQDLDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPVVDITGKECVVALYDYTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKKIDAGLSASQQNLVDNHSIAKRQNQINSQYDNLLALARERQNKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEINEMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERHQARRAEIG---FTLGISSAPGAAASTSSIASPSGDEEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERRLQLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQLATEESYKDP-ANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVP-EIEQRLKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENVQSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTRTLFQN 2447          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: alpha-Spec (gene:FBgn0250789 transcript:FBtr0072789)

HSP 1 Score: 2780.74 bits (7207), Expect = 0.000e+0
Identity = 1397/2434 (57.40%), Postives = 1830/2434 (75.18%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYI-SESGQPIPDAYDYRAFTGHLFQN 7344
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q  S+E+++D TNLQ+K QKHQA E E++A S  + +LD  G +MI   H+ASE IQ RLD+LH LWE LL+   EK   L+  L  VQFLR+ +E++FW K+KETFVT++EFGQDLEHVEVLQ+KF+EF KD+  QE +  E+   AD L+Q+  PE++++  +K+++ +A +RLK LA  RQ+KLF AHEIQ+F RD D+T++W+ EK + L+S+D+GRDLASVQAL+RKHE ++RDL ALE+KV+ L  +A  L + H D  D I+DK+  + + W  L  K+ ER ++LD SY LHRFL+D+RDL+SW+  MKA+I+ADELAKDVAG EAL+ERH EHK EID+R++SFK     G++L+   H  + +I  KL  L+ ++  L+ LW +RR+LYEQ MDLQLFYRDTEQA+ W+AKQEAFL N D+GDSLDSVEALI+KHEDFEKSLAAQEEK + LD  A +L++  HYAA DV ++R  LL R++ L+EK+  R+  LEDS+ YQ F+RD DE K WI EKLK A+D++Y +PTNL  K+QKHQNF  E+ AN+SRI+D+ N G  L++  H  ++ I  R++E+  LW  LV AS  K   L +A  QQQF R +ED+E+WL+E+E QL S+D GKDL SV NLQKKH LLEAD+ +HQDRI+S    A++F++  HFDAD I+ K+  +S RY  L  P+ +RK  L D+ ++ Q +RD +DE  WI EKEPIA STN GRDLIGVQNLIKKHQA+ AEI  HE R+L V + G+ M+    +A  DI ++++ ++  W+ LK K+ +RKQ LDDSL+A QY ADA+EAESWMREKEP+   +++GKDEDS+EALLKKH+AL++D+EA+ +TI +L+ QA  C+ QE PV D  GKE V+ALYDY EK+PREVSM+KGDVLTLLNSN+KDWWKVE+NDRQG VPAAY+KK+DA +S    N  +  ++A +Q  + +QY+NLL+L R+R+++L ++V+AY LVREA DL QW+ +KE  A    +    LE V+  +KK D+F ++ K  E ++  + + A +L   GQTEA  KI+  +  L +K+  L+ +T  K   L   + VQR+HR+ DE K+WI EK   LN  D+GKDL SVQ L RKH+ +ERDL AL ++++ LD  A  L+Q+HP+ AE     Q+EINEMW+++ TK+   K KL +S DLQ+FL+DYRDL++WIN+M +LV+SDELA DVTGAEAL+ERH                      +EH  EIDAR+GTF  FE FG ELL+  HYA  EIKEK++ +A A+E L + W  R+ QL+Q L+LQLY+RDCE AE WM+ RE+ L  +D  +    V++LIKKHEDF++AIN  E K+ AL+  ADQL+   HY  + + +K ++VL RW  LKE +I  RSRLGD QTLQ F RDADE+E WI EKLQ   +ESYKDP  NIQ+KHQKHQAFEAELAANA+R+QS+L  G  L +K QC G E+AV++R+ ++ADQW+YL +K+ +KS KL+EAN+Q  Y A +KD++FWLGEVE  L++ D GKD ASV +L+ KHQ++  DI AHEDRIKD+N +AD  +ESG  D+  I+E+++ INERYE++  LA +R   L +A  LH F+R I DEE+WI+EKK+LV S+DYGRDL GV+NLKKKH+RLE E+ +HEP IQ+V++ G +LM+ S L  P EI+++L+ L  AW EL+ L++ R  KL+ES  YQ+FL  VEEEEAWI EKQ LLS  DYGD++AAVQGLLKKHDAFETD   H+D+C+ IC++G +L++  NH+ ++I QRC+ LR KLD L   A RRK  L DNSA+LQFMWK DVVESWI DKE  V+SD++GRDLS+VQTLLTK ETFD GL +F  EGI  IT+L +QLI ++HAQS AI  R+ +++ RW KL+  S  RKD LL +QE+++++EELYLTFAKKASAFNSWFENAEEDLTDPVRCNS+EEI+AL +AH+ F+ SL +AE DF  L+ LD++I+S+ VG NPYTWFTMEALEETW+NLQ+II+ERD EL +E KRQEEND LR+EFA  A+ FHQWL   R+++MEG G+LE+QLEA + K+ EV+ R++DLK+IEE GA+LEE LILDNR+TEHSTVGL+Q WDQLDQL+MRM HNLEQQIQARN SGVSE++L+EFSMMFKHFDKDKSG+L+H+EFKSCLRALG DL  VEEGQ DPEFE IL VVDPNRDG+V+LQE++AFMIS+ETENVQS +E+E AF A+T   +PY+TK+ELY NLTKD A++C++ M P+    SGQPI DA DY  FT  LFQN
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDELHKLWELLLSRLAEKGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRKEELNEAWQRLKQLAIVRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAEIANYWQSLTTKARERKQKLDESYYLHRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAALENDKSSLLSLWEDRRILYEQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETLVQASDKKGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGVQNLIKKHQAVLAEINNHEARLLNVISSGENMLKDQPFASDDIRQRLEALQEQWNTLKEKSSQRKQDLDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPVVDITGKECVVALYDYTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKKIDAGLSASQQNLVDNHSIAKRQNQINSQYDNLLALARERQNKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEINEMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERH----------------------QEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERRLQLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQLATEESYKDP-ANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVP-EIEQRLKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENVQSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTRTLFQN 2415          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: alpha-Spec (gene:FBgn0250789 transcript:FBtr0332878)

HSP 1 Score: 2778.43 bits (7201), Expect = 0.000e+0
Identity = 1403/2457 (57.10%), Postives = 1836/2457 (74.73%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIG-------------EEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVR----------SALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYI-SESGQPIPDAYDYRAFTGHLFQN 7344
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q  S+E+++D TNLQ+K QKHQA E E++A S  + +LD  G +MI   H+ASE IQ RLD+LH LWE LL+   EK   L+  L  VQFLR+ +E++FW K+KETFVT++EFGQDLEHVEVLQ+KF+EF KD+  QE +  E+   AD L+Q+  PE++++  +K+++ +A +RLK LA  RQ+KLF AHEIQ+F RD D+T++W+ EK + L+S+D+GRDLASVQAL+RKHE ++RDL ALE+KV+ L  +A  L + H D  D I+DK+  + + W  L  K+ ER ++LD SY LHRFL+D+RDL+SW+  MKA+I+ADELAKDVAG EAL+ERH EHK EID+R++SFK     G++L+   H  + +I  KL  L+ ++  L+ LW +RR+LYEQ MDLQLFYRDTEQA+ W+AKQEAFL N D+GDSLDSVEALI+KHEDFEKSLAAQEEK + LD  A +L++  HYAA DV ++R  LL R++ L+EK+  R+  LEDS+ YQ F+RD DE K WI EKLK A+D++Y +PTNL  K+QKHQNF  E+ AN+SRI+D+ N G  L++  H  ++ I  R++E+  LW  LV AS  K   L +A  QQQF R +ED+E+WL+E+E QL S+D GKDL SV NLQKKH LLEAD+ +HQDRI+S    A++F++  HFDAD I+ K+  +S RY  L  P+ +RK  L D+ ++ Q +RD +DE  WI EKEPIA STN GRDLIGVQNLIKKHQA+ AEI  HE R+L V + G+ M+    +A  DI ++++ ++  W+ LK K+ +RKQ LDDSL+A QY ADA+EAESWMREKEP+   +++GKDEDS+EALLKKH+AL++D+EA+ +TI +L+ QA  C+ QE PV D  GKE V+ALYDY EK+PREVSM+KGDVLTLLNSN+KDWWKVE+NDRQG VPAAY+KK+DA +S    N  +  ++A +Q  + +QY+NLL+L R+R+++L ++V+AY LVREA DL QW+ +KE  A    +    LE V+  +KK D+F ++ K  E ++  + + A +L   GQTEA  KI+  +  L +K+  L+ +T  K   L   + VQR+HR+ DE K+WI EK   LN  D+GKDL SVQ L RKH+ +ERDL AL ++++ LD  A  L+Q+HP+ AE     Q+EINEMW+++ TK+   K KL +S DLQ+FL+DYRDL++WIN+M +LV+SDELA DVTGAEAL+ERH+    EI       GI   P               EEH  EIDAR+GTF  FE FG ELL+  HYA  EIKEK++ +A A+E L + W  R+ QL+Q L+LQLY+RDCE AE WM+ RE+ L  +D  +    V++LIKKHEDF++AIN  E K+ AL+  ADQL+   HY  + + +K ++VL RW  LKE +I  RSRLGD QTLQ F RDADE+E WI EKLQ   +ESYKDP  NIQ+KHQKHQAFEAELAANA+R+QS+L  G  L +K QC G E+AV++R+ ++ADQW+YL +K+ +KS KL+EAN+Q  Y A +KD++FWLGEVE  L++ D GKD ASV +L+ KHQ++  DI AHEDRIKD+N +AD  +ESG  D+  I+E+++ INERYE++  LA +R   L +A  LH F+R I DEE+WI+EKK+LV S+DYGRDL GV+NLKKKH+RLE E+ +HEP IQ+V++ G +LM+ S L  P EI+++L+ L  AW EL+ L++ R  KL+ES  YQ+FL  VEEEEAWI EKQ LLS  DYGD++AAVQGLLKKHDAFETD   H+D+C+ IC++G +L++  NH+ ++I QRC+ LR KLD L   A RRK  L DNSA+LQFMWK DVVESWI DKE  V+SD++GRDLS+VQTLLTK ETFD GL +F  EGI  IT+L +QLI ++HAQS AI  R+ +++ RW KL+  S  RKD LL +QE+++++EELYLTFAKKASAFNSWFENAEEDLTDPVRCNS+EEI+AL +AH+ F+ SL +AE DF  L+ LD++I+S+ VG NPYTWFTMEALEETW+NLQ+II+ERD EL +E KRQEEND LR+EFA  A+ FHQWL   R          +++MEG G+LE+QLEA + K+ EV+ R++DLK+IEE GA+LEE LILDNR+TEHSTVGL+Q WDQLDQL+MRM HNLEQQIQARN SGVSE++L+EFSMMFKHFDKDKSG+L+H+EFKSCLRALG DL  VEEGQ DPEFE IL VVDPNRDG+V+LQE++AFMIS+ETENVQS +E+E AF A+T   +PY+TK+ELY NLTKD A++C++ M P+    SGQPI DA DY  FT  LFQN
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDELHKLWELLLSRLAEKGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRKEELNEAWQRLKQLAIVRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAEIANYWQSLTTKARERKQKLDESYYLHRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAALENDKSSLLSLWEDRRILYEQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETLVQASDKKGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGVQNLIKKHQAVLAEINNHEARLLNVISSGENMLKDQPFASDDIRQRLEALQEQWNTLKEKSSQRKQDLDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPVVDITGKECVVALYDYTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKKIDAGLSASQQNLVDNHSIAKRQNQINSQYDNLLALARERQNKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEINEMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERHQARRAEIG---FTLGISSAPGAAASTSSIASPSGDEEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERRLQLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQLATEESYKDP-ANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVP-EIEQRLKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRYYMLGYNRQGTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENVQSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTRTLFQN 2457          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: alpha-Spec (gene:FBgn0250789 transcript:FBtr0332880)

HSP 1 Score: 2773.04 bits (7187), Expect = 0.000e+0
Identity = 1397/2444 (57.16%), Postives = 1830/2444 (74.88%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVR----------SALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYI-SESGQPIPDAYDYRAFTGHLFQN 7344
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q  S+E+++D TNLQ+K QKHQA E E++A S  + +LD  G +MI   H+ASE IQ RLD+LH LWE LL+   EK   L+  L  VQFLR+ +E++FW K+KETFVT++EFGQDLEHVEVLQ+KF+EF KD+  QE +  E+   AD L+Q+  PE++++  +K+++ +A +RLK LA  RQ+KLF AHEIQ+F RD D+T++W+ EK + L+S+D+GRDLASVQAL+RKHE ++RDL ALE+KV+ L  +A  L + H D  D I+DK+  + + W  L  K+ ER ++LD SY LHRFL+D+RDL+SW+  MKA+I+ADELAKDVAG EAL+ERH EHK EID+R++SFK     G++L+   H  + +I  KL  L+ ++  L+ LW +RR+LYEQ MDLQLFYRDTEQA+ W+AKQEAFL N D+GDSLDSVEALI+KHEDFEKSLAAQEEK + LD  A +L++  HYAA DV ++R  LL R++ L+EK+  R+  LEDS+ YQ F+RD DE K WI EKLK A+D++Y +PTNL  K+QKHQNF  E+ AN+SRI+D+ N G  L++  H  ++ I  R++E+  LW  LV AS  K   L +A  QQQF R +ED+E+WL+E+E QL S+D GKDL SV NLQKKH LLEAD+ +HQDRI+S    A++F++  HFDAD I+ K+  +S RY  L  P+ +RK  L D+ ++ Q +RD +DE  WI EKEPIA STN GRDLIGVQNLIKKHQA+ AEI  HE R+L V + G+ M+    +A  DI ++++ ++  W+ LK K+ +RKQ LDDSL+A QY ADA+EAESWMREKEP+   +++GKDEDS+EALLKKH+AL++D+EA+ +TI +L+ QA  C+ QE PV D  GKE V+ALYDY EK+PREVSM+KGDVLTLLNSN+KDWWKVE+NDRQG VPAAY+KK+DA +S    N  +  ++A +Q  + +QY+NLL+L R+R+++L ++V+AY LVREA DL QW+ +KE  A    +    LE V+  +KK D+F ++ K  E ++  + + A +L   GQTEA  KI+  +  L +K+  L+ +T  K   L   + VQR+HR+ DE K+WI EK   LN  D+GKDL SVQ L RKH+ +ERDL AL ++++ LD  A  L+Q+HP+ AE     Q+EINEMW+++ TK+   K KL +S DLQ+FL+DYRDL++WIN+M +LV+SDELA DVTGAEAL+ERH                      +EH  EIDAR+GTF  FE FG ELL+  HYA  EIKEK++ +A A+E L + W  R+ QL+Q L+LQLY+RDCE AE WM+ RE+ L  +D  +    V++LIKKHEDF++AIN  E K+ AL+  ADQL+   HY  + + +K ++VL RW  LKE +I  RSRLGD QTLQ F RDADE+E WI EKLQ   +ESYKDP  NIQ+KHQKHQAFEAELAANA+R+QS+L  G  L +K QC G E+AV++R+ ++ADQW+YL +K+ +KS KL+EAN+Q  Y A +KD++FWLGEVE  L++ D GKD ASV +L+ KHQ++  DI AHEDRIKD+N +AD  +ESG  D+  I+E+++ INERYE++  LA +R   L +A  LH F+R I DEE+WI+EKK+LV S+DYGRDL GV+NLKKKH+RLE E+ +HEP IQ+V++ G +LM+ S L  P EI+++L+ L  AW EL+ L++ R  KL+ES  YQ+FL  VEEEEAWI EKQ LLS  DYGD++AAVQGLLKKHDAFETD   H+D+C+ IC++G +L++  NH+ ++I QRC+ LR KLD L   A RRK  L DNSA+LQFMWK DVVESWI DKE  V+SD++GRDLS+VQTLLTK ETFD GL +F  EGI  IT+L +QLI ++HAQS AI  R+ +++ RW KL+  S  RKD LL +QE+++++EELYLTFAKKASAFNSWFENAEEDLTDPVRCNS+EEI+AL +AH+ F+ SL +AE DF  L+ LD++I+S+ VG NPYTWFTMEALEETW+NLQ+II+ERD EL +E KRQEEND LR+EFA  A+ FHQWL   R          +++MEG G+LE+QLEA + K+ EV+ R++DLK+IEE GA+LEE LILDNR+TEHSTVGL+Q WDQLDQL+MRM HNLEQQIQARN SGVSE++L+EFSMMFKHFDKDKSG+L+H+EFKSCLRALG DL  VEEGQ DPEFE IL VVDPNRDG+V+LQE++AFMIS+ETENVQS +E+E AF A+T   +PY+TK+ELY NLTKD A++C++ M P+    SGQPI DA DY  FT  LFQN
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDELHKLWELLLSRLAEKGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRKEELNEAWQRLKQLAIVRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAEIANYWQSLTTKARERKQKLDESYYLHRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAALENDKSSLLSLWEDRRILYEQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETLVQASDKKGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGVQNLIKKHQAVLAEINNHEARLLNVISSGENMLKDQPFASDDIRQRLEALQEQWNTLKEKSSQRKQDLDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPVVDITGKECVVALYDYTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKKIDAGLSASQQNLVDNHSIAKRQNQINSQYDNLLALARERQNKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEINEMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERH----------------------QEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERRLQLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQLATEESYKDP-ANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVP-EIEQRLKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRYYMLGYNRQGTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENVQSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTRTLFQN 2425          
BLAST of Spectrin alpha chain vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0073072)

HSP 1 Score: 521.546 bits (1342), Expect = 1.734e-148
Identity = 336/945 (35.56%), Postives = 533/945 (56.40%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDE--NFKDLTNLQSKN---QKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLL-QEDFP-EQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPD-SKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNK-LERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL 2892
            +IQ   + VL R    K+    RR KLEDA  Y  F RD  E + WI EK +    +  ++ ++TNL  K    QKHQA + E+AA    +  +   G  ++   H +S  I+  ++ +   W+ LL   +++ R L+   D ++F  ++D+I  W ++KE  V + + G+DLEH   L +K ++   D+   +++   I   AD L+ Q   P + +S+  ++KD      +L+      +  L  A+EI  F RD D T   + EKS+ ++S D GRDLA+V+AL R+ EAL+RD+ A+++K++Q    A+ L  K+P+     I+ K E L  +W +L+  SV+R   L+ +Y  H+F+SD ++L  W+ DM   +   +    +   E  +E H E K EI+ R E+F   K +GE+L         D V K L  L++    L + W+ER     +   LQLF    EQ E W+A +EAFL N+D+GDS  +VE L++KH++FEK L A    T  L   AN ++E     A  + +K   +L RK  L E ++ RK  L  SH  Q F R   EI  W+V+KL+ A DENY+EP+NLQSK+QKH  F AE+ +N  R+  V + G+ L+  +H   ++I ++++ L+  W  L  AS+ K+  L QA     F R+V++   W+ EVE QL+S+D GKDL +V+NL KKH  LEAD++ H +  D   Q+ +QF   +HF    I ++      RY  L EPL  R+  L D+  L QF RDA+DE  W+ EK+ +AGS ++G  L+ VQ L KKH +++AE+   EP I  +   GQ+MI  +H+A   ++ K + ++     L++ A  R+  L D++E+Q +  +A+EA++WMREK P++ S+++G+DE S +   KK + L  ++ A++ +I+ +
Sbjct: 2212 NIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDT--LQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKV 3154          

HSP 2 Score: 514.227 bits (1323), Expect = 2.818e-146
Identity = 412/1580 (26.08%), Postives = 781/1580 (49.43%), Query Frame = 1
Query: 1735 LRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD------AC-------------------------------------KMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEI-NDRQGHVPAAYVKKVDA-MMSDIDPNA------------------------------PEQI---------------TVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELL--KTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLE--SFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKL-----QRESK 6165
            LR+  LE   NY+ F++ +   + ++ E ++  SD  Y    +  + ++KH+   A+I A   R +D+    + L   N++  E ++ R +E+   W  L+   + +  NL Q S     +R +      + E++ Q AS+D G  L  V  L + H+L E  ++++ + +  F +QA  +   +H DA  + ++  ++   Y +L      R+ +L +A   H F  D D+EE W+ +K+ I  +    +DL  V +L +KH+A++ EI   +P+  ++   G+++I   H    +I+ +ID +   W  L+   + R++ L+D+ EA Q+  DA+EAESW+ EK  LV S ++G DE S +ALL++H  L  ++ AY   I +L  QAD       C                                     K++   V+++     V +L+ ++ +    + M KG+V+ L +  + DWW V   N  +G VPA YV++V+   ++ I P A                              P+ +               +V  +Q+ +   Y+ L  + + R   L+DS+  +   RE +D  +W+ EKE      +I     E V + K+K ++F+ +     ++++E+    +  +R G ++ ++KI     Q+ + +++L     ++ K LE   +V+ ++R CDEAK W+ EK  +L+T+ +  DL +VQ L R+H  LER+L  + ++V  +      +   +P E + +   Q+E+ +MW ++  +  D + ++ + +  Q F    + L++WI+++   +++DE A+DV  A  LL++H DL        GD              +I A    F      GK+L   K        + E+L++  DA   ++  W  ++K L QC++LQ++ R+ ++ +      E+ L    LG  +D+  V++++K+H DF +++  Q+  ++   + AD+L+ ++HYD   I D+  +VL +  ++K+     +  L   +    F  +AD++++W+ +K +   DE+Y+D  +N+  K QKHQAFE EL AN  +L+++   GQ L + G  + +   VE RV  L  +W  L+  S+DK  KL++A  Q  +N  L+D +  + E++ +L S D G D  S   L++K Q+L ++I   + ++ +L    D+    G  ++  I    K + +R++ ++   + R   L ++   H F   +D E  WI E      S + G++L   ++L KKH++LE EI  H+P+I      G  L+++ Q    ++++   + LE AW +L++    R  KL+ S + Q++L    E E+W+ E+ ++L ST+YG    +   LL KH   E ++  +     ++ +    ++  N+ ++K +  + + + + L  L K A +R+  L ++    ++  ++D VE WI ++E    S+DYG+D   +Q L  K +     +E  + R++  E+   L  +LI+S    ++ ++ R + L   W+ L     QRE K
Sbjct:  389 LRQEKLEQL-NYK-FEKKSVLREGYLKEMIQVLSDPRYLRQVD--ATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQG---MKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKE-----RMIKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQ-LDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDL--------GD--------------DIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDA---IHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDE--VEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRD-LSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE---VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQ-QHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCEL---LAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQK 1920          

HSP 3 Score: 442.195 bits (1136), Expect = 4.263e-124
Identity = 461/1905 (24.20%), Postives = 892/1905 (46.82%), Query Frame = 1
Query:  715 ESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQ-LWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSS-----LEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKV-------QKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEE-LDKLWNDLVSASKVKEKNLGQASGQ-QQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAP---VSDSYGKETVMALYDYQE---KNPREVSMRKGDVLTLLNSNHKDWWKVEIND--------RQGHVPAAYVKKVDAMMSDID------------------PNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPG--HLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLD---ESYKDPTTNIQ---AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDT--IRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDV-------LRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELY 6225
            +S+  +++ +    + L+ +A+KR   L ++  +  F+R+ D    W+ EK   + S++       V   KRK E    DL A  ++V ++    D    +     D I  ++  +   W  L     +R + L+ + S+  F     +   W+++    +    +  D+  V+AL  RH   + E+   ++        G   +   +P  +D VN  ++  ++    +Q   ++ R   E  +  Q+F    +   AWI   +  L  ++    +++   L++KH D    + A + +   +  +  +L +     A  V       +I +   E+ A  R  +     L    + Q+F+R+AD+I A       T S E + E  NL + +       ++H +F   + A +  +    +    L+ ++H  S+ I +R  + L K     V     + K L QAS    +F    +D+++WL + ++++A D+  +DL+++    +KH   E ++ +++ ++ +  +     V   +   + ++ +  +++ R+  L    + +  KL  A    +  R  +D +  + E +    S +VG DL   ++LI K Q +++EI   + ++ E+ + G  M +  H+  ++IE    +++  + DL++   +R+  L++SL   +++ +      W+ E  P   S E G++    ++L KKH  L A+I+ ++  I+       +   Q+ P     +S  ++   A  D +    +  R++ M       L ++   + W  E N+        R     A  + K   +  ++D                   N P+   +A++Q+ +E   ++L  L   R+ RL +S+  ++   E++++ QW+ E+E  A +E       HL+ +Q+   K D+  +  +   +++ + +  A KL  S    A E +E    QL+  +E L ++  ++ + L     + R+HR+  EA   I++K+A L + ++G+DL S   L RKH+  E DLVAL  ++++L   +  L   +P+ A  I Q Q+++   WN L  ++     +L  S DLQ FL D RD++SW + + A + ++E   D  GA AL  +H  +                      + EI+AR   F+   +    +++TGHYA  +++EK  ++ D +++L+  W  +K  L+Q ++L  +LRD +Q ++  + ++++L     G+ V+D  V + I+KH++F R I  QE+K+  L+E   +L+E  HYD   I+   Q VLAR   +K+     R +L D      F+RD  E + WINEK Q  L+    SY +  TN+     K QKHQAF+AE+AAN  R+Q I  +G  L  K      E  ++  +  + + W  L+ + + +   L+EA     +N+ L  IE W+ + E  + + D G+D    ++L+ K   + +D+   + R+K +N+ AD+ I      +DT  + +R+K  N  + +++         LG A ++H F R +DD    I EK + +SS D GRDL  V  L ++ + LE ++ A +  I   E     L+ +        I+RKLE L  +W  LQ LS  R++ L E+    KF+  V+E E W+ +    +++T    T+   +  L+ H   + +++  ++    +  +G++L      + +  +Q+ + +R+ L V       L +A   R   L +      F  + + VE W+A+KE  + +DD G   ++V+ LL KH+ F+  L +   + ++ +    N ++E     +D I+ +   ++ R  KL   S+ RK  L +  +  + +  LY
Sbjct:  947 DSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNS-VKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETV------AVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDA------TTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGK--RKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQD-KTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE-VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQN---KFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE-VEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAAL-SQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAI----------------------YGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVED--VQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEK-QKKLEADAASYAE-VTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPE--IKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQL------SKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHA---DHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLY 2788          

HSP 4 Score: 439.113 bits (1128), Expect = 4.356e-123
Identity = 258/830 (31.08%), Postives = 471/830 (56.75%), Query Frame = 1
Query:  403 IQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL 2892
            ++ R  +++  +++L  M +++  LL+ ++    F R  D+   W KEKE  + S+E     E V+  ++KF +F+ DL    ++  EI    D   ++   + + +I +++ +    +RL N   +R++ L  A  ++ F R  D+   W++EK + L +     DL +VQAL+R+H+ L+R+L  +E+KVN++T   + + N +P  KD +  +++ +   W  ++++  +   +++       F +  + LL+W+  +K  + ADE A+DV     L+++HN+   +I + D  F      G++L +   P   + V  +ERL  E+  + + W E++    Q +DLQ+F R+ ++ +A     EAFLE N++G SLD VEA++++H DFEKSL AQ++  +   + A++L+ N HY +  +  +R+ +L ++  ++++A  RK  L+ S ++  F  +AD++K W+ +K + A DENY++ +NL  K+QKHQ F  E+ ANE ++ +V   GQ L+ +  N+  +++ R+ +L+K W DL++ S+ K + L QA+ Q++  R++ED +  + E++S L S D G DL S  +L  K  +LE++I+    ++   +   D      HF+A  I+    E+  R+  L++P  +R+ KL ++   H+F  + D E  WI+E  P A S  +G++L   Q+L KKH+ ++AEI GH+P I +    GQ +I+  H     +E     ++  W DL+    +R + LD SL+AQQYL DA E ESW+ E+  ++ STE+G+D DS   LL KH  +  +++ Y   +  +
Sbjct:  949 VEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQL-SDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAG-NRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEM 1772          

HSP 5 Score: 356.681 bits (914), Expect = 5.054e-98
Identity = 265/935 (28.34%), Postives = 487/935 (52.09%), Query Frame = 1
Query: 3583 VQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNE-AEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQE--RYKKV--EELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSL 6366
            +  ++R+ D+  + I EK   ++++D G+DL +V+ L R+ +ALERD+ A+ +++   ++ A  L++ +P   A+ I +  EE+++ W  L   +   +  L  +    KF++D ++L  W+N M   +++ +    +   E  LE H++  VEI  R   F                  +G  Q  E   K   +      + +++ L  + +  + LNE W  R + L +  +LQL+    EQ E W+  +E+ L  +D+ D    V+ L+KKH++F + ++   D +  L++FA+ ++E E  D D I++K   +L R   L E     + RL     LQ F+R   E++ W+ +KLQ  LDE+Y++P+ N+Q+K QKH AF+AEL +N+ R+QS++  G+RL  +G    ++  + ++V  L   W  L   S+ K +KLQ+A     +N  + +   W+ EVE  LSS DYGKD A+V +LL KH+ L  D+  H +    L ++ ++F ++       I ER  +   RY  + +    R   L  +  L  F R  +DE  W+ EK+++  S+D G  L+ V+ L+KKH  LE E+ + EP+IQ++ ++G +++ ++  A+ ++++ K E L+   V+L+ L++IR+ +L ++ E Q F     E +AW+ EK+ +LSS+DYG    +VQG  KK +  + ++   +     +      LI+ N+ ++  I ++   + ++ + L + A  R+  L +     +++ +T+ +  W+ D+     S+DYG D+  V+ L+   E+F + L +     +E      ++LI+ N+    +IK +       W++L+     R+D L   ++   Y +V  E + L   K AS  +   E+  +D         LE I+AL   H  F++ L
Sbjct: 2462 IHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAF------------------AGLKQQGEQLSK---RPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHA--DHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPS-NLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLI-RGDHFAKDE-IAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFAS-EQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEAR-VEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLIS---EDYGQD---------LESIQALGRKHQVFESEL 3356          

HSP 6 Score: 300.442 bits (768), Expect = 7.010e-81
Identity = 172/496 (34.68%), Postives = 288/496 (58.06%), Query Frame = 1
Query:  151 RRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIA 1635
            RR +L DA + Q F  +A+E ++W+ EK    S  ++ +D  ++Q   +K + L+ E+ A   ++  + K    +IE +H+ S  I  +  Q+   +E LL + KE+   L       ++LR  +E+  W  ++     SE++G+D+EHVE L   F  F+ +L   E +      + D L+QE+ P + S+ +K+ + +   E LK+L   RQ  L  A ++  + R  D+TI  +NEK   L SED+G+DL S+QAL RKH+  + +L+ ++ +V+ +  +A +L   +PD+K+ I+ K++  + AW+ LK+K+  R  +L  +  L  +  +YRDL++W+ +M A I A ELA  VAG E L+    +H +EI +RDE+F      G++LI   H L+ ++ +K++ L     +L    N+RR +YE N+D QLF +D E  E WI+ +E  L++  +GDS+  VE L+R+HEDFEK++AAQEEK Q +  I 
Sbjct: 3087 RRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRIT 3582          

HSP 7 Score: 270.781 bits (691), Expect = 6.393e-72
Identity = 224/911 (24.59%), Postives = 458/911 (50.27%), Query Frame = 1
Query:  121 YSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKD-LTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDA-DGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHD 2844
            +    EA  ER + L +A + Q FK   +++E W+  K    ++++  D  T ++   +KH   E E    +++++ L K    ++E     +++I+ +L  +    +KLL + +E+ + L  +    +FLR + EI  W  +K      E + ++  +++   +K   F  +L     +   +  + + L++ D   ++ +  + + +E    +LK  ++ ++ KL +A++   F R  D+  +W++E  + L+SED+G+DLA+V  L +KHE L+ D+    E  +QL +  ++        +  I ++    +  ++ L +    R E L+ S SL +FL D  D L WL + + V  + +L   +  V+ L ++HN  ++E+ S++   ++    G+++I  NH  SE +  K E L K+ V L  L   RR+     ++ QLFY +  +A+AW+ ++   L ++D G    SV+   +K E  ++ L A +   +++  +A  L+E  H+ ++++ +K   +     +L   AK R+S L +      + R+ +E+  W+ +++   + E+Y E   +++  +   ++F++ + ANE+R++    RG  L+  N+     IK + +E  +LW +L      ++  L  A     + R  ++    + E ++ L S+D G+DL S+  L +KH + E+++   Q ++DS L +A + + E + DA + I+ K++E    +  L+E    RK KL+ A +L  ++ +  D   WI+E      +  +   + G + L+   +    EI   +    +    GQ++I   H+   ++E KI  ++     LK+  +KR+++ + +L+ Q +L DA   E W+  +EP +  T+ G      E LL++H+
Sbjct: 2656 HQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHD--EFEKLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAK-LGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHE 3562          

HSP 8 Score: 257.299 bits (656), Expect = 7.213e-68
Identity = 219/941 (23.27%), Postives = 459/941 (48.78%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQ-LTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLV--GSTEFGKDEDSTEAL--LKKHDALMADIEAYRSTIDSLR 2895
            I +RR QVL +  A K+   ER++ L+ +K +  F  +AD+L+ W+ +K +   DEN++DL+NL  K QKHQA E E+ A    L  + K+G  +++  +   E+ ++R+  L+  W+ LL + ++K R L+      +  R +++      E ++ + S + G DL   + L  K      ++   ++K AE+ S  D +        +++    K+++   + L++  ++R+ KL E+    KF  + D    W+NE      S + G++L   Q+L +KH+ L+ ++   +  +N+ L      +S +HP+ ++ ++   + L  AW  L++   ER+ +LD+S    ++L D  ++ SWL +   V+ + E  +D      L+ +H   + E+D+         +    ++  NHP S+ +  K + ++K    L +L ++R+    +++    ++ ++++ E WI +QE    + D G   + ++ L  K +D +  +    ++  + + +A +L+++    A +V K+++ L     NL +    R+  L  +     F RD  E    I +K    S E  ++  +  + ++KH+ F  ++ A E+++  +      L     + +  I ++ +++   WNDL   S  +   L  +S  Q F+ +V D+  W + + + L +++   D    T L+ +H+ +  +I + +D+     + +D  V   H+ A  +++K   + +   KL    +K+KI L     L  F RDA   ++    ++    S++ G+ +  VQN I+KH   +  I   E ++  +   G+K+I   HY   +I+  +  +      +K+    R+  L+D+L   +++ D +EA+ W+ EK+  +   +  + +  +  E +  L+KH A  A++ A +  I  ++
Sbjct: 1368 IGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEV-ESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPE-REQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQ 2306          

HSP 9 Score: 245.743 bits (626), Expect = 2.792e-64
Identity = 241/1003 (24.03%), Postives = 475/1003 (47.36%), Query Frame = 1
Query:   25 IFKMADITLPKEIKILETPEDIQ---ERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENH-HYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKK---DVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEA-PVSDSYGK----ETVMALYDYQEKN 2991
            I ++AD    K I   + P D Q   +RR+     +   + A    R  L  A +   F RD D+    I EK +   S +  +DL  +++  ++ +ALE +++A  + ++  +     +I+ +    ++ I+ +L++LH  W  L  +  ++  +L       +F+  V E+  W  +    + + +    +   E   +   E   ++E ++E  A +  + + L +   P+Q+   N +K    +E+  + L     +R + L EAH++Q F    ++   W+  K   L ++D G    +V+ L +KH+  ++ L A  + V+ L K A+ +    P   D I++K   +L     L + S ER ++L  S+ L  FL    ++  WL   K  +A DE  ++ + +++ +++H    +E+ S     +S  +EGE LI  +H   ++I  +++ L+ + + L      ++   +Q  D   F R  ++   W+ + E  L + D G  L +V  L++KHE  E  +A   E   +L     +  +  H+   +++++    + R + L E   +R+ +LEDS + Q F RDA++   W+ EK   A  ++      ++Q   +KH +  AE+ + E  I  +  RGQ ++  NH  SE ++ + E L K    L   + ++   L  A   Q F     + + W+ E    L+S D G+D  SV   QKK  +L+ ++++ +  I+   + A   ++  HFD+  I +K  +V   Y  L     +R+ +L +  KL ++ R+ ++  +W+ ++  +  S + G D+  V+ LI   ++  + +  +E R+      G ++I  ++     I+ K D+ K +W +LK+    R+  L  + +   Y   A E    + EK+  + S ++G+D +S +AL +KH    +++   +  +DS+   A+A K+ E  P +  + +    ETV A  D +EK 
Sbjct: 2411 INQLAD----KLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKR--PQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHA--DHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLV-QKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVL--AEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKT 3402          

HSP 10 Score: 237.654 bits (605), Expect = 7.713e-62
Identity = 235/982 (23.93%), Postives = 461/982 (46.95%), Query Frame = 1
Query:   73 ETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEI--IQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQ--ESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNE-------KSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKD----TIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNE-----HKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVN-KLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAK--QEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDS 2943
            E+  +I+   E VL  +       E+R + LE+A+    F    D++E+WI +K +   + +  +DL +  +  +K   ++ ++    + +  +++    +I      ++   +  R    +  W +L         LL    +   F R VD+      EK   ++S + G+DL  VE L ++     +D+   ++K  +  + A+ L+++ +PE+  + +  K +++  +   L+ L+ KRQ  L EA+   KF  D  +   WVN+          P T  D    L   Q  K + E        L+++  QL+K   +   + PD+       +++  + L  AWS       ER   L  ++ L  F +    +  WL + +A +  D+L      VE L+++H+E     H   +D+  + F +   EGE       P   D++  KL  + + +  L++L  ER+    Q+  LQ F R   + + W+ +  Q A  EN     +L S    I+KH  F+  L +   + Q + +   RL+   H+A  ++ ++   L      L+  ++ +K  L+ +++   F+R  DE   W+ E +L+ +S++  K+   + + ++KH+   A++A +    D +K + +    + H    +I ER     + +N L     ++ +NL  +   QQF+R+ ED   WLAE +    S D G  L SV  LQKKHN LEA+++S +  I + LQ+  Q + + HF ++ ++ K   +  + V+L++    R+++L DA +   FY +A++ + W+ EK P+  S++ GRD + VQ   KK + +Q E+   +P I +V      +I  +H+   +I +K   +   + DL   A +R+  L +  +  +YL +  E   W+ ++  +  S ++G+D +  E L+   ++ ++++ A  + +++   + D    +  P   S
Sbjct: 2318 ESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKK-YPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQ---QQPDNVRKYLLVLEELHQTLNEAWS-------ERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTL-QKFANSILEGE-------PKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSK---IQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSS 3277          

HSP 11 Score: 215.312 bits (547), Expect = 4.747e-55
Identity = 208/910 (22.86%), Postives = 418/910 (45.93%), Query Frame = 1
Query: 3484 EKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFD--TGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQER 6201
            EK+  I+ + QK  E  EE   R    L   + +Q + R   E   W+ +K  ++   +  ++ +++Q   +KH A + +L++   RV+ +  +   L++      + I Q  + +   W KL   ++  K KL  + D   F     +  +W++ +   +SS++  KD+     LL++H  L  ++A                HH E+          +   ++  +  H+  +EI E+          L+E    R++ L+  L LQ +LRD E    W+  ++     +D+     +V  L KKH      +  QE  +QAL +   Q++   H+  + ++ K + +  +   L++     R RL D    Q F  +A+E + W+ EK        Y     ++Q   +K +  + EL A    ++ +      L E+       + + E+  ++  +++ L+  +K++  +L E  +   Y    +++  W+G+     +S DYG+D   V+ L+   +   ++++A+E R++   ER D  I+       +I+ ++    + +E++K L   R   L  AK++H + R  D+    I EK   + SEDYG+DL  ++ L +KHQ  E+E+   +  + SV  +  +L  E      + I+ K +    AW +L++ ++ RK KL ++ + Q + D   +  AWI E    +++ +  +++A  + LL      +T+++  ++        GQ+LI + +  A  +E + + L+ + ++L+    +R+   E N     F+   +++E WI+ +E Q+K    G  +  V+ LL +HE F+     +  + + I+ IT L  QL             R+Q   ++  KLQ + +  K+ L +L++R
Sbjct: 2751 EKLAYILRRKQKLLELSEERKQR----LTQSHQLQEFLRSLYEIDRWLVQK-LQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVA----------------HHGEL------ADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHF--DSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKL-GEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLE-QLF------------RHQLEQEKISKLQEKERLEKERLEQLKQR 3617          

HSP 12 Score: 202.601 bits (514), Expect = 3.233e-51
Identity = 210/975 (21.54%), Postives = 456/975 (46.77%), Query Frame = 1
Query:   67 ILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLIN-KKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTI-SWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTI------QDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAA------ADVNKKRDDLLIRKSNLEEKA-KLRKSSLEDSHNYQLFD--RDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSD 2940
            I E  + +++R++++   Y   +E  ++R   LED+     F R+ D+ E W+ EK +    +  + + N + K +K      +++A S+ +  +D          H   + I  R  Q+H +W++L N   ++ + L+       F R  DE   W  EK   + +     DL  V+ LQ++     ++L   E+K   +    + + +  +P ++  +N ++++V+D  ++++      + ++ E+   Q+ F ++ K + +W++     L +++  RD+ +   L +KH  L  D+ A + +  ++ +   +LS+  P+  +T+      + +++A+   W+       E+ + L     L  F  +   + +     +A +  + L   +  VEA+++RH + +  + ++D+  K   +  ++LI+ +H  S+ I ++  ++  +R  +     ER+ L + + D   F  + +  + W+  +     + +  D L ++   ++KH+ FE+ L A E + + +      LV+ G+         AD+NK+  DLL      E+K  KL +++ +  HN  L D  +  DE+ +     L++    N  +  + +  + K Q   +EI   + ++ ++ + G ++    H  +++I+   +EL + + DL   ++ +   L ++    +FV  ++    W+ E      S++ G++L+   +L KKH  LEA+I  HQ  I+  L      + +QH + + ++    ++   +  L+    +R  KL+ + K  Q+  DA + E W+ E+  +  ST  GRD      L+ KH+ I+ E+  +   + E+ +    M+ A+H   + +  K   ++ +   L   A +R+  L +SL   +Y  ++ E E W+RE+E    S ++G+D +  + L  K D L   +E     +D     A      E+P ++
Sbjct:  942 INENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEGEGVDNAKRKFEK---FITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSV-KNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRI-ESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWA-------EKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRD-LSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEVESRVADLNKRWKDLLTLS---EDKGRKLEQAASQREHNRSLEDAKKKVDELDS----ALRSGDVGN--DLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYAN 1894          

HSP 13 Score: 188.734 bits (478), Expect = 4.301e-47
Identity = 180/722 (24.93%), Postives = 334/722 (46.26%), Query Frame = 1
Query:  130 FKEATEERRKKLEDAKKYQYFKRDADELESWILE-KIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMD-------LQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKL-KTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDK----LWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSF 2256
             K A++ ++ KL+ A     F R  DE  +W+ E ++Q  S++  KDL  + +  +KH+ LE ++A   E  + L +      +  H+    I  R       +  L      +   L+ +L   QFLR  ++ L W  EK+    S++ G  L  V+ LQKK N    +L  QE     +  +   +++++    E L  K + ++  L +L++LA  R+ +L +A E Q F+ + ++  +W+ EK   L+S D+GRD  SVQ  ++K E L R+L A +  + ++ K A  L  ++      I +K   +   +  L + + ER  +L     L  +L +  +L  W+ D  AV A+++  +DV  VE L+       S +++ +   ++C   G+ LI  N+P    I +K +          QLW E + L     D       + ++ R  ++    I +++A L + D G  L+S++AL RKH+ FE  L   + +   +   A +L E    A   +  KRD+ +   ++L+EK   RK+ L  +   Q +  +  ++ AWI E L K  + E        +  +   ++   EI   +         GQ L+   H  + +++++I+ L      L + L    ++ E NL      Q F+++ E +E W++  E QL     G  +  V +L ++H   E  +++ +++  + 
Sbjct: 2868 LKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETK-------QLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNL----DTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAI 3578          

HSP 14 Score: 167.933 bits (424), Expect = 9.089e-41
Identity = 200/857 (23.34%), Postives = 385/857 (44.92%), Query Frame = 1
Query: 3673 LTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPN------EAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIR----ESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINE-KLQNTLDESYKD-PTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQR---ESKRRKDHLLKLQE 6198
            + S+Q++  K   L R +V + +R+K +      LVQ   +       A+ + + Q+ IN+ +++L   A+     L +SI L  F  +  D   W+     ++ SDE                   V+ A R  +  I       +   EID    TF+          + GH   ++I  + + I    ++LN     R+K L+    ++L+ R C++A+ WM+ +    +++++  D+  +TV +L ++H++  R +   EDK+  +    + +      ++D +  + QEV   W  +++     R+R+      Q F   A  +  WI+  K Q   DES +D  T N   K  KH     ++ A+      ++  G++L +    M +  AV ER+   A+Q D +     +K + L +     ++N     I+      E  L   + G     V+++L +H      + A +  +K  ++ AD+ I +   DS  I +R+  +  + + VK  A  R   L  +K  H F    DD + W+++K  +   E+Y RDL  +    +KHQ  E E+ A+E  +++V K G  L+         E++ ++  L   W +L  LS  +  KLE+++  ++   ++E+ +  + E    L S D G+ L + + L+ K    E+++ + + K  ++ + G  +    + NA+ IE   + L+++   LR    RR+  LE++  + +F+++ D    WI +     KS++ G++L   Q+L  KH+  +  ++  +   I         LI   H + + ++   Q L   W  L+R   E  R+ D  LK Q+
Sbjct:  901 VKSLQKV--KKTILVRQVVPV-KRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDE----------------GEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFR----------RQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDL--RTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLK--KHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLK--AEQ-DAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENY-RDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRV--PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQ-PMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQ 1717          

HSP 15 Score: 160.229 bits (404), Expect = 1.907e-38
Identity = 213/979 (21.76%), Postives = 442/979 (45.15%), Query Frame = 1
Query:   49 LPKEIKILETP--EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADEL-SNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEAL------MERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLE-RLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAA--ADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK-LKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNK-SEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVD-EQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADH------YAHRDIEKKIDDMKNIWSDL------KNK----ADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL 2892
            L K++   E+P   ++++R+EQ+   +    +   +R +KL  A +   F RD  E    I +K    S E  +DL +  +  +KH+  E ++ A    L  L ++   +   +   +  I  + D++ A W  L      +   L  + D   FL  V +I+ W+      + +EE   D      L+ + +    ++E +E+K   +   +D ++Q        +  K   + D  ++L     K++  L +  ++  F RD  +  +  + +   L+S DFG+ +  VQ   RKH+  +R +   EEKV+ L +   +L   +H DS + IQ   + +L+    +K     R  +L+ +    +F+ D  +   W+ + +  + AD  A   A V  L      +++H   ++E+ +     +  ++ G  L++  H  S +I   +E  L+  + +L +L    R L E    L+ F    ++ EAWI  +E  ++ +D G  L+   AL+RK +D +  +   +++ + ++ +A++L+      A    V+K+R D       L+      ++ L  ++   +F+RD D+    I EK L  +S +  ++   +++ +++ +    +++A + +ID  +   + L+     + ++ I+ ++EEL K W +L + S  ++  L +A    +FV +V+++E+W+ ++  ++ +      +N      + H   + +I   Q+      QQ +Q     Q    D ++K    +   +  L E   +R   L +A++L  F    +  E W+  KE    + ++G     V+ L+KKH                  +E +K+++ADH      +A+  +E +  D   I   L      K K    +++RKQ L  S + Q++L    E + W+ +K   V   E  ++  + ++ ++KH A  A++ +    + S+
Sbjct: 1881 LAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSAN-IQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEAD--AASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLE-FNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKH------------------DEFEKLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQ-VALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSV 2836          

HSP 16 Score: 101.293 bits (251), Expect = 1.270e-20
Identity = 138/622 (22.19%), Postives = 278/622 (44.69%), Query Frame = 1
Query: 3250 SVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVE--IANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEF---WLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDL 5094
            S+   Q +R+A D  QW+ EK+LVA ++ +    L +VQ  +KK +    E   +E  I+ L  +  ++ R     A E+++     LQK+  QL ++   +   L D    Q ++ E +EA  W+ EK   L++SD G+D  SVQ   +K + L+R+L A    ++ +   A  L++ +  ++  I +   ++ + +  L   A++ + +L     L ++L +  +L  W+    A+ +S++  +DV   E L+     LA E  ++N                   ++A     +   + G  L++  +   + IK K        E+L +    R+  L    ++ +Y R  ++    +  +++SL+ ED   D +++ +L +KH+ F   +   + ++ ++   A +L E     ++ I+ K  E +  W  LKE   A +++L   + LQ++  +  ++  WINE L         +     +      +  + E+    E       +GQ+L ++   +  E  VE+++  L  + + L+  + +K  ++ E N        LKD E    W+   E  L     G     V+ LL +H+     + A E++ + +
Sbjct: 2988 SLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLL-SVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHF-ASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLI-----LAFESFVSN-------------------LNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHE--VEDKIKVLQARHE-LLKHTLNKRREIYELNLDT--QLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAI 3578          

HSP 17 Score: 96.2857 bits (238), Expect = 4.917e-19
Identity = 111/449 (24.72%), Postives = 204/449 (45.43%), Query Frame = 1
Query: 5080 RIKDLNERADEFIESGTC------DSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVE-------KQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKL---IDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIES--NHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKA 6372
            RIK ++      ++  T       ++D++ +R++ IN+ Y++++++A+ R   L  +  L  FYR  DD E W++EK+ ++ S D G    GV N K+K ++   ++ A    ++ ++       +QGH     SQL   D+I  +   +   W  L    + R+  LE +S  + F  T +E + W+ EK   L +      L  VQ L ++H   E ++   EDK N +   G  +         N  A +Q  + + +++   R + LR +  +E       F     V+ +WI   + Q+ +D+  RD+ +   LL KH      + +   E +EVI  L  QL +   N A++ A+  R   L    D + R    ++  LL+  +           F ++A   ++  ++ E  L       SL+E++A+ + H  F+ SL A
Sbjct:  921 RIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKS-DEGE---GVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGH-----SQL---DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQ-RGSDLRNR--IESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVI-QLGKQLSDGKPNMAETVAVIER---LKAEQDAIHRGWAEKQKWLLQCVD--------LQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMA 1342          

HSP 18 Score: 94.3597 bits (233), Expect = 1.881e-18
Identity = 90/359 (25.07%), Postives = 166/359 (46.24%), Query Frame = 1
Query:  586 LEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDT--IQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENG 1656
            L  V+   KK      D+  + E+  ++ + A+ L +E++  +E +  ++++V     +L  L + ++  L +   +    R+   T   V E      SED G  L  V+ L + H   +  +    E + +  + A  L  K  + KD   +  +   L  A+S L ++S  R  +L+ + + H F+ DY +  SWL D + +      AKD+  V +L ++H   + EI SR          G+ LI   HP S +I ++++ L +    L  L   RR   E   +   FY D  +AE+W+ ++ A + + D G+   S +AL+++H D +  L A       L+  A++L++ G
Sbjct:  425 LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQA--LPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAG 781          

HSP 19 Score: 90.8929 bits (224), Expect = 1.795e-17
Identity = 80/362 (22.10%), Postives = 179/362 (49.45%), Query Frame = 1
Query:  898 RDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVS--YSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYK--EPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSN 1971
            R L  V A  +KHEA+  D++A  E+ N LT  A+EL  ++   K+ ++ +++ +++ W  L +  +  N++L++S   +L   L +       + +++   A++++   + GVE L++ H+  + ++++  E+ K    +     +  H  +  +  +L  L++    L++    RR   E+  +   F  D +  E+W+  ++   +       L +V +L +KH+  E  + +++ K+ ++     RL+   H  ++++  + D L      LE   +LR+  LED+     F  DA+E ++W+ EK+   +  +Y   EP+  Q+ +Q+H++   E+ A    I ++  +   L+ + 
Sbjct:  423 RYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLE--LLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPS-AQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAG 781          

HSP 20 Score: 85.8853 bits (211), Expect = 6.391e-16
Identity = 82/359 (22.84%), Postives = 173/359 (48.19%), Query Frame = 1
Query: 1540 LDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLL---DSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINA 2604
            L  V+A ++KHE     + A+ E+   L  +A  L    ++    V ++  +++ +   L E  + ++ +L    N     R+       + E + + AS++       ++  +Q H   L E+  N +  + +K   +  L    S H  +  + +R+ +L++ +++L+  S  +   L +A     F+ + ++ E WL + +    +    KDL +V +LQ+KH  LE +I S + +         + + EQH  +  I+ + + ++  +  L+  ++ R+ +L DA + +QFY DA++ E W++EK  +  S + G D    Q L+++H+ +Q E+  +   IL +  +  K+I A
Sbjct:  425 LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHS--LQELQVN-TYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKA 780          

HSP 21 Score: 71.2478 bits (173), Expect = 1.588e-11
Identity = 68/310 (21.94%), Postives = 138/310 (44.52%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKD-LTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADEL 1008
            E ++ R ++V+ ++    E  E +R  L          R+       + E  Q ++ E+    L  ++   Q H   EL++    E L   ++       + H  + ++  RL  L   + +LL     +   L+   ++  F+   D    W  +K+    +    +DL  V  LQ+K      +++ ++ K+ ++ +    L+ E  P    + ++   + +  + L+ L + R+++L +A E  +F+ D ++  SW+NEK   + S D+G D  S QAL ++H  L  +L A    +  L + AD+L
Sbjct:  468 ERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKL 777          

HSP 22 Score: 67.3958 bits (163), Expect = 2.841e-10
Identity = 49/178 (27.53%), Postives = 84/178 (47.19%), Query Frame = 1
Query:  166 EDAKKYQYFKRDADELESWILEKIQTY-SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQ 696
            E+A+ + +F  D D  ESW+++K +   +    KDL  + S  QKH+ALE EI ++      +   G  +I   H  S  IQ+R+D L   W+ L  + + + R L+   +  QF    +E   W  EK   V S ++G D    + L ++  +   +L         +  +AD L++
Sbjct:  602 EEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIK 779          

HSP 23 Score: 67.0106 bits (162), Expect = 3.359e-10
Identity = 109/523 (20.84%), Postives = 214/523 (40.92%), Query Frame = 1
Query: 3622 WIEEKDARLNTSDVGKDLTSVQR---LFRKHDALERDLVALGERVKL------LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQ--------KFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTC 5133
            WI +K   L   D+   L  +QR    F+++  +E+      ER ++      +++    L Q   N  +G  Q   +I + W  L       ++ L + +  Q        KF         ++  M  ++S     + V   +A L++H  ++                      A+I AR   F +     +EL +  ++ +  ++ + Q +     QL E   N++  L Q   L   LR+     + +   +     EDV      V+ L++ H      +N   + ++     A      EH D   +  +  ++   +  L     A R+RL + +    F+ D D  E W+ +K +             + +  QKH+A E E+ +   +   +  +G+RL   G+   + + ++ R++ LA+ W  L    + +  +L++A     +     + E WL E    ++S DYG D  S  +LL +H+ L  +++A+   I +LN++AD+ I++G C
Sbjct:  291 WIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKP-PKYKERSEIEALYFTINTLLKALNQPPYNPQDG--QLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRYLRQV---DATLKKHEAIS----------------------ADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRL--IGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGIC 783          

HSP 24 Score: 53.1434 bits (126), Expect = 5.480e-6
Identity = 68/291 (23.37%), Postives = 123/291 (42.27%), Query Frame = 1
Query: 5767 NHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLE--SFRIEGIE-VITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSAL 6630
            N NA ++E+R + + +  D L++ A +R   LED+     F  + D  E W+ +KE  +KSD+       V     K E F T L   S R+E I+  + +   Q     H+Q D I  R + +   W +L     +R+  L    E    VE     F +       W       L   V    L  ++AL   H + +  L   E+    ++ L   +++      P     + A ++  +++ + +Q+R ++L    + + E++V +Q F + A     W+  V+  L
Sbjct:  943 NENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQ----GHSQLDKIIARQRQIHQIWQRLNNAKAQREKSL----EGASSVE----LFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKN----AYPAEKDNVNARQQEVQDMWQQVQQRGSDL----RNRIESEVGQQVFNNSAKVLLAWIDSVKDQL 1209          
BLAST of Spectrin alpha chain vs. Ensembl Zebrafish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-051113-60])

HSP 1 Score: 2664.41 bits (6905), Expect = 0.000e+0
Identity = 1374/2500 (54.96%), Postives = 1786/2500 (71.44%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG------------QTEAVEKIEG--------------------------IITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDEN+KD +NLQ K QKHQA E E+ A +E +  LD+ G  MI   H+ASE I+TRL++LH LW+ LL   KEK   L      VQ+LR  ++ L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E ++ K+++V  A +RLK LA++RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL AL +KVN L  +AD L   HP +   I  K++ L++ W  ++  + ER+ +L+ SY L RF +D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+   H  SE++  KL  L +E+V L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A+ R+++LEDS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D  H  S ++  R++E+   W  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL SV NLQKKH LLEAD+++HQDRID    QA QF D  HFDAD I+KKQ  +  RY  L+EP+  RK KL+D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ MI+  H+A  D++ K+ ++ N W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGS ++GKDEDS EALLKKH+ALM+D+ AY S+I +L+ +A AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++  +Q  +ENQ                    Y  LL LG  R+D L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E +++++   A++L+  G            Q E +    G                           I +L  ++  L+++   +   L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP   + I +   E+N  W+ L  +A+  K KL NS DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTF  FE FG++LL  GHYA  EIK+KL+++   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  +D  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++ +G  L ++G C G E+AV+ R+N L +QW +LVNKS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  +N R+ K+K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQSV + G +L +++ +   +EI+++L      W EL+ L++ R  +LEES EYQ+F+  VEEEEAWI EK +L+ S DYGDTLAAVQGLLKKH+AFETD  VH D+ ND+C+ G +L+   NHN + I  + + LR K+  L +AA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+  LM RW++L   S  RK  LL+ Q+ ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI+AL +AH  F++SL +AE DF  L++LD++I+SY V  NPYTWFTMEALEETW NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQWLQ  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+KSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE+IL +VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E+KPY+TK+ELY NLTK+QA++C+  M PY+   G+ IP A+D+  FT  LF N
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSVVRRQKLEDSYRFQFFRRDADELEKWIQEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANAEAIIKLDETGNLMISEGHFASETIRTRLEELHRLWDLLLQKTKEKGIRLLQAQKLVQYLRECEDALDWISDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQAAGKLTQENHPEAELILKKQEEVNSAWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALNDKVNTLGGEADRLQQTHPQNATQIHLKRDELITNWEQIQTLATERHARLNDSYMLQRFTADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSTDEAGQALLNTGHYASEEVKEKLGILSEEKVSLLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKDDVATRRDALLSRRNALHERAQFRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELVDGKHYASSEVSTRMDEVSSQWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDFGKDLTSVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDADNIRKKQEALVARYEALKEPMAARKQKLSDSLRLQQLFRDVEDEETWIREKEPIASSTNRGKDLIGVQNLLKKHQALQAEISGHEPRIKAVTQKGEAMIDEGHFAGEDVKAKLQELHNRWDGLKGKAAQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSPDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALKEEAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPTQSSSRENLLDEQGSIGLRQDQIENQTAATKEVCSVSMRMKQVEELYGTLLELGEKRKDMLEKSCKKFMLFREANELQQWINEKE-SALTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVASELESEGLMAEEAPVVQAQQVEVLGSAPGKDEADSKGASPWKSVRLAVQTTANFNTIKELNNRWRSLQQLAEDRSNMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVDDIQEKCTELNTAWSSLVGRADQRKEKLGNSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFLAFEQFGQQLLARGHYASPEIKQKLEALDRERADLEKAWVQRRMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQSFADQLISADHYAKPEIFKRRSEVLDRWLRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTATDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIDTGNALIQRGACAGSEDAVKARLNALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMASNAFDTSQVKDKRDAVNGRFGKIKSMAAGRRAKLNESHRLHQFFRDLDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLETGKKLSDDNTIGQ-EEIQQRLAQFVEHWRELKDLAAARGQRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVNDVCSNGDELVKKENHNVENIMAKMKALRGKVLELERAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSKAIEARHATLMKRWNQLLSNSAARKKKLLEAQDHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALRDAHDAFRSSLSSAEADFSQLAELDRQIKSYNVVSNPYTWFTMEALEETWSNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDIVDPNRDGNVSLQEYMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTKEQADYCISHMKPYLDSKGREIPSAFDFVEFTRSLFVN 2480          
BLAST of Spectrin alpha chain vs. Ensembl Zebrafish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-051113-60])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 294/475 (61.89%), Postives = 367/475 (77.26%), Query Frame = 1
Query: 6001 ETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGI---------------------------GTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+  LM RW++L   S  RK  LL+ Q+ ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI+AL +AH  F++SL +AE DF  L++LD++I+SY V  NPYTWFTMEALEETW NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQWLQ  R+ L++GI                           GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+KSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE+IL +VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E+KPY+TK+ELY NLTK+QA++C+  M PY+   G+ IP A+D+  FT  LF N
Sbjct:    1 ETFDAGLQAFQQEGITNITALKDQLLAAKHVQSKAIEARHATLMKRWNQLLSNSAARKKKLLEAQDHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALRDAHDAFRSSLSSAEADFSQLAELDRQIKSYNVVSNPYTWFTMEALEETWSNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLQETRTYLLDGIAYRRVIRVYQYEVDDDLSGRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDIVDPNRDGNVSLQEYMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTKEQADYCISHMKPYLDSKGREIPSAFDFVEFTRSLFVN 475          
BLAST of Spectrin alpha chain vs. Ensembl Zebrafish
Match: sptbn5 (spectrin, beta, non-erythrocytic 5 [Source:ZFIN;Acc:ZDB-GENE-131121-26])

HSP 1 Score: 486.878 bits (1252), Expect = 1.016e-137
Identity = 313/956 (32.74%), Postives = 527/956 (55.13%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKN---QKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMK----DLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNL---AKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDS-LRTQADACKMQ 2922
            +QERRE++       K+ + +RR+ LE +K +  F RD  E E WI +++    D++  D++NLQ+K    QKHQ  E EI A    + ++ + G +++  HH  S+ I+  +  L + W+ L      + ++L+   D+++FL++V+++  W ++KE  +   + G+D EH + L KK +EF      D+   +     I + A  L +++  E   L+  KK  +   ER +N        ++KL  A E+    R+ ++      EK + L  +  G D+ SV+ L R+HE ++R+   ++E+   L K+  +   +H D  D +  K+E +  A   L K+   R E+L  S+ L  F ++ R LL W       +    L K+    E+ +  H++ K+EID+R +   S K+ G+ L+   H  + +I   L +LD  + +L + W +RR   +Q + LQ+F    +Q E+W++ +EAFL N D+G SL  VEAL RK   FE SL AQ E+   +D  A +L++  HY + ++ K+   +L+RK  + E +K R+ +LE+S   Q F   + EI +W+ EK   A DE++K+P NLQ+K+ KHQ+F AEI AN +R+      G N+L  +H     IK RI+++D  W+ L+S  K K+  L QA    QF R++ D+E WL  VE ++A+DD G DL SV+ L K    LE  + +H +++   +  A  F  + +F AD I+++  EV NRY  L EP+  R+  L     L QFYRD +DE  WI +K     + + G  L  +Q+++KKH  +  EI    P I+ V   GQ ++   H+A R+I +K+  +K  +  LK ++  + +LL  +L+ Q +L++ S+ E WM E++P++ S ++GK+E++TEA L+K D +  ++E+ R  +++ L+T  D  K Q
Sbjct: 2205 LQERRERI-------KDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDE---LVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQERGAALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQ 3150          

HSP 2 Score: 371.318 bits (952), Expect = 2.477e-102
Identity = 372/1527 (24.36%), Postives = 724/1527 (47.41%), Query Frame = 1
Query: 1900 AEIAANESRIDDVKNRGQNL-LDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVS-------------------------DSYGKETV------MALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGH---VPAAYVKKVDAMMSDIDPNAPEQI-------------------------------------TVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKL--KRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKEL-LKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKH-------EDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEEL 6222
            A++ A+E R   +      +  D+ H+K + I+  ++ +++ W DL    + +  ++G A+     +R++E + + L E+++Q  S D GK L  V  L +K +L++  I S  + +++    +   +  +H  A  ++++  ++++ Y  L      R+  L    KL +F+ D ++ E WI+EK  +  + ++GRDL  +Q  I+ H+A++AEI   E     V   GQ++    H    DI+K I  ++  W  LK +   RK  L  +   +QY AD +EA SW+ + +PL+   ++GKDE S+ ALL++H  +  ++EAY S +  L  QA +   Q AP++                         D  GK          A+  ++ + P+ +  R G++LT+++    D  K+ + D +G+   V + Y++++  +  +  P     +                                     T+ S Q +LE  +  L +L + +   L+D+ + ++      +   W+ +KE V  T      +LE VQ+   K + FV E     +++ ++    ++L  ++  + + +++  GI+T   +++E+++++      +L     V+ + + C E +  ++ + A+L+T DVG   +++Q    +    ERD+ AL  ++  L S A       P E+  I++    + ++  +L  +A   +  L  +  LQ F  + RDL+ W       +  +E   DV  A+ALL+ + DL                        EI+ +    ++ E  G+ L + +G     ++++ L  +     QL++ W +R ++L+Q LE Q    + ++ E  ++  E+ L    LG+ VD  +V SL+ +        E   R+I + +DK Q       +L+   ++    I+ + + +   +  LKE+    R  L   +  Q F+RDA+EM +W++EK +   DESY+DP TNI  K +KH+A E E+ ANA R+  ++ +G+++        Q  +++++  ++  +W  L  K  ++ +KL++A +Q      L+D +  +  +E  L +   G D  S   LL +H+ L  +     ++I  +  RA   + +   DS  I +      + ++ +++  ++R   L     L+ FY  +D E  WI E + +  + +Y R L+G  +L +KH+ L+ E++AH   +Q V  +G  +   +Q  N  E++++ E L   W EL++    R  +L  +   ++ L    E E  + E   L+ STDYG T  A + L+K+H+  E  ++V   + +++ +  ++ +       + + + C  ++ KL  L+ +A  R+  L +     +F  +T  +E WIA +     S+D G D  +   L  + E F   LE  + E +     L ++LI+SNH +S  I+     L + WD+LQ  SK RK+ L K ++ +K  ++L
Sbjct:  444 ADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNR-WKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAI--SSSSALKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQAKSA-AQLAPLTTETQQTRMVHYSDSSDGEDEKEKKADKGGKAVSKILQQEQAMIRFKYRGPKLIWDR-GEILTIISREKDD--KLLLRDSRGNEQLVSSTYIREL-PVSQEAPPETTNGVAESPKRKVSRPRRTRSMRRGTAEISTSTLPDPHFQKDTIESTQNSLEKDFNRLYNLAQSKNKILEDTARLHRFYNACEEFESWMGDKENVLNTFSSNSNNLEVVQA---KYENFVTELASGRKQLDDITKFGDELLKQQHSRKKDIQQRLGIVT---RRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQAEEHRQAQAERDIEALERKIDYLKSVAKMKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETGSDVASAQALLKENLDL----------------------KQEIELQKAKLKDMERLGQSLDVASGEKGGKDVQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVD--SVHSLLSRQEELEALLEALERSIILFQDKCQ-------ELISKRNFAAKEIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDP-TNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQ--SIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKN-LATNHFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQW-NGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAV--RVWGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGK-ERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDL 1916          

HSP 3 Score: 363.614 bits (932), Expect = 4.990e-100
Identity = 283/983 (28.79%), Postives = 486/983 (49.44%), Query Frame = 1
Query: 3559 KDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKT--VDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYK---KVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNL 6492
            + LE    V    RE +E ++   EK   L     G D+ SV+ L R+H+ +ER+   + ER   L+ +  + ++ H + ++ + + QEE+     KL  + +  K +L  S  LQ F A+ R L+ W    +  +    L K+ T AE+ +  H D                        AEIDAR     + + FG+ L+K+GH    EIKE L+ + DAK  L   W +R+K LDQ L+LQ++L   +Q E WM+ RE+ L+ ED+      V++L +K   F  ++  Q +++  +  +A QL++  HYD D IK + + +L R   + E   + R  L +   LQ F+  + E+  W+NEK    +DES+KDP  N+QAK  KHQ+FEAE+ AN  R+Q+ +  G  +         ++ ++ R+  + D WD L++  K K  +LQ+A +   +   L DIE WLG VE  +++ DYG D ASV  LL   Q L   + AH ++++ L + A +F   G   +D I++R   +  RY  + +  + R  TL   + L  FYR ++DE  WI +K    +++D+G  L  ++++ KKH  +  EI    P+I +V++ G  L+     A+  EI  KL  L+  +  L++ S+ +   L+++ + Q FL  V + E W+ E++ +L S DYG    A +  L+K D  + +++    K   +   G  L    + N+  + +  E ++ + + L + +  R+  LE+   F  F      +++W+  ++T  +SDDYG+DL  V+ L  K E F   + +     +  +  L  Q ++S  AQ      + ++L+  W+ L +  K R ++L   +E ++    ++EL +   +K  A +S      E+L      N L  ++AL   H   +  L   EED     +  K +              ++ +EE W+NL
Sbjct: 2439 RKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQERGAALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDW----------------------KAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPI-NLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPA--KSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFAS-REISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKL-KQSVQSADAQ-----QKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDS------EELK-----NDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNL 3378          

HSP 4 Score: 337.035 bits (863), Expect = 7.448e-92
Identity = 445/2111 (21.08%), Postives = 951/2111 (45.05%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKK---RQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELIT------MNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKS--NLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLD-SNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRI--LEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEA----------LLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWW-------KVEINDRQGHVPA----------------------------------AYVKKVDAMMSDID-PNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKEL----------VAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK-TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDM-KVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL 6183
            +IQ+R + + + +   KE+ + RR +L  +KKYQ F RDA+E+  W+ EK +   DE+++D TN+  K +KH+A E E+ A +  ++ L + G  M+ + HY ++ IQ +  ++H  W +L     E+   L+      Q +  + +     +  E  + +   G DL     L K+  +  ++ +   EK   I ++A +L    F  Q  L    K+ +  L+  K+L K    R+ +L    ++  F+ D D  ++W++E      + ++ R L    +L +KH+ L  ++ A  + + ++      ++  +  +   +Q + E L++ W  L++   +R+ +L+ + +  + L D  +L + +++  A+++ D   K      +L+++H   + +I+         K+  ++ +       +N P +  I +KL  L     +  Q   E   L+E       F R+T + E WIA+Q     +ND+G   ++   L  + E F K L   +E+    + +A++L+++ H  +  + + ++  L+R+S   L++ +K RK  L  S     F +D  +    I E+ KT  ++  K+   +QS+++KH+  + E+A  E ++ ++ +    +L   +      ++E  +E+ + W  L    + +E+ L  A  +  F+   +D  +W ++V S + +++  +D+ +      +H  L A+I + ++     +      ++    +A  I++K   +     KL +    R+  L + Y    FYRD +  E   + +E    ++++G  +  V++LIK+H+A +  +   E ++  L+   E  K        + +I+ K+  ++     +K+ + KR++ L+ S     +  D SEAE W+ ++          K +D ++           +L+KH    A+I A+ + I+S++   +       P S    ++TV AL  + +   +E+++R G VL     +++D+        +VE+  RQ  V                                    A++K ++ + + ++  N+ E +TV  +++ L  ++ N        + +L+ +++ + L+RE  ++     EK L          V   E +   H E ++ E + I E               K+  ++LKR    +  +K+     +++    +L++   R+ + L++ + +Q +        +W  ++   +    + K+ T  +    +H   + ++ A G+R+  + S    LV++  ++A  I +   ++++    LT   ED +  L  ++ LQ FL       SW++   A + +++L   ++  EAL    R LA+                       ++A+       + + ++L++  HY  + IK++ ++I   KE++ E   +R+K L++ L+LQ +L    +   W+  + S  + E   D   + + + KH+ F   I    +++QA  +  D ++   H  +  IK + ++V   W  L  N    ++RL        F R   ++E W+        ++ Y     ++    +  Q  E  + A+ E++Q ++ + +    +G  +   + +++RV ++ ++++ L    + + E L+       +   L+D   W+ +   + ++ D+G    S+ S++ KH V+  +I      I  + E     +      S  I E+   + + ++ +K+ + N+   L +A K+  F   +   E W+ E+K ++ S DYG++        +K   ++ E+ +    ++++ K G +L  +SQ  N   + + LE ++  +  L QLS  R+T+LE    +  F     + + W+L ++ +  S DYG  L  V+ L KK + F  ++  + + K + +    QKL   +  +A A +Q+ + L +  + L KA   R   L       QF    D +  W+ +KE  + S++   DL SVQ L+ +HE  +  L     E +         L+  +    D++  R Q + + W  L  ++ +R+  L
Sbjct: 1352 EIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLATNHFDSQRIL----KETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALVSTD-YGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAVRVWGLEELNKPCNH-IKSKLSELQHSATVREQRLRETLHLHE-------FKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQN--LLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTIPEDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGLQELQQEVVENWERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQAVSMGQGLLENDIPNAREIQEKLKALQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDR--------MNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEI-RQTVSALISHWKALKQELAVR-GKVL----EDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRH-EEMEREARVIQE---------RGAALEKETKDRLKR--HCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEAL---QRKLAL-------------------FENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLA--DNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDL-EKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTV----QKL-KQSVQSADA-QQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIE-EDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRL 3389          

HSP 5 Score: 315.079 bits (806), Expect = 2.827e-85
Identity = 228/843 (27.05%), Postives = 435/843 (51.60%), Query Frame = 1
Query:  373 IENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEEL-ITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRT 2898
            + + H+  + I++  + L   + +L N+ + K+++L+ T    +F    +E   W  +KE  + +  F  +  ++EV+Q K+  F+ +L    ++  +I    D LL++    ++ +  +   V    ER++ L  +   +L  + +++ F +   +  + +  +   L + D G   +++QA + +    +RD+ ALE K++ L   A    +  P     I ++  AL      LK ++++R   L+ +  L  F  + RDLL W    +  +  +E   DVA  +AL++ + + K EI+ +    K  +  G+ L +       +D+   L +LD E   L +LW+ R    EQ ++ Q    + ++ EA I+  EA L+  D+GDS+DSV +L+ + E+ E  L A E       +    L+   ++AA ++ ++   +      L+E  KLR+  L  S  YQ F RDA+E+  W+ EK + A DE+Y++PTN+  K++KH+    E+ AN  RID +   G+ +L  +H  ++ I+++ +E+ K W +L      +   L QA  Q+Q +  ++D ++ +  +E  L +   G DL S   L K+H  LE +     ++I+S + +A       HFD+  I K+ +     +  L++PLD R+ +L     L+ FY D D E +WI E +P+A +TN  R L+G  +L++KH+ +QAE+  H   +  V + G+ M  ++ +  ++++++ + +   W +L+    KR   L+ ++  +Q L D +E E+ + E   LV ST++GK E +T +L+K+H+ +   IE   + +D L++
Sbjct:  920 LPDPHFQKDTIESTQNSLEKDFNRLYNLAQSKNKILEDTARLHRFYNACEEFESWMGDKENVLNT--FSSNSNNLEVVQAKYENFVTELASGRKQLDDITKFGDELLKQQHSRKKDIQQRLGIVTRRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQAEEHRQAQAERDIEALERKIDYLKSVAKMKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETGSDVASAQALLKENLDLKQEIELQKAKLKDMERLGQSLDVASGEKGGKDVQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVDSVHSLLSRQEELEALLEALERSIILFQDKCQELISKRNFAAKEIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLAT-NHFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKS 1758          

HSP 6 Score: 275.789 bits (704), Expect = 2.385e-73
Identity = 247/970 (25.46%), Postives = 475/970 (48.97%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNE--KSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADE-LSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENG--HYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSK---VQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLL----EADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRT---------QADACKMQEA 2928
            +++Q+R EQ++ ++   +E+ ++R  +L  A   +    D  ELE+ + E     S +  K     +S  ++H+ +E +I   +  ++ L  N    +    +  E +    + + +   +L +    + + L+ TL   +F R   E+  W  ++     S + G D E+   L+ +F  F+K LE  +E+       AD L++ + PE   +   +  + ++ + L++L+K R++KL ++ +  KF++D    +  + E  K+IP   ED  +DL  VQ+  RKHEAL  +L   E+++ +L    D  L    P+ +  +Q+ ++ ++  W  L+ +  +R E+L  +   + FL+  +D   W + + + + A+E  +DVA  +  + +H +  +EI +R+E+F    + G+ L+  + P + +I  KL+ L +ER  L   W  R+   E     Q+FYRDTE  E     QE  L+N+D+G ++D VE+LI++HE FEK L +QE+K   L   A RL   G      +++  K   L  R+  +++ +  R+  LE S  + +F RD  E + WI +++    D++  + +NLQ+K   +QKHQ F AEI A+ + I+ V+  G  L+  +H KS++I++ +  L   W  L     V+ K L       +F++ VE +E+W+ + E  +   D G+D      L KK +        D++     I +    A +   +   +   +KK++ +++ R+      L   K KL  A ++H   R+ ++  D   EK  +      G D+  V+NLI++H+ ++ E    + R   +  E +  +         + KK +++K     L  +  +RK+ L +S + Q + A+      W  ++   +      K++   E+ + +H    A+I+A    IDS+++          +DA +++EA
Sbjct: 1667 QEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALVSTDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAV--RVWGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTIP---EDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGLQELQQEVVENWERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQAVSMGQGLLENDIPNAREIQEKLKALQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQERGAALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEA 2631          

HSP 7 Score: 254.218 bits (648), Expect = 9.520e-67
Identity = 393/1836 (21.41%), Postives = 802/1836 (43.68%), Query Frame = 1
Query:  109 VLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPE-QESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQ-LTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELIT--MNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGD--SLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK--LKTASD--ENYKEPTNLQSKVQKHQ-NFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFD-ADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIE---KKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALY---DYQEKNPREVSMRKGDVLTLLNSNHK-------------------DW------------WKVEIN---------DRQGHVPA------AYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWM----TIRESSLLGEDVDDKTVDSLIKKHEDFNRAIN-MQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQEN-----AVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAH 5391
            + ++ S  + +   R ++L +      FKR+  ELE WI ++ Q  +  +   D  N      + +    ++    E ++  ++    +I+++H  S  I+   + L   W++L ++ K++   L+ +    +F + + + L   KE+   +  E+  +DL+ V+   +K    + +L   E++  E+    D +L    PE +  L   +++V +  ERL+   ++R+++L  A +   F         W ++    + +E+  RD+A+      +H+ L  +++A EE   Q ++     L N  P++++ IQ+K +AL      L      R + L+ +Y    F  D   +       +  +   +L   V  VE+L++RH   +  + S+++   + +   E L T  +    + +I NKL+ L + R  +  L  +RR   E +    +F RD  +AE WI  +   ++++   D  +L +   +++KH+ FE  + A     + +    N LV   H  + ++ +    L+     L+++  +R   LED+ ++  F +  ++++ WI +K  +    D  E+Y+    L  K+ + + +   ++  +++ I  +      L   N ++   +K+R ++L++ W +        ++ L  A      +R +E++     E    L    CG D+ SV NL ++H  +E +    Q+R  + L++  +   ++H D +D + KKQ EV    VKL + + +RK +L ++++L  F  +     DW  ++        + ++    ++ I +H   +AEI     RI  V + GQ ++ + H    +I+   +K+DD K +   L    + R++ LD +L+ Q +L  A + ESWM  +E  + + + G      EAL +K       +EA               +M++    D Y ++ + A +   D  +K  + + +RK  +L +  S  K                    W            WK  IN           +  + A      A++K  D M++    + P +  +  + K++++ ++ LLS  + ++ RL+ + QA Q  R   D+ +W+   E V V      G L +V    K +           EK++ L D A      G   A + I+  + ++  +Y  L E    + + LE    + +++R+ ++   WIE+K     T D G  L S+Q + +KH  + +++      +  +      LV+     +  I +    + + ++ L  ++ +    L  ++ +Q FL++   L  W+     ++ S +  K+    EA L R  D        T D              E++++ G  +     G +L K+ H   + + + L+ +    E L +    R+ +L+      ++ RD    + W+    TI ES   G+D++   V++L KK EDF+  +  + + K+  +++   Q V+     Q     K +++L  W  L + M A    L   + +  F  D DE+ IW+NEK      E  K+   ++QA  ++H+  E +LA   E +        R KE+G+ + + +     ++ +R+ ++ + W  L+ K+  + ++LQ+A     Y    +++  WL E    ++   +G     ++ ++ KH    T I    D+ + +       +E G   S  + ER   + +   +V +    R     +  +L    R ++  E W+   +  + +EDYG  +  V +L KK + LE  I A 
Sbjct: 1779 IKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTI-PEDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGLQELQQEVVENWERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQAVSMGQGLLENDIPNARE-IQEKLKALQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQER-GAALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTM---LTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEA---------------QMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAF---SHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVE-VEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLA-DNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFL-RKLD--------TVDL-------------ELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEG--VEALQKKFEDFSEEVGTLGQSKLSTVQKLK-QSVQSADAQQ-----KEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDV-------SRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQ 3551          

HSP 8 Score: 244.588 bits (623), Expect = 8.187e-64
Identity = 226/946 (23.89%), Postives = 458/946 (48.41%), Query Frame = 1
Query:  124 SAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFK-DLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAA-NESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL---RTQADACKMQEAPVSDS 2943
            +    A E+RRK L+ A K Q F   AD+ ESW+  +     +E+    L+ +++  +K    E  + AQ E ++ +D+    +I+ +HY S+ I+ R   +    E++L + K + + L+ +L   +FL    EI  W  EK +    E + +D  +++    K   F  ++     +        D++L    P +  +  + KDV+D  ++L +  K ++ +L +A++  +F R       W+    + + ++D+G DLASV  L +  + L+  + A  EKV  L   A + S++     D IQ +   +++ ++ L +    R E L+    L +F  D  D L W+ D     A  +    +  +++++++H     EI++R     + +  G+ L+   H  S +I  KL  L K    L +    +  L +Q + +Q F  +  Q E W+ +Q+  LE+ D G + ++ EA +RK +  +  L +Q  K + L      L ++ H  +  V+K  +D+      L + +  R++ LE+ +N+ +F+RDA +++ W++ +   A  ++Y K+   +++  +K ++F  E+    +S++  V+   Q++      +S D +++ ++L KLW DL  A K + +NL  A    QF  +++++ IW+ E E  L S++   DL SV  L ++H  LE D++  ++ +    ++    V       D + K+  EV   +  L E  ++R+ +L  A  + ++  +  +   W+ E   +      G  +  ++ +IKKH   + +I     +   V N+G++++   +    ++E+++ ++K++   +     +R+    + +E QQ   +  +AE W+   E  + + ++G+       L+KK + L A I+A     ++L   RTQ +  KM+E    DS
Sbjct: 2640 TMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESW-KDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKLKQSV------QSADAQQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQSERFNALQARRTQREN-KMKEIQRGDS 3577          

HSP 9 Score: 216.853 bits (551), Expect = 2.052e-55
Identity = 142/510 (27.84%), Postives = 273/510 (53.53%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEK 1611
            +I E+   +   + A K+ +  + + L+ A K Q F  +  +LE W+ E+       ++ K+    ++  +K   ++LE+ +Q   + AL K G D+ ++ H  S ++   L+ +   +E LL +  E+   L+   ++  F R   ++  W   ++T   S+++G+DLE VE LQKKF +F +++    +       K    +Q    +Q     K+KD+    E L    K R + L  A E+ +F  D D+   W+NEK + L SE+   DL SVQAL R+HE L+RDL  +EE V++  ++   L  + P  +D++  + + +   W +L +K+ +R ++L  + ++ R+L ++R+++ WL +  +++  +     V  +E ++++H+E++++ID + +  +  KN+G  L+   +  S ++  +L  L    V +++ W ERR  Y+++++LQ   R+ EQAE W+   E+ L   D G+S+  V  L++K ED E  + AQ E+
Sbjct: 3050 EISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKLKQSVQSADAQQ-----KEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQSER 3554          

HSP 10 Score: 184.111 bits (466), Expect = 1.465e-45
Identity = 196/933 (21.01%), Postives = 420/933 (45.02%), Query Frame = 1
Query: 3490 IEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRK----HDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLL---GEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWF 6267
            I   ++ L   ++ L++    + K LED      + ++ ++ + WI +K+  +N  DVG+D    Q+L +K      +   D+      +K +++ AA L + + +E   + + ++++NE W         YK KL  ++++   + +  ++         L+       DV   E L+ RH ++                    E  A +    G     E   K+ LK      +++ +K + +  A  +L++E   RK++L +  +LQL+  +     DW T+++S  +   G   +    +S I +H D+   I+ + D++ ++K F   LV+  H D   IK+  +++      L       R  L     LQ F+  AD+ E W++ +    ++E      + ++A  +K   FE  L A  E++  +    Q+L +        + +++R   +  + + ++  SK + + L+E+ +   +     +I  WL E ++S++  +  KD  ++ + L KHQ    +I A+ +R++   +  D  +         I+ R K +++ ++++    +++   L +A +   F R++ D E W+   ++ V+++DYG DL  V  L K  Q LE  + AH   +Q +     +  ++      D I++++  +   +  L +    R+  LE      +F   +E+E  WI +K    ++ D+G +L ++Q ++KKH     +++        +   GQ L+   +  ++ I ++  GL++  D L+K +  +   L+       F+ +   +E W+ +++  ++S DYG++  + +  L K +T D  LES R + +E +      L +S H  S  +    +++   ++ L + S  R+    +L+ +Y      +  F + A    +W 
Sbjct: 2306 IRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEM--------------------EREARVIQERGA--ALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDW-TLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHY--DSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNE-KNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFL-ADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGK-VEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRT---ELENQYN-----FYIFERDARDLQTWL 3202          

HSP 11 Score: 173.326 bits (438), Expect = 3.096e-42
Identity = 192/921 (20.85%), Postives = 432/921 (46.91%), Query Frame = 1
Query: 3280 ANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKL-LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGED--VDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRL-GDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLRE-KLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLES 6027
            A+    W+  +E   + E +  G L  V++ ++K+  F N  + + E++ E+   A +L ++   ++ + I+     +  + E++ E++  + K LE+   +Q++     E   W+ EK++ +   +  KD  ++Q    KH + E +++A   RV+  +      L  +HP +++ I    +++++ W++L +  +  K +L  +    +F     D+  W+ ++   V++D+   D+     LL+  + L                   EE    +DA     Q   D  K+    G++  + I++++  + +    L E    R++ L+    L  + RD E    W+  +  +   +D     +++ S++KKH    + I  +   + A++E    LV   H+    I +K   +   + +LK+   AN+ RL      +Q+F+ +  ++E W+ E+        Y       +A  +K    + EL +   +++++L +G  L EK Q     + V + +  +  +++ L+  S ++  +L+      ++    +D++ WL   +    S DYGKD   V++L  K +    ++           ++  + ++S        ++++K + + +E + +  + RA  L  A+++H F   +D+   W+ EK++ + SE+   DL+ V+ L ++H+ LE ++   E  +   +++G  L+  S     D + ++L+ +E  W  L + ++ R+ +L+++   Q++L    E   W+ E   L++   +G  +  ++ ++KKHD + T +    DK   + N+G++L+++ N  +  +E+R   L++ ++ VL     RR    ED     Q   + +  E W+   E+ ++++DYG  +S V  L+ K E  +  +++
Sbjct: 2666 ADQTESWMSNREAFLINEDLG-GSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDS-DNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNS-VAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSK-IKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGL-------------------EEM---VDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKES-ANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDL-EKSQ-HPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKLKQSVQSADA-----QQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVR-DSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQED-IELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQA 3550          

HSP 12 Score: 169.859 bits (429), Expect = 3.414e-41
Identity = 180/757 (23.78%), Postives = 356/757 (47.03%), Query Frame = 1
Query:   34 MADITLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILE-KIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQE------EKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADEL-SNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLW---NERRVLYEQNM----DLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSF 2256
            M   + P + KI    +D+ +  +Q+L+         + ++ +L+ A +   F+R   ++E W+   +++  +D+   DL ++    +  Q LE  + A  E +  L     D     ++ ++ IQ R+ ++   +  L    + +   L+      QF R +++ L W ++K     ++++G  L+ ++ + KK    M+++E +       ++A +   +  H    +  E+ S + K  D       LK  +  + + L +A +IQ F  +  +   W+ E+   L S D+G++  + +A  RK + +D +L +   KV  L K   +L  ++HP+S   +    E +   +  L + S ER  +L+  Y+ + F  D RDL +WL   K +  +D+  KD+ GVEAL ++  +   E+ +  +S  S   + ++ +      S D   K    +K+   L++LW   N+      +N+    ++  F  D ++   W+ ++E  L++ ++ + L SV+ALIR+HE  E+ LA  EE   R       LV         ++K+  ++     NL EKA  R+  L+ +   Q +  +  E+  W+ E L   + E +     +L+  ++KH  +  +I     + + VKN G+ L++  ++ S +++ER+ EL  L   ++ A   +     +    QQ  R +E  E WL   ES L ++D G+ ++ V +L KK   LEA I +  +R ++ 
Sbjct: 2828 MLAFSHPAKSKIKPRIKDVDDNWDQLLSN-------CKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDA------LKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSH-LVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKLKQSVQ-----SADAQQK----EKD---LLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQSERFNAL 3558          

HSP 13 Score: 154.066 bits (388), Expect = 2.267e-36
Identity = 205/985 (20.81%), Postives = 430/985 (43.65%), Query Frame = 1
Query: 3511 LQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALER-------DLVALGERVKLLDSKAA--ELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWI-NTMNALVSSDELAKDVTGAEA---LLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRA----INMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKS--------------KDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQ---ERYKKVEE--LYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAH 6345
            LQ++ E+L +    + K LE+ Y  Q ++R+ +  ++    ++ +L  SD+G  +  V+ L ++H+A E+        +VAL E  + L ++    E      N+ + + + +E I ++  K   + ED ++   + I    F  D  +   WI + MN +   D+   D++  +    +L++H+                         AEI A     ++ +  G EL+   H    EI++ + ++    + L +E   R K L+   +   +L+  EQ E W+  +E  +    +GED +      L+KK  +F  +    + + +  ++ +   A +L      +   +K + Q++  RW +   N+ + + +L     + A IR+ +E+     EK+     +       +++   ++H+  E E               + ++E+G  +  E   ++R+ +  D  D L  K               K + E+LQE+++  ++ A  + +  W  +    +      K+    +S + +H     +I A  DRI  +       ++SG  D+  I+E  + +++    + +  E+R  TL +A KL  F    D  E+W+  ++  + +ED G  L  V  L++K    EN + A    +  V++   +L+  +   + D IK++ + +      + ++S  R+  LEES + QKFL+   E  +W+ EK  +     + D +  +Q  L KH +FE ++  + ++      +G  ++  ++     I+ R + + +  D L      +K  L+     LQF      +E W+   E +V +DDYG DL+SV  LL   +  +  +++  +E ++ +           +  +D I+ R   +++R++ L    + R++ L   Q   + Y+ +E+  L++    +A+A   W               SL+ I+++ + H
Sbjct: 2097 LQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGK---RREDLEVSKLHCI----FSRDVSEAEEWITDRMNKI--QDDSKMDMSNLQTKMKMLQKHQVF----------------------EAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHG--QQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMERE--------------ARVIQERGAAL--EKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHY-DSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPI-NLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAH-MEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDW-------------GTSLQSIQSIVKKH 3016          

HSP 14 Score: 149.443 bits (376), Expect = 5.592e-35
Identity = 161/754 (21.35%), Postives = 326/754 (43.24%), Query Frame = 1
Query: 3478 AVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDI 5733
            A  KI+  I  +   ++QL      K   L+  Y   ++ R   + +EW+   +  +   D G DL SV RL +    LE  + A  E+V+ L   A +        A+ I Q   E+   +N L    +  +  L +   L +F  D  D + WI       ++ +    +   ++++++H  +  EI NRT        P+                  ++ G+ L++  H+A  EI EKL  +    + L +E  N+ + L Q L++Q +L +  Q E WM  ++  L   D   +++  ++ ++K +  +  +  Q  K++AL +    L + +H +   +    +++   + +L +     R+ L +      F RDA +++ W+  +      + Y      ++A  +K + F  E+       QS L + Q+LK+  Q        +++   L   W+ L    K ++E L  A     +   L ++  W+ E E +L S +   D  SV +L+ +H+ L  D+   E+ +    E     +       D++ +R + + E +  + + A  R   L +A+ +  +     +   W++E   L++ E +G  +  +  + KKH     +I       + V+  G  LM E   +   E++ +L  L+   V + +  + R+ + +E  E Q+    +E+ E W+   +  L + DYG++++ V  L+KK +  E  ++   ++ N +
Sbjct: 2835 AKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRT--------PL--------------IMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLG---QSKLSTVQKLKQSVQSAD----AQQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGN-SWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQSERFNAL 3558          

HSP 15 Score: 148.288 bits (373), Expect = 1.180e-34
Identity = 208/967 (21.51%), Postives = 437/967 (45.19%), Query Frame = 1
Query:   46 TLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK---IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQES--LINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADEL--SNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDS-HNYQLFDRDAD-EIKAWIVEKLKTASDENYKEPTNLQSKVQ---KHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEI-WLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD 2907
            TLP      +T E  Q   E+  NR     ++   + K LED  +   F    +E ESW+ +K   + T+S  +     NL+    K++    E+A+  + L+ + K G ++++  H   + IQ RL  +   WE++  +  E +  L  + D   FL+   E+    + +   + + + G     ++  + +  +  +D+E  E K    Y K+   +++D    ES  ++ +   +ED L +LK  A +RQ+ L EA  +Q F ++T   + W       L  E+ G D+AS QAL +++  L +++   + K+  + +    L  ++     KD +Q     L   WS L K    RN +L+      +   +   + + ++  +A +   +L   V  V +L+ R  E ++ +++ + S    +++ +ELI+  +  +++I  + + +      L +    RR+    +   Q F RD E+   W+ ++    E+    D  + +  L +KHE  EK + A   +  RL     +++ + HY    + KK  ++  R   L+ K   R   L  +    QL +   D ++K   +E++     +N     +L+S  Q   +H+    E      +I+ +  R +NL  +NH  S+ I +  +   KL+  L      +   L        F  +V D+E+ W++E +    + +  + L    +L +KH  L+A++++H   +   L +         ++   ++++  ++  ++ +L+E   KR  +LN A    Q   D  + E  + E   +  ST+ G+  +  ++LIK+H+ ++ +I     ++ E+ +  ++ +    +   ++ K  + +K+  S+L++ A  R+Q L ++L   ++  + SE E W+ ++  +  S + G D ++   L  + +  +  +E  +  + +    AD
Sbjct:  919 TLPDPHFQKDTIESTQNSLEKDFNRLYNLAQS---KNKILEDTARLHRFYNACEEFESWMGDKENVLNTFSSNS----NNLEVVQAKYENFVTELASGRKQLDDITKFGDELLKQQHSRKKDIQQRLGIVTRRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQAEEHRQAQAERDIEALERKID--YLKSVAKMKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETGSDVASAQALLKENLDLKQEIELQKAKLKDMERLGQSLDVASGEKGGKD-VQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVDSVHSLLSRQEELEALLEALERSIILFQDKCQELISKRNFAAKEIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDPTNILRKL-KKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERML----QNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLA-TNHFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDV-DLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAVRV--WGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLAD 1865          

HSP 16 Score: 136.346 bits (342), Expect = 4.470e-31
Identity = 181/856 (21.14%), Postives = 383/856 (44.74%), Query Frame = 1
Query:  367 DMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTL----DYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEA---HEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNE-------------RRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFE---KSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASD----ENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDAD-GIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDAL 2850
            ++I   ++A++ IQ R   +   +++L    KE  +L +L L     Y +FLR  +E+L W  EK      E + +D  ++    KK     K+++    +   +    + +L +D    +S+  K ++V      L+    +R  KL +A    ++ +  +D    I  +      L +   G DL S + L ++H+ L+ +   L EK+N +   A  L+  H DS+  +++  +  L  +  L+K    R  QL+    L+ F  D    L+W+++ + V       + + G  +L+++H + ++E+++  +  +   + G  +   N    +++  + E+       LI  W E             R V  EQ         D  + E  +++  A + + D G +  +  +LI++HE  E   + LAAQ ++ +     A R+     +   ++NK  + +  + S L+  A +R+  L ++ +   F R+  E++ WI ++ + A+      +Y+    L+ + +    FL ++   + R+   +     L+ SNH +S  I+E    L + W++L   SK +++ L ++    +F +++ D    + E    +  +D  KDL  V +  +KH  L  +++  + ++   L   D  +     +   G+++ Q EV   + +L+  +++R+ +L  A   + F   A D   W  +      +    RD+      + +HQ + AEI+  E    +  + GQ ++  D    R+I++K+  ++     L +    R++ L+++   Q +  D    E     +E  + +++ G   D  E+L+K+H+A 
Sbjct: 1341 ELISKRNFAAKEIQQRSKVIQDHFKRL----KESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESY-RDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERM---LQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLATNHFDSQRILKE-TDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQ-------LIAKWEELEESCKKRSGELNRAVTREQ------ILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAVRV-----WGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEV---FLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTIP-EDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGLQELQQEVVENWERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQAVSMGQGLLENDIPNAREIQEKLKALQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAF 2164          

HSP 17 Score: 100.523 bits (249), Expect = 3.610e-20
Identity = 219/1039 (21.08%), Postives = 434/1039 (41.77%), Query Frame = 1
Query: 3490 IEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNT-SDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAEN-EIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLAR----WGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIE---FWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLET---AWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEG-IEVITSLHNQLIESNHAQSDAIKHRYQNLMDRW--DKLQRESKRRKDHLLKLQE----RYKKVEE-LYL-TFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQL-DKEIQSYGVGGNPYTWFTMEA---LEETWKNLQRIIQERDAEL 6525
            IE     L+K + +L  +   K K LED   + R++  C+E + W+ +K+  LNT S    +L  VQ    K++    +L +  +++  +     EL++   +  + I Q    +   W ++    ++   +L +S D++ FL   +++ + +    A + + ++    +  +A  E HR    E                     +I+A        +   K + K    AE+  I E++ ++ D   QL  + + R++ L++   LQL+ ++      W    +  LL E+   D  +  +L+K++ D  + I +Q+ K++ ++     L       + G KD  Q+ L +    W  L +   +   RL      Q    +AD +E  I+            D   ++ +   + +  EA L A    +       Q L  K     +E  +++R   + D +  L    K +  +L  + +   Y   L+D E    W+ E +  ++  +  +D  ++   L KH+    ++ A+  RI  L E  ++ +     ++ +I+++ + +++R+ ++++    R   L +A +       + D +  I   + ++ +   G DL   R L K+H++LE E       I S+  +   L       N  + +R L+  +T    +  L++    R+++LE   +   F   V+ E  WI E Q +  +T+Y  +L     LL+KH   + ++  H      + + G+ +   N  N + ++QRCE L  K + L ++  +R   L       Q +     +E+ +++    V S DYG+   + ++L+ +HE          +EG IEV+            AQ D +K   +  +  W  ++L +     K  L +LQ     R +++ E L+L  F ++ S    W     +        +  E    L      F   L+  +E      QL DK I+S     +P + F  E    L E+W  LQ + ++R  +L
Sbjct:  930 IESTQNSLEKDFNRLYNLAQSKNKILEDTARLHRFYNACEEFESWMGDKENVLNTFSSNSNNLEVVQ---AKYENFVTELASGRKQLDDITKFGDELLKQQHSRKKDIQQRLGIVTRRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQA--EEHRQAQAE--------------------RDIEALERKIDYLKSVAK-MKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETGSDVASAQALLKENLDLKQEIELQKAKLKDMERLGQSL--DVASGEKGGKD-VQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVDSVHSLLSRQEELEALLEALERSIILFQDKCQELISKRNFAAKE--IQQRSKVIQDHFKRLKESCKLRRLELLASKK---YQEFLRDAEEMLLWMDE-KFEIAEDESYRDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLAT-----NHFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEG---------VEGQIEVLA-----------AQVDELKSNVKQAVRVWGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKS----NHPESRFIRETQNLLRESWDELQDLSKDRKEKL 1903          

HSP 18 Score: 96.6709 bits (239), Expect = 4.779e-19
Identity = 84/334 (25.15%), Postives = 155/334 (46.41%), Query Frame = 1
Query: 5044 QVLGTDIHAHEDRIKDLNERADEFIESGTCDS--DTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIE 6039
            + LG D+ AHE R + L+E A   IE     S    IR    ++N R++ +KQ+ + +   +G A       R I+     ++E +    S D G+ L  V  L +K   ++ +I +    + ++       +         +++R+L+ L + +  L  LS  R+  LE   +  +F    EE EAWI EK  LL +   G  L+ +Q  ++ H A E +++  E  C+ +   GQ+L    + N   I++    L+++   L++    RK+ L   +   Q+        SW+ D +  +  +DYG+D +S   LL +H+  +  +E++  E
Sbjct:  440 EALGADVLAHEPRFRALSEMA-AVIERDNYHSKVQVIRRNVDIMN-RWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSSALKVKHK---GATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSE 768          

HSP 19 Score: 90.5077 bits (223), Expect = 3.743e-17
Identity = 72/316 (22.78%), Postives = 154/316 (48.73%), Query Frame = 1
Query:  109 VLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDEN--FKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDK 1050
            ++NR+   K+  +E+R  + DA       RD  EL S  L+++Q  +D +   K L ++ +  QK   ++ +I +  E LNA+  +    ++  H  +  +Q  L  L++ +  LL + K + + L+  L   +F    +E+  W  EK   + +   G+DL  ++   +       +++ QE   + +  +   L +   P +  +    + ++   ++LK     R+ +L  A+ I+++F D  +  SW+++    L  ED+G+D AS  AL ++H+ +++++ A   +V +L + A   +   P + +T Q +
Sbjct:  481 IMNRWKDLKQVLQEQRAHVGDAANTFAVLRDI-ELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSS--ALKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQAKSAAQLAPLTTETQQTR 793          

HSP 20 Score: 80.8777 bits (198), Expect = 2.637e-14
Identity = 88/372 (23.66%), Postives = 171/372 (45.97%), Query Frame = 1
Query:  184 QYFKRDADELESWILEKIQTYSDENFKDLTNLQSKN---QKHQALELEIAAQSENLNALDKNGYDMIE--NHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELS-NKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDS 1281
            Q F R A   ES++ + +Q    ++   L  L+      ++ +AL  ++ A      AL +    +IE  N+H   ++I+  +D ++  W+ L  + +E+   +    +    LR ++ I    KE +    S + G+ L  V  L +K +     +    E    I S +   L+        +  + KD+      L  L+K R++ L    ++ +FF D ++  +W+ EK + L +   GRDL+ +Q   + H+AL+ ++ + E   + +     EL   +HP+  D IQ     L   W  LK++   R  +L  +  + ++ +D  +  SWL D K ++  ++  KD A   AL++RH   + E+++
Sbjct:  398 QKFGRKATLRESYLEDTLQLIQQQDLGGLQRLEEAEIAARRLEALGADVLAHEPRFRALSEMAA-VIERDNYHSKVQVIRRNVDIMNR-WKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSS--ALKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNEND-IQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEA 764          

HSP 21 Score: 80.4925 bits (197), Expect = 3.252e-14
Identity = 72/271 (26.57%), Postives = 130/271 (47.97%), Query Frame = 1
Query: 1465 RDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK---LKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQA 2268
            RD E     + + +A  +++D+G  L  V AL++K +  +  + +  E    + + +   V+  H  A  V ++  DL    ++L   +K R+ +LE       F  D +E++AWI EK   L+ AS    ++ + +Q  +Q H+   AEI + ES    V  RGQ L    H    DI++ I  L K W  L     +++  L  A+  +Q+  ++ +   WL + +  L  +D GKD  S T L ++H  +E ++ ++   +    +QA
Sbjct:  510 RDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSSALKVK--HKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAAS--LGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQA 776          

HSP 22 Score: 77.411 bits (189), Expect = 3.103e-13
Identity = 108/490 (22.04%), Postives = 216/490 (44.08%), Query Frame = 1
Query:  517 VDEILFWTKEKETFVTSEEFG---QDLEHVEVLQKKFNEFMKDLEYQEEKAAEIY-----SKADHLLQEDF--PEQESLINKKKD------VEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFG--RDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRI 1929
            V ++L W K K   +    F    ++++H+    KK+    K  +YQE  A E +     +K     Q D+  PE ++L + +++       E   ER+   A  R ++L +    QKF R      S++ +    +  +D G  + L   +   R+ EAL  D++A E +   L++ A  +   +  SK  +  +   +++ W  LK+   E+   +  + +    L D   +   L +++A   + ++ K +  V AL+++ +   ++I S  E+  +  +     + + H  +  +  +L+ L+     L+ L   RR   E  + L  F+ D E+ EAWI ++   L+   +G  L  ++  I+ H+  E  + +QE     +      L    H    D+ K    L  +   L+E+  +RK+ L  ++  + +  D  E  +W+ +      DE+Y K+  +  + +Q+HQ    E+ A  S +
Sbjct:  284 VSDLLRWIKTKVVELNDRSFPNSLREMQHLVAAFKKYRTIEKPPKYQERGAIEAHLFDLRTKLRANNQRDYIPPEGKTLGDIERNWTLLERAEHQRERVLQSALMRLEQLEQL--AQKFGRKATLRESYLEDTLQLIQQQDLGGLQRLEEAEIAARRLEALGADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNRWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSSA--LKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEV 769          

HSP 23 Score: 62.003 bits (149), Expect = 1.639e-8
Identity = 48/224 (21.43%), Postives = 106/224 (47.32%), Query Frame = 1
Query: 2212 LEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCN--EGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRS 2877
            L AD+ +H+ R  +  + A     + +     + ++  ++ NR+  L++ L +++  + DA       RD +     + E +  A S+++G+ L  V  L++K   I  +II     + E  N       +   H     +++++ D+ + ++ L   +  R++ L+  L+  ++  D  E E+W+ EK  L+ +   G+D    +  ++ H AL A+I++  S
Sbjct:  442 LGADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNRWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIIS----LGETLNAISSSSALKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQES 661          
BLAST of Spectrin alpha chain vs. Ensembl Zebrafish
Match: sptbn5 (spectrin, beta, non-erythrocytic 5 [Source:ZFIN;Acc:ZDB-GENE-131121-26])

HSP 1 Score: 486.878 bits (1252), Expect = 1.016e-137
Identity = 313/956 (32.74%), Postives = 527/956 (55.13%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKN---QKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMK----DLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNL---AKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDS-LRTQADACKMQ 2922
            +QERRE++       K+ + +RR+ LE +K +  F RD  E E WI +++    D++  D++NLQ+K    QKHQ  E EI A    + ++ + G +++  HH  S+ I+  +  L + W+ L      + ++L+   D+++FL++V+++  W ++KE  +   + G+D EH + L KK +EF      D+   +     I + A  L +++  E   L+  KK  +   ER +N        ++KL  A E+    R+ ++      EK + L  +  G D+ SV+ L R+HE ++R+   ++E+   L K+  +   +H D  D +  K+E +  A   L K+   R E+L  S+ L  F ++ R LL W       +    L K+    E+ +  H++ K+EID+R +   S K+ G+ L+   H  + +I   L +LD  + +L + W +RR   +Q + LQ+F    +Q E+W++ +EAFL N D+G SL  VEAL RK   FE SL AQ E+   +D  A +L++  HY + ++ K+   +L+RK  + E +K R+ +LE+S   Q F   + EI +W+ EK   A DE++K+P NLQ+K+ KHQ+F AEI AN +R+      G N+L  +H     IK RI+++D  W+ L+S  K K+  L QA    QF R++ D+E WL  VE ++A+DD G DL SV+ L K    LE  + +H +++   +  A  F  + +F AD I+++  EV NRY  L EP+  R+  L     L QFYRD +DE  WI +K     + + G  L  +Q+++KKH  +  EI    P I+ V   GQ ++   H+A R+I +K+  +K  +  LK ++  + +LL  +L+ Q +L++ S+ E WM E++P++ S ++GK+E++TEA L+K D +  ++E+ R  +++ L+T  D  K Q
Sbjct: 2205 LQERRERI-------KDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDE---LVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQERGAALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQ 3150          

HSP 2 Score: 371.318 bits (952), Expect = 2.477e-102
Identity = 372/1527 (24.36%), Postives = 724/1527 (47.41%), Query Frame = 1
Query: 1900 AEIAANESRIDDVKNRGQNL-LDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVS-------------------------DSYGKETV------MALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGH---VPAAYVKKVDAMMSDIDPNAPEQI-------------------------------------TVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKL--KRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKEL-LKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKH-------EDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEEL 6222
            A++ A+E R   +      +  D+ H+K + I+  ++ +++ W DL    + +  ++G A+     +R++E + + L E+++Q  S D GK L  V  L +K +L++  I S  + +++    +   +  +H  A  ++++  ++++ Y  L      R+  L    KL +F+ D ++ E WI+EK  +  + ++GRDL  +Q  I+ H+A++AEI   E     V   GQ++    H    DI+K I  ++  W  LK +   RK  L  +   +QY AD +EA SW+ + +PL+   ++GKDE S+ ALL++H  +  ++EAY S +  L  QA +   Q AP++                         D  GK          A+  ++ + P+ +  R G++LT+++    D  K+ + D +G+   V + Y++++  +  +  P     +                                     T+ S Q +LE  +  L +L + +   L+D+ + ++      +   W+ +KE V  T      +LE VQ+   K + FV E     +++ ++    ++L  ++  + + +++  GI+T   +++E+++++      +L     V+ + + C E +  ++ + A+L+T DVG   +++Q    +    ERD+ AL  ++  L S A       P E+  I++    + ++  +L  +A   +  L  +  LQ F  + RDL+ W       +  +E   DV  A+ALL+ + DL                        EI+ +    ++ E  G+ L + +G     ++++ L  +     QL++ W +R ++L+Q LE Q    + ++ E  ++  E+ L    LG+ VD  +V SL+ +        E   R+I + +DK Q       +L+   ++    I+ + + +   +  LKE+    R  L   +  Q F+RDA+EM +W++EK +   DESY+DP TNI  K +KH+A E E+ ANA R+  ++ +G+++        Q  +++++  ++  +W  L  K  ++ +KL++A +Q      L+D +  +  +E  L +   G D  S   LL +H+ L  +     ++I  +  RA   + +   DS  I +      + ++ +++  ++R   L     L+ FY  +D E  WI E + +  + +Y R L+G  +L +KH+ L+ E++AH   +Q V  +G  +   +Q  N  E++++ E L   W EL++    R  +L  +   ++ L    E E  + E   L+ STDYG T  A + L+K+H+  E  ++V   + +++ +  ++ +       + + + C  ++ KL  L+ +A  R+  L +     +F  +T  +E WIA +     S+D G D  +   L  + E F   LE  + E +     L ++LI+SNH +S  I+     L + WD+LQ  SK RK+ L K ++ +K  ++L
Sbjct:  444 ADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNR-WKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAI--SSSSALKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQAKSA-AQLAPLTTETQQTRMVHYSDSSDGEDEKEKKADKGGKAVSKILQQEQAMIRFKYRGPKLIWDR-GEILTIISREKDD--KLLLRDSRGNEQLVSSTYIREL-PVSQEAPPETTNGVAESPKRKVSRPRRTRSMRRGTAEISTSTLPDPHFQKDTIESTQNSLEKDFNRLYNLAQSKNKILEDTARLHRFYNACEEFESWMGDKENVLNTFSSNSNNLEVVQA---KYENFVTELASGRKQLDDITKFGDELLKQQHSRKKDIQQRLGIVT---RRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQAEEHRQAQAERDIEALERKIDYLKSVAKMKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETGSDVASAQALLKENLDL----------------------KQEIELQKAKLKDMERLGQSLDVASGEKGGKDVQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVD--SVHSLLSRQEELEALLEALERSIILFQDKCQ-------ELISKRNFAAKEIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDP-TNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQ--SIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKN-LATNHFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQW-NGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAV--RVWGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGK-ERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDL 1916          

HSP 3 Score: 363.614 bits (932), Expect = 4.990e-100
Identity = 283/983 (28.79%), Postives = 486/983 (49.44%), Query Frame = 1
Query: 3559 KDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKT--VDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYK---KVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNL 6492
            + LE    V    RE +E ++   EK   L     G D+ SV+ L R+H+ +ER+   + ER   L+ +  + ++ H + ++ + + QEE+     KL  + +  K +L  S  LQ F A+ R L+ W    +  +    L K+ T AE+ +  H D                        AEIDAR     + + FG+ L+K+GH    EIKE L+ + DAK  L   W +R+K LDQ L+LQ++L   +Q E WM+ RE+ L+ ED+      V++L +K   F  ++  Q +++  +  +A QL++  HYD D IK + + +L R   + E   + R  L +   LQ F+  + E+  W+NEK    +DES+KDP  N+QAK  KHQ+FEAE+ AN  R+Q+ +  G  +         ++ ++ R+  + D WD L++  K K  +LQ+A +   +   L DIE WLG VE  +++ DYG D ASV  LL   Q L   + AH ++++ L + A +F   G   +D I++R   +  RY  + +  + R  TL   + L  FYR ++DE  WI +K    +++D+G  L  ++++ KKH  +  EI    P+I +V++ G  L+     A+  EI  KL  L+  +  L++ S+ +   L+++ + Q FL  V + E W+ E++ +L S DYG    A +  L+K D  + +++    K   +   G  L    + N+  + +  E ++ + + L + +  R+  LE+   F  F      +++W+  ++T  +SDDYG+DL  V+ L  K E F   + +     +  +  L  Q ++S  AQ      + ++L+  W+ L +  K R ++L   +E ++    ++EL +   +K  A +S      E+L      N L  ++AL   H   +  L   EED     +  K +              ++ +EE W+NL
Sbjct: 2439 RKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQERGAALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDW----------------------KAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPI-NLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPA--KSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFAS-REISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKL-KQSVQSADAQ-----QKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDS------EELK-----NDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNL 3378          

HSP 4 Score: 337.035 bits (863), Expect = 7.448e-92
Identity = 445/2111 (21.08%), Postives = 951/2111 (45.05%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKK---RQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELIT------MNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKS--NLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLD-SNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRI--LEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEA----------LLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWW-------KVEINDRQGHVPA----------------------------------AYVKKVDAMMSDID-PNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKEL----------VAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK-TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDM-KVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL 6183
            +IQ+R + + + +   KE+ + RR +L  +KKYQ F RDA+E+  W+ EK +   DE+++D TN+  K +KH+A E E+ A +  ++ L + G  M+ + HY ++ IQ +  ++H  W +L     E+   L+      Q +  + +     +  E  + +   G DL     L K+  +  ++ +   EK   I ++A +L    F  Q  L    K+ +  L+  K+L K    R+ +L    ++  F+ D D  ++W++E      + ++ R L    +L +KH+ L  ++ A  + + ++      ++  +  +   +Q + E L++ W  L++   +R+ +L+ + +  + L D  +L + +++  A+++ D   K      +L+++H   + +I+         K+  ++ +       +N P +  I +KL  L     +  Q   E   L+E       F R+T + E WIA+Q     +ND+G   ++   L  + E F K L   +E+    + +A++L+++ H  +  + + ++  L+R+S   L++ +K RK  L  S     F +D  +    I E+ KT  ++  K+   +QS+++KH+  + E+A  E ++ ++ +    +L   +      ++E  +E+ + W  L    + +E+ L  A  +  F+   +D  +W ++V S + +++  +D+ +      +H  L A+I + ++     +      ++    +A  I++K   +     KL +    R+  L + Y    FYRD +  E   + +E    ++++G  +  V++LIK+H+A +  +   E ++  L+   E  K        + +I+ K+  ++     +K+ + KR++ L+ S     +  D SEAE W+ ++          K +D ++           +L+KH    A+I A+ + I+S++   +       P S    ++TV AL  + +   +E+++R G VL     +++D+        +VE+  RQ  V                                    A++K ++ + + ++  N+ E +TV  +++ L  ++ N        + +L+ +++ + L+RE  ++     EK L          V   E +   H E ++ E + I E               K+  ++LKR    +  +K+     +++    +L++   R+ + L++ + +Q +        +W  ++   +    + K+ T  +    +H   + ++ A G+R+  + S    LV++  ++A  I +   ++++    LT   ED +  L  ++ LQ FL       SW++   A + +++L   ++  EAL    R LA+                       ++A+       + + ++L++  HY  + IK++ ++I   KE++ E   +R+K L++ L+LQ +L    +   W+  + S  + E   D   + + + KH+ F   I    +++QA  +  D ++   H  +  IK + ++V   W  L  N    ++RL        F R   ++E W+        ++ Y     ++    +  Q  E  + A+ E++Q ++ + +    +G  +   + +++RV ++ ++++ L    + + E L+       +   L+D   W+ +   + ++ D+G    S+ S++ KH V+  +I      I  + E     +      S  I E+   + + ++ +K+ + N+   L +A K+  F   +   E W+ E+K ++ S DYG++        +K   ++ E+ +    ++++ K G +L  +SQ  N   + + LE ++  +  L QLS  R+T+LE    +  F     + + W+L ++ +  S DYG  L  V+ L KK + F  ++  + + K + +    QKL   +  +A A +Q+ + L +  + L KA   R   L       QF    D +  W+ +KE  + S++   DL SVQ L+ +HE  +  L     E +         L+  +    D++  R Q + + W  L  ++ +R+  L
Sbjct: 1352 EIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLATNHFDSQRIL----KETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALVSTD-YGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAVRVWGLEELNKPCNH-IKSKLSELQHSATVREQRLRETLHLHE-------FKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQN--LLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTIPEDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGLQELQQEVVENWERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQAVSMGQGLLENDIPNAREIQEKLKALQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDR--------MNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEI-RQTVSALISHWKALKQELAVR-GKVL----EDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRH-EEMEREARVIQE---------RGAALEKETKDRLKR--HCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEAL---QRKLAL-------------------FENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLA--DNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDL-EKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTV----QKL-KQSVQSADA-QQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIE-EDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRL 3389          

HSP 5 Score: 315.079 bits (806), Expect = 2.827e-85
Identity = 228/843 (27.05%), Postives = 435/843 (51.60%), Query Frame = 1
Query:  373 IENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEEL-ITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRT 2898
            + + H+  + I++  + L   + +L N+ + K+++L+ T    +F    +E   W  +KE  + +  F  +  ++EV+Q K+  F+ +L    ++  +I    D LL++    ++ +  +   V    ER++ L  +   +L  + +++ F +   +  + +  +   L + D G   +++QA + +    +RD+ ALE K++ L   A    +  P     I ++  AL      LK ++++R   L+ +  L  F  + RDLL W    +  +  +E   DVA  +AL++ + + K EI+ +    K  +  G+ L +       +D+   L +LD E   L +LW+ R    EQ ++ Q    + ++ EA I+  EA L+  D+GDS+DSV +L+ + E+ E  L A E       +    L+   ++AA ++ ++   +      L+E  KLR+  L  S  YQ F RDA+E+  W+ EK + A DE+Y++PTN+  K++KH+    E+ AN  RID +   G+ +L  +H  ++ I+++ +E+ K W +L      +   L QA  Q+Q +  ++D ++ +  +E  L +   G DL S   L K+H  LE +     ++I+S + +A       HFD+  I K+ +     +  L++PLD R+ +L     L+ FY D D E +WI E +P+A +TN  R L+G  +L++KH+ +QAE+  H   +  V + G+ M  ++ +  ++++++ + +   W +L+    KR   L+ ++  +Q L D +E E+ + E   LV ST++GK E +T +L+K+H+ +   IE   + +D L++
Sbjct:  920 LPDPHFQKDTIESTQNSLEKDFNRLYNLAQSKNKILEDTARLHRFYNACEEFESWMGDKENVLNT--FSSNSNNLEVVQAKYENFVTELASGRKQLDDITKFGDELLKQQHSRKKDIQQRLGIVTRRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQAEEHRQAQAERDIEALERKIDYLKSVAKMKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETGSDVASAQALLKENLDLKQEIELQKAKLKDMERLGQSLDVASGEKGGKDVQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVDSVHSLLSRQEELEALLEALERSIILFQDKCQELISKRNFAAKEIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLAT-NHFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKS 1758          

HSP 6 Score: 275.789 bits (704), Expect = 2.385e-73
Identity = 247/970 (25.46%), Postives = 475/970 (48.97%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNE--KSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADE-LSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENG--HYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSK---VQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLL----EADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRT---------QADACKMQEA 2928
            +++Q+R EQ++ ++   +E+ ++R  +L  A   +    D  ELE+ + E     S +  K     +S  ++H+ +E +I   +  ++ L  N    +    +  E +    + + +   +L +    + + L+ TL   +F R   E+  W  ++     S + G D E+   L+ +F  F+K LE  +E+       AD L++ + PE   +   +  + ++ + L++L+K R++KL ++ +  KF++D    +  + E  K+IP   ED  +DL  VQ+  RKHEAL  +L   E+++ +L    D  L    P+ +  +Q+ ++ ++  W  L+ +  +R E+L  +   + FL+  +D   W + + + + A+E  +DVA  +  + +H +  +EI +R+E+F    + G+ L+  + P + +I  KL+ L +ER  L   W  R+   E     Q+FYRDTE  E     QE  L+N+D+G ++D VE+LI++HE FEK L +QE+K   L   A RL   G      +++  K   L  R+  +++ +  R+  LE S  + +F RD  E + WI +++    D++  + +NLQ+K   +QKHQ F AEI A+ + I+ V+  G  L+  +H KS++I++ +  L   W  L     V+ K L       +F++ VE +E+W+ + E  +   D G+D      L KK +        D++     I +    A +   +   +   +KK++ +++ R+      L   K KL  A ++H   R+ ++  D   EK  +      G D+  V+NLI++H+ ++ E    + R   +  E +  +         + KK +++K     L  +  +RK+ L +S + Q + A+      W  ++   +      K++   E+ + +H    A+I+A    IDS+++          +DA +++EA
Sbjct: 1667 QEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALVSTDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAV--RVWGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTIP---EDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGLQELQQEVVENWERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQAVSMGQGLLENDIPNAREIQEKLKALQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQERGAALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEA 2631          

HSP 7 Score: 254.218 bits (648), Expect = 9.520e-67
Identity = 393/1836 (21.41%), Postives = 802/1836 (43.68%), Query Frame = 1
Query:  109 VLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPE-QESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQ-LTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELIT--MNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGD--SLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK--LKTASD--ENYKEPTNLQSKVQKHQ-NFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFD-ADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIE---KKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALY---DYQEKNPREVSMRKGDVLTLLNSNHK-------------------DW------------WKVEIN---------DRQGHVPA------AYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWM----TIRESSLLGEDVDDKTVDSLIKKHEDFNRAIN-MQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQEN-----AVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAH 5391
            + ++ S  + +   R ++L +      FKR+  ELE WI ++ Q  +  +   D  N      + +    ++    E ++  ++    +I+++H  S  I+   + L   W++L ++ K++   L+ +    +F + + + L   KE+   +  E+  +DL+ V+   +K    + +L   E++  E+    D +L    PE +  L   +++V +  ERL+   ++R+++L  A +   F         W ++    + +E+  RD+A+      +H+ L  +++A EE   Q ++     L N  P++++ IQ+K +AL      L      R + L+ +Y    F  D   +       +  +   +L   V  VE+L++RH   +  + S+++   + +   E L T  +    + +I NKL+ L + R  +  L  +RR   E +    +F RD  +AE WI  +   ++++   D  +L +   +++KH+ FE  + A     + +    N LV   H  + ++ +    L+     L+++  +R   LED+ ++  F +  ++++ WI +K  +    D  E+Y+    L  K+ + + +   ++  +++ I  +      L   N ++   +K+R ++L++ W +        ++ L  A      +R +E++     E    L    CG D+ SV NL ++H  +E +    Q+R  + L++  +   ++H D +D + KKQ EV    VKL + + +RK +L ++++L  F  +     DW  ++        + ++    ++ I +H   +AEI     RI  V + GQ ++ + H    +I+   +K+DD K +   L    + R++ LD +L+ Q +L  A + ESWM  +E  + + + G      EAL +K       +EA               +M++    D Y ++ + A +   D  +K  + + +RK  +L +  S  K                    W            WK  IN           +  + A      A++K  D M++    + P +  +  + K++++ ++ LLS  + ++ RL+ + QA Q  R   D+ +W+   E V V      G L +V    K +           EK++ L D A      G   A + I+  + ++  +Y  L E    + + LE    + +++R+ ++   WIE+K     T D G  L S+Q + +KH  + +++      +  +      LV+     +  I +    + + ++ L  ++ +    L  ++ +Q FL++   L  W+     ++ S +  K+    EA L R  D        T D              E++++ G  +     G +L K+ H   + + + L+ +    E L +    R+ +L+      ++ RD    + W+    TI ES   G+D++   V++L KK EDF+  +  + + K+  +++   Q V+     Q     K +++L  W  L + M A    L   + +  F  D DE+ IW+NEK      E  K+   ++QA  ++H+  E +LA   E +        R KE+G+ + + +     ++ +R+ ++ + W  L+ K+  + ++LQ+A     Y    +++  WL E    ++   +G     ++ ++ KH    T I    D+ + +       +E G   S  + ER   + +   +V +    R     +  +L    R ++  E W+   +  + +EDYG  +  V +L KK + LE  I A 
Sbjct: 1779 IKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTI-PEDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGLQELQQEVVENWERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQAVSMGQGLLENDIPNARE-IQEKLKALQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQER-GAALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTM---LTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEA---------------QMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAF---SHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVE-VEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLA-DNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFL-RKLD--------TVDL-------------ELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEG--VEALQKKFEDFSEEVGTLGQSKLSTVQKLK-QSVQSADAQQ-----KEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDV-------SRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQ 3551          

HSP 8 Score: 244.588 bits (623), Expect = 8.187e-64
Identity = 226/946 (23.89%), Postives = 458/946 (48.41%), Query Frame = 1
Query:  124 SAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFK-DLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAA-NESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL---RTQADACKMQEAPVSDS 2943
            +    A E+RRK L+ A K Q F   AD+ ESW+  +     +E+    L+ +++  +K    E  + AQ E ++ +D+    +I+ +HY S+ I+ R   +    E++L + K + + L+ +L   +FL    EI  W  EK +    E + +D  +++    K   F  ++     +        D++L    P +  +  + KDV+D  ++L +  K ++ +L +A++  +F R       W+    + + ++D+G DLASV  L +  + L+  + A  EKV  L   A + S++     D IQ +   +++ ++ L +    R E L+    L +F  D  D L W+ D     A  +    +  +++++++H     EI++R     + +  G+ L+   H  S +I  KL  L K    L +    +  L +Q + +Q F  +  Q E W+ +Q+  LE+ D G + ++ EA +RK +  +  L +Q  K + L      L ++ H  +  V+K  +D+      L + +  R++ LE+ +N+ +F+RDA +++ W++ +   A  ++Y K+   +++  +K ++F  E+    +S++  V+   Q++      +S D +++ ++L KLW DL  A K + +NL  A    QF  +++++ IW+ E E  L S++   DL SV  L ++H  LE D++  ++ +    ++    V       D + K+  EV   +  L E  ++R+ +L  A  + ++  +  +   W+ E   +      G  +  ++ +IKKH   + +I     +   V N+G++++   +    ++E+++ ++K++   +     +R+    + +E QQ   +  +AE W+   E  + + ++G+       L+KK + L A I+A     ++L   RTQ +  KM+E    DS
Sbjct: 2640 TMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESW-KDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKLKQSV------QSADAQQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQSERFNALQARRTQREN-KMKEIQRGDS 3577          

HSP 9 Score: 216.853 bits (551), Expect = 2.052e-55
Identity = 142/510 (27.84%), Postives = 273/510 (53.53%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEK 1611
            +I E+   +   + A K+ +  + + L+ A K Q F  +  +LE W+ E+       ++ K+    ++  +K   ++LE+ +Q   + AL K G D+ ++ H  S ++   L+ +   +E LL +  E+   L+   ++  F R   ++  W   ++T   S+++G+DLE VE LQKKF +F +++    +       K    +Q    +Q     K+KD+    E L    K R + L  A E+ +F  D D+   W+NEK + L SE+   DL SVQAL R+HE L+RDL  +EE V++  ++   L  + P  +D++  + + +   W +L +K+ +R ++L  + ++ R+L ++R+++ WL +  +++  +     V  +E ++++H+E++++ID + +  +  KN+G  L+   +  S ++  +L  L    V +++ W ERR  Y+++++LQ   R+ EQAE W+   E+ L   D G+S+  V  L++K ED E  + AQ E+
Sbjct: 3050 EISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKLKQSVQSADAQQ-----KEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQSER 3554          

HSP 10 Score: 184.111 bits (466), Expect = 1.465e-45
Identity = 196/933 (21.01%), Postives = 420/933 (45.02%), Query Frame = 1
Query: 3490 IEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRK----HDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLL---GEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWF 6267
            I   ++ L   ++ L++    + K LED      + ++ ++ + WI +K+  +N  DVG+D    Q+L +K      +   D+      +K +++ AA L + + +E   + + ++++NE W         YK KL  ++++   + +  ++         L+       DV   E L+ RH ++                    E  A +    G     E   K+ LK      +++ +K + +  A  +L++E   RK++L +  +LQL+  +     DW T+++S  +   G   +    +S I +H D+   I+ + D++ ++K F   LV+  H D   IK+  +++      L       R  L     LQ F+  AD+ E W++ +    ++E      + ++A  +K   FE  L A  E++  +    Q+L +        + +++R   +  + + ++  SK + + L+E+ +   +     +I  WL E ++S++  +  KD  ++ + L KHQ    +I A+ +R++   +  D  +         I+ R K +++ ++++    +++   L +A +   F R++ D E W+   ++ V+++DYG DL  V  L K  Q LE  + AH   +Q +     +  ++      D I++++  +   +  L +    R+  LE      +F   +E+E  WI +K    ++ D+G +L ++Q ++KKH     +++        +   GQ L+   +  ++ I ++  GL++  D L+K +  +   L+       F+ +   +E W+ +++  ++S DYG++  + +  L K +T D  LES R + +E +      L +S H  S  +    +++   ++ L + S  R+    +L+ +Y      +  F + A    +W 
Sbjct: 2306 IRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEM--------------------EREARVIQERGA--ALEKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDW-TLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHY--DSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNE-KNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFL-ADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGK-VEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRT---ELENQYN-----FYIFERDARDLQTWL 3202          

HSP 11 Score: 173.326 bits (438), Expect = 3.096e-42
Identity = 192/921 (20.85%), Postives = 432/921 (46.91%), Query Frame = 1
Query: 3280 ANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKL-LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGED--VDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRL-GDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLRE-KLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLES 6027
            A+    W+  +E   + E +  G L  V++ ++K+  F N  + + E++ E+   A +L ++   ++ + I+     +  + E++ E++  + K LE+   +Q++     E   W+ EK++ +   +  KD  ++Q    KH + E +++A   RV+  +      L  +HP +++ I    +++++ W++L +  +  K +L  +    +F     D+  W+ ++   V++D+   D+     LL+  + L                   EE    +DA     Q   D  K+    G++  + I++++  + +    L E    R++ L+    L  + RD E    W+  +  +   +D     +++ S++KKH    + I  +   + A++E    LV   H+    I +K   +   + +LK+   AN+ RL      +Q+F+ +  ++E W+ E+        Y       +A  +K    + EL +   +++++L +G  L EK Q     + V + +  +  +++ L+  S ++  +L+      ++    +D++ WL   +    S DYGKD   V++L  K +    ++           ++  + ++S        ++++K + + +E + +  + RA  L  A+++H F   +D+   W+ EK++ + SE+   DL+ V+ L ++H+ LE ++   E  +   +++G  L+  S     D + ++L+ +E  W  L + ++ R+ +L+++   Q++L    E   W+ E   L++   +G  +  ++ ++KKHD + T +    DK   + N+G++L+++ N  +  +E+R   L++ ++ VL     RR    ED     Q   + +  E W+   E+ ++++DYG  +S V  L+ K E  +  +++
Sbjct: 2666 ADQTESWMSNREAFLINEDLG-GSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDS-DNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNS-VAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSK-IKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGL-------------------EEM---VDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKES-ANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDL-EKSQ-HPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKLKQSVQSADA-----QQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVR-DSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQED-IELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQA 3550          

HSP 12 Score: 169.859 bits (429), Expect = 3.414e-41
Identity = 180/757 (23.78%), Postives = 356/757 (47.03%), Query Frame = 1
Query:   34 MADITLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILE-KIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQE------EKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADEL-SNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLW---NERRVLYEQNM----DLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSF 2256
            M   + P + KI    +D+ +  +Q+L+         + ++ +L+ A +   F+R   ++E W+   +++  +D+   DL ++    +  Q LE  + A  E +  L     D     ++ ++ IQ R+ ++   +  L    + +   L+      QF R +++ L W ++K     ++++G  L+ ++ + KK    M+++E +       ++A +   +  H    +  E+ S + K  D       LK  +  + + L +A +IQ F  +  +   W+ E+   L S D+G++  + +A  RK + +D +L +   KV  L K   +L  ++HP+S   +    E +   +  L + S ER  +L+  Y+ + F  D RDL +WL   K +  +D+  KD+ GVEAL ++  +   E+ +  +S  S   + ++ +      S D   K    +K+   L++LW   N+      +N+    ++  F  D ++   W+ ++E  L++ ++ + L SV+ALIR+HE  E+ LA  EE   R       LV         ++K+  ++     NL EKA  R+  L+ +   Q +  +  E+  W+ E L   + E +     +L+  ++KH  +  +I     + + VKN G+ L++  ++ S +++ER+ EL  L   ++ A   +     +    QQ  R +E  E WL   ES L ++D G+ ++ V +L KK   LEA I +  +R ++ 
Sbjct: 2828 MLAFSHPAKSKIKPRIKDVDDNWDQLLSN-------CKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDA------LKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSH-LVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLGQSKLSTVQKLKQSVQ-----SADAQQK----EKD---LLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQSERFNAL 3558          

HSP 13 Score: 154.066 bits (388), Expect = 2.267e-36
Identity = 205/985 (20.81%), Postives = 430/985 (43.65%), Query Frame = 1
Query: 3511 LQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALER-------DLVALGERVKLLDSKAA--ELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWI-NTMNALVSSDELAKDVTGAEA---LLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRA----INMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKS--------------KDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQ---ERYKKVEE--LYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAH 6345
            LQ++ E+L +    + K LE+ Y  Q ++R+ +  ++    ++ +L  SD+G  +  V+ L ++H+A E+        +VAL E  + L ++    E      N+ + + + +E I ++  K   + ED ++   + I    F  D  +   WI + MN +   D+   D++  +    +L++H+                         AEI A     ++ +  G EL+   H    EI++ + ++    + L +E   R K L+   +   +L+  EQ E W+  +E  +    +GED +      L+KK  +F  +    + + +  ++ +   A +L      +   +K + Q++  RW +   N+ + + +L     + A IR+ +E+     EK+     +       +++   ++H+  E E               + ++E+G  +  E   ++R+ +  D  D L  K               K + E+LQE+++  ++ A  + +  W  +    +      K+    +S + +H     +I A  DRI  +       ++SG  D+  I+E  + +++    + +  E+R  TL +A KL  F    D  E+W+  ++  + +ED G  L  V  L++K    EN + A    +  V++   +L+  +   + D IK++ + +      + ++S  R+  LEES + QKFL+   E  +W+ EK  +     + D +  +Q  L KH +FE ++  + ++      +G  ++  ++     I+ R + + +  D L      +K  L+     LQF      +E W+   E +V +DDYG DL+SV  LL   +  +  +++  +E ++ +           +  +D I+ R   +++R++ L    + R++ L   Q   + Y+ +E+  L++    +A+A   W               SL+ I+++ + H
Sbjct: 2097 LQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGK---RREDLEVSKLHCI----FSRDVSEAEEWITDRMNKI--QDDSKMDMSNLQTKMKMLQKHQVF----------------------EAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHG--QQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNSDELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMERE--------------ARVIQERGAAL--EKETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGHSDAAEIKEALRKLDDAKTMLTRAWEDRRKTLDQALKLQIFLGYADQTESWMSNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHY-DSDNIKKRTKAILLRKERILEISKSRRKALEESLQLQKFLEASYEISSWLNEKNSVAVDESWKDPI-NLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAH-MEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDW-------------GTSLQSIQSIVKKH 3016          

HSP 14 Score: 149.443 bits (376), Expect = 5.592e-35
Identity = 161/754 (21.35%), Postives = 326/754 (43.24%), Query Frame = 1
Query: 3478 AVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDI 5733
            A  KI+  I  +   ++QL      K   L+  Y   ++ R   + +EW+   +  +   D G DL SV RL +    LE  + A  E+V+ L   A +        A+ I Q   E+   +N L    +  +  L +   L +F  D  D + WI       ++ +    +   ++++++H  +  EI NRT        P+                  ++ G+ L++  H+A  EI EKL  +    + L +E  N+ + L Q L++Q +L +  Q E WM  ++  L   D   +++  ++ ++K +  +  +  Q  K++AL +    L + +H +   +    +++   + +L +     R+ L +      F RDA +++ W+  +      + Y      ++A  +K + F  E+       QS L + Q+LK+  Q        +++   L   W+ L    K ++E L  A     +   L ++  W+ E E +L S +   D  SV +L+ +H+ L  D+   E+ +    E     +       D++ +R + + E +  + + A  R   L +A+ +  +     +   W++E   L++ E +G  +  +  + KKH     +I       + V+  G  LM E   +   E++ +L  L+   V + +  + R+ + +E  E Q+    +E+ E W+   +  L + DYG++++ V  L+KK +  E  ++   ++ N +
Sbjct: 2835 AKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRT--------PL--------------IMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKSQHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDFSEEVGTLG---QSKLSTVQKLKQSVQSAD----AQQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWMNEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLKETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGN-SWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRAEDYGESVSDVLDLMKKQEDLEAMIQAQSERFNAL 3558          

HSP 15 Score: 148.288 bits (373), Expect = 1.180e-34
Identity = 208/967 (21.51%), Postives = 437/967 (45.19%), Query Frame = 1
Query:   46 TLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK---IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQES--LINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADEL--SNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDS-HNYQLFDRDAD-EIKAWIVEKLKTASDENYKEPTNLQSKVQ---KHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEI-WLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD 2907
            TLP      +T E  Q   E+  NR     ++   + K LED  +   F    +E ESW+ +K   + T+S  +     NL+    K++    E+A+  + L+ + K G ++++  H   + IQ RL  +   WE++  +  E +  L  + D   FL+   E+    + +   + + + G     ++  + +  +  +D+E  E K    Y K+   +++D    ES  ++ +   +ED L +LK  A +RQ+ L EA  +Q F ++T   + W       L  E+ G D+AS QAL +++  L +++   + K+  + +    L  ++     KD +Q     L   WS L K    RN +L+      +   +   + + ++  +A +   +L   V  V +L+ R  E ++ +++ + S    +++ +ELI+  +  +++I  + + +      L +    RR+    +   Q F RD E+   W+ ++    E+    D  + +  L +KHE  EK + A   +  RL     +++ + HY    + KK  ++  R   L+ K   R   L  +    QL +   D ++K   +E++     +N     +L+S  Q   +H+    E      +I+ +  R +NL  +NH  S+ I +  +   KL+  L      +   L        F  +V D+E+ W++E +    + +  + L    +L +KH  L+A++++H   +   L +         ++   ++++  ++  ++ +L+E   KR  +LN A    Q   D  + E  + E   +  ST+ G+  +  ++LIK+H+ ++ +I     ++ E+ +  ++ +    +   ++ K  + +K+  S+L++ A  R+Q L ++L   ++  + SE E W+ ++  +  S + G D ++   L  + +  +  +E  +  + +    AD
Sbjct:  919 TLPDPHFQKDTIESTQNSLEKDFNRLYNLAQS---KNKILEDTARLHRFYNACEEFESWMGDKENVLNTFSSNS----NNLEVVQAKYENFVTELASGRKQLDDITKFGDELLKQQHSRKKDIQQRLGIVTRRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQAEEHRQAQAERDIEALERKID--YLKSVAKMKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETGSDVASAQALLKENLDLKQEIELQKAKLKDMERLGQSLDVASGEKGGKD-VQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVDSVHSLLSRQEELEALLEALERSIILFQDKCQELISKRNFAAKEIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDPTNILRKL-KKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERML----QNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLA-TNHFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDV-DLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAVRV--WGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLAD 1865          

HSP 16 Score: 136.346 bits (342), Expect = 4.470e-31
Identity = 181/856 (21.14%), Postives = 383/856 (44.74%), Query Frame = 1
Query:  367 DMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTL----DYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEA---HEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNE-------------RRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFE---KSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASD----ENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDAD-GIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDAL 2850
            ++I   ++A++ IQ R   +   +++L    KE  +L +L L     Y +FLR  +E+L W  EK      E + +D  ++    KK     K+++    +   +    + +L +D    +S+  K ++V      L+    +R  KL +A    ++ +  +D    I  +      L +   G DL S + L ++H+ L+ +   L EK+N +   A  L+  H DS+  +++  +  L  +  L+K    R  QL+    L+ F  D    L+W+++ + V       + + G  +L+++H + ++E+++  +  +   + G  +   N    +++  + E+       LI  W E             R V  EQ         D  + E  +++  A + + D G +  +  +LI++HE  E   + LAAQ ++ +     A R+     +   ++NK  + +  + S L+  A +R+  L ++ +   F R+  E++ WI ++ + A+      +Y+    L+ + +    FL ++   + R+   +     L+ SNH +S  I+E    L + W++L   SK +++ L ++    +F +++ D    + E    +  +D  KDL  V +  +KH  L  +++  + ++   L   D  +     +   G+++ Q EV   + +L+  +++R+ +L  A   + F   A D   W  +      +    RD+      + +HQ + AEI+  E    +  + GQ ++  D    R+I++K+  ++     L +    R++ L+++   Q +  D    E     +E  + +++ G   D  E+L+K+H+A 
Sbjct: 1341 ELISKRNFAAKEIQQRSKVIQDHFKRL----KESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESY-RDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERM---LQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLATNHFDSQRILKE-TDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQ-------LIAKWEELEESCKKRSGELNRAVTREQ------ILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQAVRV-----WGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEV---FLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTIP-EDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGLQELQQEVVENWERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQAVSMGQGLLENDIPNAREIQEKLKALQEEREKLSDNWQLRQKWLENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAF 2164          

HSP 17 Score: 100.523 bits (249), Expect = 3.610e-20
Identity = 219/1039 (21.08%), Postives = 434/1039 (41.77%), Query Frame = 1
Query: 3490 IEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNT-SDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAEN-EIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLAR----WGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIE---FWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLET---AWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEG-IEVITSLHNQLIESNHAQSDAIKHRYQNLMDRW--DKLQRESKRRKDHLLKLQE----RYKKVEE-LYL-TFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQL-DKEIQSYGVGGNPYTWFTMEA---LEETWKNLQRIIQERDAEL 6525
            IE     L+K + +L  +   K K LED   + R++  C+E + W+ +K+  LNT S    +L  VQ    K++    +L +  +++  +     EL++   +  + I Q    +   W ++    ++   +L +S D++ FL   +++ + +    A + + ++    +  +A  E HR    E                     +I+A        +   K + K    AE+  I E++ ++ D   QL  + + R++ L++   LQL+ ++      W    +  LL E+   D  +  +L+K++ D  + I +Q+ K++ ++     L       + G KD  Q+ L +    W  L +   +   RL      Q    +AD +E  I+            D   ++ +   + +  EA L A    +       Q L  K     +E  +++R   + D +  L    K +  +L  + +   Y   L+D E    W+ E +  ++  +  +D  ++   L KH+    ++ A+  RI  L E  ++ +     ++ +I+++ + +++R+ ++++    R   L +A +       + D +  I   + ++ +   G DL   R L K+H++LE E       I S+  +   L       N  + +R L+  +T    +  L++    R+++LE   +   F   V+ E  WI E Q +  +T+Y  +L     LL+KH   + ++  H      + + G+ +   N  N + ++QRCE L  K + L ++  +R   L       Q +     +E+ +++    V S DYG+   + ++L+ +HE          +EG IEV+            AQ D +K   +  +  W  ++L +     K  L +LQ     R +++ E L+L  F ++ S    W     +        +  E    L      F   L+  +E      QL DK I+S     +P + F  E    L E+W  LQ + ++R  +L
Sbjct:  930 IESTQNSLEKDFNRLYNLAQSKNKILEDTARLHRFYNACEEFESWMGDKENVLNTFSSNSNNLEVVQ---AKYENFVTELASGRKQLDDITKFGDELLKQQHSRKKDIQQRLGIVTRRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQA--EEHRQAQAE--------------------RDIEALERKIDYLKSVAK-MKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETGSDVASAQALLKENLDLKQEIELQKAKLKDMERLGQSL--DVASGEKGGKD-VQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVDSVHSLLSRQEELEALLEALERSIILFQDKCQELISKRNFAAKE--IQQRSKVIQDHFKRLKESCKLRRLELLASKK---YQEFLRDAEEMLLWMDE-KFEIAEDESYRDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLAT-----NHFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALV-STDYGKTELATRSLIKQHEG---------VEGQIEVLA-----------AQVDELKSNVKQAVRVWGLEELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKS----NHPESRFIRETQNLLRESWDELQDLSKDRKEKL 1903          

HSP 18 Score: 96.6709 bits (239), Expect = 4.779e-19
Identity = 84/334 (25.15%), Postives = 155/334 (46.41%), Query Frame = 1
Query: 5044 QVLGTDIHAHEDRIKDLNERADEFIESGTCDS--DTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIE 6039
            + LG D+ AHE R + L+E A   IE     S    IR    ++N R++ +KQ+ + +   +G A       R I+     ++E +    S D G+ L  V  L +K   ++ +I +    + ++       +         +++R+L+ L + +  L  LS  R+  LE   +  +F    EE EAWI EK  LL +   G  L+ +Q  ++ H A E +++  E  C+ +   GQ+L    + N   I++    L+++   L++    RK+ L   +   Q+        SW+ D +  +  +DYG+D +S   LL +H+  +  +E++  E
Sbjct:  440 EALGADVLAHEPRFRALSEMA-AVIERDNYHSKVQVIRRNVDIMN-RWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSSALKVKHK---GATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSE 768          

HSP 19 Score: 90.5077 bits (223), Expect = 3.743e-17
Identity = 72/316 (22.78%), Postives = 154/316 (48.73%), Query Frame = 1
Query:  109 VLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDEN--FKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDK 1050
            ++NR+   K+  +E+R  + DA       RD  EL S  L+++Q  +D +   K L ++ +  QK   ++ +I +  E LNA+  +    ++  H  +  +Q  L  L++ +  LL + K + + L+  L   +F    +E+  W  EK   + +   G+DL  ++   +       +++ QE   + +  +   L +   P +  +    + ++   ++LK     R+ +L  A+ I+++F D  +  SW+++    L  ED+G+D AS  AL ++H+ +++++ A   +V +L + A   +   P + +T Q +
Sbjct:  481 IMNRWKDLKQVLQEQRAHVGDAANTFAVLRDI-ELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSS--ALKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQAKSAAQLAPLTTETQQTR 793          

HSP 20 Score: 80.8777 bits (198), Expect = 2.637e-14
Identity = 88/372 (23.66%), Postives = 171/372 (45.97%), Query Frame = 1
Query:  184 QYFKRDADELESWILEKIQTYSDENFKDLTNLQSKN---QKHQALELEIAAQSENLNALDKNGYDMIE--NHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELS-NKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDS 1281
            Q F R A   ES++ + +Q    ++   L  L+      ++ +AL  ++ A      AL +    +IE  N+H   ++I+  +D ++  W+ L  + +E+   +    +    LR ++ I    KE +    S + G+ L  V  L +K +     +    E    I S +   L+        +  + KD+      L  L+K R++ L    ++ +FF D ++  +W+ EK + L +   GRDL+ +Q   + H+AL+ ++ + E   + +     EL   +HP+  D IQ     L   W  LK++   R  +L  +  + ++ +D  +  SWL D K ++  ++  KD A   AL++RH   + E+++
Sbjct:  398 QKFGRKATLRESYLEDTLQLIQQQDLGGLQRLEEAEIAARRLEALGADVLAHEPRFRALSEMAA-VIERDNYHSKVQVIRRNVDIMNR-WKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSS--ALKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNEND-IQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEA 764          

HSP 21 Score: 80.4925 bits (197), Expect = 3.252e-14
Identity = 72/271 (26.57%), Postives = 130/271 (47.97%), Query Frame = 1
Query: 1465 RDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK---LKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQA 2268
            RD E     + + +A  +++D+G  L  V AL++K +  +  + +  E    + + +   V+  H  A  V ++  DL    ++L   +K R+ +LE       F  D +E++AWI EK   L+ AS    ++ + +Q  +Q H+   AEI + ES    V  RGQ L    H    DI++ I  L K W  L     +++  L  A+  +Q+  ++ +   WL + +  L  +D GKD  S T L ++H  +E ++ ++   +    +QA
Sbjct:  510 RDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSSALKVK--HKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAAS--LGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQA 776          

HSP 22 Score: 77.411 bits (189), Expect = 3.103e-13
Identity = 108/490 (22.04%), Postives = 216/490 (44.08%), Query Frame = 1
Query:  517 VDEILFWTKEKETFVTSEEFG---QDLEHVEVLQKKFNEFMKDLEYQEEKAAEIY-----SKADHLLQEDF--PEQESLINKKKD------VEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFG--RDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRI 1929
            V ++L W K K   +    F    ++++H+    KK+    K  +YQE  A E +     +K     Q D+  PE ++L + +++       E   ER+   A  R ++L +    QKF R      S++ +    +  +D G  + L   +   R+ EAL  D++A E +   L++ A  +   +  SK  +  +   +++ W  LK+   E+   +  + +    L D   +   L +++A   + ++ K +  V AL+++ +   ++I S  E+  +  +     + + H  +  +  +L+ L+     L+ L   RR   E  + L  F+ D E+ EAWI ++   L+   +G  L  ++  I+ H+  E  + +QE     +      L    H    D+ K    L  +   L+E+  +RK+ L  ++  + +  D  E  +W+ +      DE+Y K+  +  + +Q+HQ    E+ A  S +
Sbjct:  284 VSDLLRWIKTKVVELNDRSFPNSLREMQHLVAAFKKYRTIEKPPKYQERGAIEAHLFDLRTKLRANNQRDYIPPEGKTLGDIERNWTLLERAEHQRERVLQSALMRLEQLEQL--AQKFGRKATLRESYLEDTLQLIQQQDLGGLQRLEEAEIAARRLEALGADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNRWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSSA--LKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEV 769          

HSP 23 Score: 62.003 bits (149), Expect = 1.639e-8
Identity = 48/224 (21.43%), Postives = 106/224 (47.32%), Query Frame = 1
Query: 2212 LEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCN--EGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRS 2877
            L AD+ +H+ R  +  + A     + +     + ++  ++ NR+  L++ L +++  + DA       RD +     + E +  A S+++G+ L  V  L++K   I  +II     + E  N       +   H     +++++ D+ + ++ L   +  R++ L+  L+  ++  D  E E+W+ EK  L+ +   G+D    +  ++ H AL A+I++  S
Sbjct:  442 LGADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNRWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIIS----LGETLNAISSSSALKVKHKGATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQES 661          
BLAST of Spectrin alpha chain vs. Ensembl Zebrafish
Match: sptbn1 (spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-031006-3])

HSP 1 Score: 437.573 bits (1124), Expect = 1.117e-123
Identity = 291/983 (29.60%), Postives = 523/983 (53.20%), Query Frame = 1
Query:   34 MADITLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFK-DLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKS-IPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIV--NKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSS-------LEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYG 2949
            MAD     E KI E   D+Q +       ++A ++    R+ +LE+A     F+ DAD++++W L+ ++  S  +   D  + Q+  +KH+    E+A+    ++AL +    +      ++ + + RL  +   ++++  + + + + L+  L   +     D    W  EKE ++ S E  + LE +EV+Q +F     ++  Q  + A +   A  L+    P ++ +  ++  +     + ++L  ++++ L  A  +Q +  D ++T SW+ EK+ +  ++++ G DL  V AL+RK   ++RDL A+E K+  L  +AD L+ +HPD    I  +   + + W  +K+    R E L  +  L +FL +  D  SWL+  +  IA++++   +A  E L+ +H   K+EI++ +E ++  ++ GE ++T +   ++ +    +L+ LD     L ++W  R+ L  Q+   Q+F RDT+QAEA++  QE  L + ++  +L+  EA I+K EDF  ++ A E+K        N +VE G   A+D N   D +  R ++++++ K  + +       L+D+ + Q F +D  E+  WI EK+ TA D +Y E  NL SK  KHQ F+AE+ +N+  +D ++  G+ L+         +KE++  L K+W +L + ++ K + L  A+  + F ++  D++ WL  +E Q+ SDD GKDL SV  L KK  +LE  +   Q  ++    QA   + ++  D D +  ++  V  ++ +L +PL KRK  L  + ++HQF RD +DE  W+ E+ P+A ST+ G +L  VQ LIKK+Q +Q EI GH+PR  ++    Q ++ AD      I  ++ D++ +WS +  + +KR   L+++ +AQQY  DA+EAE+WM E+E  + S E  KDE S+ A+LKKH  L   +E Y  T+  L   +        P S+  G
Sbjct:  625 MADAGHFGEAKIRERIADVQAQ-------WAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQANSANVSE-RLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGE-MVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKI-------NGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQA-HVLRQEGKDTDEVDGRRKVVEQKFQELLDPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIG 1590          

HSP 2 Score: 291.197 bits (744), Expect = 2.797e-78
Identity = 353/1664 (21.21%), Postives = 744/1664 (44.71%), Query Frame = 1
Query:  535 WTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELS----NKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHN-YQLFDRDADEIKAWIVEKLKTASDENYKEPT-NLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQL-ASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHY--AHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMAD-----------IEAYRSTIDSLRTQADACKMQEAPVSDSYGK------ETVMALYDYQE-----KNPREVSMRKGD-VLTLLNSN-------HKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQ-KNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEI---KEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRE----SSLLGEDVDDKTVDSLIKKHEDFNR-AINMQEDKMQALKEFADQLVEHEHYDQDGI---KDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLE 5373
            W  E +  V+ + FG DL+ VE   KK      D+   EE+   + + A  L  E++ + + +  +K +V    E L  L K R+Q+L     +Q+ F++    + W++E  + L S+D+G+ L  V+ L +KH  ++ D+    ++V  +  +A   +       P     I+D+   +   +  L + + ER  +L+ S  L +F  +  +   W+ + + ++++D+  KD+ G   L+ +H   + E+  R    +    EG+ +    H     I  ++  +  +   L QL + R+   E+   L  F  D +  + W       +   DVG    S +AL++KH+D    +A+       L   A  L       +A+V+++   +  R   + E  +LRK +L+D+   Y++F  +AD  + WI EK +  +     E   +L+    + ++   E+    SR+  V    + L+ S H   +DIK + ++L+  W+        K+++L  A G Q +  +  + + W+ E    + ++ + G DL  V  LQ+K   +E D+++ + ++     +AD+   E    A  I  +  E++  + +++E L  R+  L +A KL QF R+ DD + W+   +    S ++   L   + L+ +H+ I+ EI  +E    ++ + G+ M+  D     +  + +++  +   W++L    + R+ LL  S   Q +L D  +AE+++  +E ++  TE     +  EA +KK +  M             +EA R         AD  + + A + D + K      E +M L D ++     ++ +E+S+   + +LT  + +       H  W K +    +      ++ K++     +    PE   V  ++   L+  +  L +  + +   L D+ +A    +   DL +W+V  E   +        L +V    KK     N+ + ++ +++EL+ +A+ L++ G+    ++++G    +++K+++L +   ++   L     + +++R+ ++   W+EE+     ++D G +L +VQ L +K+  L++++     R   +  ++  +++      EGI     ++  +W+ +  + E    +L  +   Q++  D  +  +W++     + S+E AKD   + A+L++H+ L   +                E +AE      T        + L+   H     I   + ++  +    + L+EE   R+ +L++   L    R+ +  E W+  RE    S  LG+D +  T+  L ++  +F R   N+ ++++  +   AD+L+   H D   +   KD   E    W  L E +      L     L  F  DA E+   I +K +   +E  +D  T ++   + H  FE ++ A   +++ +     RL +      + + ++ R  ++ + W  L+   + +  +L +   +  + + ++D+  W+ +V   + + +  +D +SV+ L++ HQ +  +I A  D      E     +      S+ I+E+   + ++ + +    E+R   L    ++H F R     EAW+  ++  +SS + G+ +  V  L K+H+  E
Sbjct:  358 WLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFAVDEEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPE-QANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFS-EADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGE-MVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLE-GQIQSDDYGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGKD--TDEVDGRRKVVEQKFQELLDPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAV----------------EDYAE------TVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEE---RRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTM--LQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEA---WADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKLPEELGRDQNT-VETLQRMHTTFEHDIQALGTQVRQLQDDAVRL-QSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAFE 1983          

HSP 3 Score: 243.817 bits (621), Expect = 8.057e-64
Identity = 226/994 (22.74%), Postives = 479/994 (48.19%), Query Frame = 1
Query:   43 ITLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFK-DLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDM-IENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLL--QEDF-PEQESLI-NKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKT--ASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDAD--GIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKM-----INADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQL--LDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDED-STEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMAL 2970
            + +P+E K++       ER E+  +           R++KLE   +   F R A   E+W+ E  +  S +NF  DL  +++  +KH+A+E +IAA  E + A+     ++  EN+H    I   R D +  LWE LL + K + + L++ L   +  + +  I+ W  E +  + S+++G+ L  VE L +K      D+  Q ++   + + A      +E + P    +I ++   +E   + L  LA +R+ +L E+  + KFF +  +   W+ EK   L+S+D G+DL     L  +H AL+ ++      +    ++   +++     +  I+++   + + W+ L++ +  R  +L+ + SLH+F +D  D+ +W  D   +++  ++  D    +AL+++H +  +E+ S      +   + + L       S ++  +L  +++    + +L   R+   +  + L   + + +  E WI ++E +L + ++ + L+ +E +  + E  E  +  Q  +   ++ IA +L+ +GH +  D+  ++D L  R S   +    +K SL  +   Q +  D +E K+WI EK K   ++ E   + T + +  +K      ++AA E+++ D++     L   + ++++ I  R+ E+  +W ++    + +E++LG+AS  QQF+R ++D + WL+  ++ +AS+D    L     L  +H  ++ +I+++++     ++   + V +   DA    ++++   +   + +L +  + R+  L+ ++    F RD    E +++ +E +   T +   L G +  IKK +     +  +E +I  V   G+++     INAD    R     IDD        KN+    + L  L D+ + Q++L D  E   W+ EK  ++ + +   DE  +  +   KH A MA++++ +  +D +  +     + E P +++  KE + AL
Sbjct:  301 VYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARR--FDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRIT-ARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFAVDEEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPP-EQANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQK-MRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQER--AASIDDRHK-----KNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQL-VSEKPETEAVVKEKLAAL 1279          

HSP 4 Score: 240.736 bits (613), Expect = 6.119e-63
Identity = 169/513 (32.94%), Postives = 268/513 (52.24%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDL-EYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHP-DSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEK 1611
            E I+ R   +   +S   + TE+R  +LE+A K Q +  DA E E+W+ E+ +   S+E  KD  +  +  +KHQ LE  +   +E ++ L K    ++  +H  SE I  R  Q+  L+  L ++ +E+   L+      Q  R VD++  W  E+E    S E GQD EHV +LQ++F EF +D     +E+   +   AD L+     +  ++   K  + +A   L  L   R Q L  ++E+ KF+ D  + +  + +K   L  E+ GRD  +V+ L+R H   + D+ AL  +V QL  DA  L + +  D  D IQ ++  +L AW  L +    R  +L  +    RF S  RDL+ W+ D+  +I   E  +DV+ VE LM  H   K+EID+R++SF +C   G+ L+   H  SE+I  KL +L  +R  +I  W +R       +++  F RD   AEAW+  QE +L + ++G S+D VE LI++HE FEKS A  EE+
Sbjct: 1481 EGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAFEKSAATWEER 1992          

HSP 5 Score: 231.876 bits (590), Expect = 3.388e-60
Identity = 213/931 (22.88%), Postives = 441/931 (47.37%), Query Frame = 1
Query:   46 TLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTY-SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFV-TSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDT-IQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLD----KERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVG-DSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQ-QQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKD 2808
            TLP E        ++ ER   +  RY    E T  R++ L+DA        +AD  E WI EK Q   S E  + L +L+    + ++LE E+  Q+  +  +++    +I + H + + I+ + D+L+  W +  ++  +K   L   L    +    +E   W +EK   + +++E G DL  V  LQ+K     +DL   E K  ++  +AD L  E   + +++  +  ++    E +K   + R++ L EA ++Q+F R+ D   SW++     + SED    LA  + L  +HE +  ++   EE   ++    + ++    D++   ++ + +AL + W+ L K    R   L  S++   FL D +   ++L + + V+A  E+   + G EA +++  +  + +D+ ++        G  L +  +  ++ I  +   +D    K R   ++L     +  + N DLQ F +D ++   WI   E  L   D+  D   ++ +   KH+ F   L + +E   +++    +LV       A V +K   L    + LE   + +   L D++  +LF +   ++  W+V  + +  SD+  K+ T++   ++K Q    ++   +  +++++++  ++L      ++++  R + +++ + +L+    +K KN   AS +  QF R+VED  +W+ E      S D G +L +V  L KK+  L+ +I  HQ R D   +++   +     + +GI+ + +++   +  + +  +KR  +L +A+K  Q+Y DA + E W+ E+E    S    +D      ++KKHQ ++  +  +   + ++    + ++ A+H     I  +   +  +++ LK+ +++R+  L++     Q   +  + E W+ E+E + GS E G+D
Sbjct:  730 TLPPEQA---NSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELL----MRLKDNRDLQKFLQDCQELSLWI--NEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQA-HVLRQEGKDTDEVDGRRKVVEQKFQELLDPL-LKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQD 1649          

HSP 6 Score: 229.565 bits (584), Expect = 1.788e-59
Identity = 220/897 (24.53%), Postives = 398/897 (44.37%), Query Frame = 1
Query: 3523 YEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELV----QTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWM--TIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSL-SSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADK--ETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLL 6186
            +E L E+   + + LE   ++QR  +E     +W++E    L + D GK L  V+ L +KH  +E D+    +RVK +++ A           P + + I      +   + +LT  A + + +L  S  L KF  +  +   WI     ++SSD+  KD+TGA  LL +HR L                        E+  RSG  Q+    G+ +   GH+ E +I+E++  +      L +    RK +L++   L  +  D +  + W    +R  S      D+ +  +L+KKH+D +  +      + AL E A Q +  E  +   + ++   +  R+  + E     +  L D   L     +AD  E+WI+EK Q        +   +++    + ++ E E+   A R+  +    ++L   G     E  ++ + +KL  +W    +    K E L  A     Y+    + + W+ E    + S+ + G D   V +L  K   +  D+ A E ++ DL   AD         +  I  R   I   +E++K+    R  +LG+A KL  F R +DD ++W+   +  ++SED    L     L  +H+ ++NEI+ +E   Q +   G  +  +   A    ++++L+ L+T W EL ++   R+  L +S  YQ FL   ++ EA++  ++++L+ T+   TL   +  +KK + F T M  +EDK N +   G++L  D N NA  I++R   + ++    R+AA+     L+DN    +F+     +  WI +K    Q  S D  R+L S      KH+ F   L+S + E ++ I     QL+         +K +   L   W +L+  ++ +   L 
Sbjct:  431 WEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFAVDEEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRAL----------------------EDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQA-QTLPPEQANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGH--PSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSK---WLKHQAFMAELQSNK-EWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLF 1298          

HSP 7 Score: 225.713 bits (574), Expect = 2.510e-58
Identity = 205/920 (22.28%), Postives = 441/920 (47.93%), Query Frame = 1
Query: 3484 EKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQT-HPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALV-SSDELAKDVTGAEALLER----HRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDS--LIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDG-IKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTT--NIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSA-SVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYK 6207
            E++ GI    +++Y+++ E+T  + + L+D  A+ +   E D  + WI+EK+  LN+ ++ + L  ++ +  + ++LE ++     RV +++  A +L+ + HP+E + I   Q+++N  W++     +  K  L +++ +Q +  D  +  SWI     ++ S+ EL  D+TG  AL  +     RDLA  I  + GD   + + +  EH  +  A +G                         +L  I    E++ E    R++ L +  +LQ +LR+ +  + W++  ++++  ED+ +   ++  L+ +HE     IN  E+  Q +++  + + + +   Q   ++ + Q +   W  L +     ++ L      Q F+RD  + E ++N   Q  +    + PTT    +A  +K + F   + AN +++  ++ +G+RL   G      + ++ER   + D+       + +   +L++      +    +++  W+ E    L++ D   D A ++ S   KHQ    ++ ++++ +  + +   + +         ++E+   + + + +++   + +A  L  A K   F ++  D + W+   +  + S+DYG+DL  V  L KK Q LEN++   +  ++ ++ Q H L  E +  + DE+  + + +E  + EL      RK  L  S E  +F   VE+E  W+ E+  L +STD+G+ L  VQ L+KK+   + +++ H+ +C+DI    Q ++  ++ N + I  R   L+    ++ +   +R   LE+     Q+ +     E+W++++E  + S++  +D  S   +L KH+  +  +E +  E +  ++     L+ +NH +S+ I  R   +   +  L+  S+ R+    KL+ER++
Sbjct:  743 ERLAGI----EERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKD-IKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAA-IEAKLGDLRGEADRLAGEHPDQAKAITG-------------------------RLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNN--QEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINA--DRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINE--KMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGK--DTDEVDGRRKVVEQKFQELLDPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDY-AETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRG---KLEERFR 1619          

HSP 8 Score: 195.667 bits (496), Expect = 3.238e-49
Identity = 199/911 (21.84%), Postives = 414/911 (45.44%), Query Frame = 1
Query:  145 EERRKKLEDAKKYQYFKRDADELESWI--LEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQD-LEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKK-KDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASD----ENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFD-ADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDAL 2850
            E R+  L  +  YQ F RD  + E+++   E +  ++ E    L   ++  +K +     + A  + +N + + G  +  + +  ++ IQ R   +    +K      E    LK   D  +FL+   E+  W  EK   +T+++   D   ++     K   FM +L+  +E   +I  +   L+ E  PE E+++ +K   ++     L+   + + Q LF+A++ + F +       W+      + S+D+G+DL SV  L +K + L+  +   + +V +L   A  L  +  D+ D +  +++ +   +  L    ++R   L  S  +H+F  D  D + W+ +   +  + +   ++  V+ L++++   + EI              + ++  + P  E I  +L  L     +++Q   +R    E+    Q +Y D  +AEAW+++QE ++ + +      S  A+++KH+  E+++    E   +L   +  LV   H  +  +  ++  +    + L++ ++ R+  LE+       +R+ D+++ WI E+   A      ++Y+  T LQ + ++       I   + R+D V      L+++ H  +  + E  + L++ W DL+     + + L  +    +F  + +++   + +   +L  ++ G+D N+V  LQ+ H   E DI +   ++      A +       D AD I++++ EV   +  L E  + R+ +L D     +F+    D   W+ +   +  +    RD+  V+ L+  HQ I+AEI             G+ ++   HYA  +I++K+  + +   D+ +K + R + L   LE  Q+  DA  AE+W+  +EP + S E G+  D  E L+K+H+A 
Sbjct: 1080 ENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHT-EMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEK-PETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGKDT-DEVDGRRKVVEQKFQELLDPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIG--QERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAF 1982          

HSP 9 Score: 183.341 bits (464), Expect = 1.782e-45
Identity = 201/978 (20.55%), Postives = 444/978 (45.40%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILE-KIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDM-IENHHYAS---EIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQN-------MDLQLFYRDTEQAEAWIAKQEAFLENN-DVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNL---QSKVQKHQNFLAEIAANESRIDDVKNRGQNLL-DSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAG--STNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVM 2964
            I  R++ VL  +    E  + RR++LE     Q   ++   +  W+ E K+   S +  K L  ++   QKH  +E +I  Q++ + A++ N     ++   Y     ++I+ R+  +   +++L  +  E+   L+ +    +F   + E   W +EKE  ++S++ G+DL     L  +      ++  +         +   +       +  +  +  DV+     L+ LA  R+ +L EA  + +F  D D   +W  +    +++ D G D  S QAL +KH+    ++ +    ++ L + A  L  +  +S + + ++   +   +  + + +  R + L  + +L++  S+      W+ + +  + + E+ + +  +E +  R    + E++++            +LI   HP  +DI  + ++L+         W++ R L +Q        + +Q ++ D  + ++WI ++   +E+  ++G+ L  V AL RK    E+ LAA E K   L   A+RL       A  +  +  ++      ++E  + R+ SL ++   Q F R+ D+ ++W+       + E+   P  L   +  + +H+    EI   E     +++ G+ +  D    +   +++R++ LD  WN+L    + ++  L Q+   Q F+R+ +  E +L   E  LA  +    L       KK       + +++D+I+  ++   +   + + +AD I+++   + +R+ K +E   +  ++L D   L +F +D  +   WI+EK   A   S +  R+L    +   KHQA  AE+  ++  + ++  EG+++++        +++K+  ++ +W++L+     + Q L D+ +A+ +    ++ + W+   E  + S ++GKD  S   LLKK   L   +E  +  ++ L++QA   + +     +  G+  V+
Sbjct:  420 ITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFAVDEEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQANSAN-VSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTR-------WSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDM--PNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNL---HSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGKDTDEVDGRRKVV 1384          

HSP 10 Score: 163.696 bits (413), Expect = 2.090e-39
Identity = 217/943 (23.01%), Postives = 414/943 (43.90%), Query Frame = 1
Query: 3259 AYQL-VREANDLHQWVVEKELV-AVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKD-LTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQ-EEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDL--AVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDW----MTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEK-LQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSE----KLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDI-HAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWI--REKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFL-------QFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFD 6012
            AYQ+ +R+      ++  +E V A TE+  P  LE  ++  KK ++F+      E+KI  + +   +L   G   A ++I+     +  ++++  E     +  L+D   +Q++ ++C E   WI EK   L   D+  D   ++   + KH A   +L +  E +  ++ +  +LV   P E E +V+ +   + +MW +L T  +     LF++   + F     DL  W+  +   + SD+  KD+T    LL++ + L   VE+  R  +    Q  +  +   + D   G  +  E   +ELL                         +  L RK  L    E+  + RD E    W    M +  S+  G ++  +TV  LIKK++   + I   + +   + E +  +++ +  + +GI+ +  ++   W  + +      SRL +    Q +  DA E E W++E+ L    +E  KD  +++ A  +KHQ  E  +   AE +  +  + + L      +   +   ER+     Q D L    KD SE    KL+E  R    N  + D+E W+ E E    S + G+D   V  L  + +    D  +  ++R+  +N  ADE I +G  D+ T+ E K  +NE +  + +L + R   L  + +LH FY    +    I  + KK+    E+ GRD   V  L++ H   E++I A    ++ ++     L +       D+I+R+   +  AW  L +    R+ +L ++ +  +F   V +   W+ +   L+ + +    +++V+ L+  H   + ++    D        G+ L+   ++ ++ I+++   L +K    RK  + +    ED   +L       QF     V E+W+  +E  + S + G+ +  V+ L+ +HE F+
Sbjct: 1091 AYQIFLRDTKQAEAFLNNQEYVLAHTEM--PTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINA-DRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKP-ETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGKDTDEVDGRRKVVEQKFQELL-------------------------DPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHGNNL--QTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSV-AMLKKHQILEQAVEDYAETVHQLSKTSRGL------VAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKL---PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDK----RKDMIDK---WEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAFE 1983          

HSP 11 Score: 160.999 bits (406), Expect = 1.135e-38
Identity = 160/657 (24.35%), Postives = 289/657 (43.99%), Query Frame = 1
Query:  985 LTK--DADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVER---NEQLDVSYSLHRFLSDY----RDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNH---------------PLSEDIVNKLERLDK---ERVILIQLWNERRVLYEQNMDLQL---FYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNL-LDSNHNKSED---IKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDAL 2850
            LTK  D +++S  HPD K  I          +S +K   VE     + LD +    + +  Y     DLL W+     ++   + A  + GV+  ++  N +++    +   F    N    L T+                  L  DI    ERL+K   ER + +     R  L  Q    QL   F R     E W+++ +  +  ++ G  L +VEA  +KHE  E  +AA EE+ Q +  +A  L    ++    +  ++D++L     L E  K R+  LE + + Q   ++   I  W+ E K+   S +  K    ++  +QKH    A+I     R+  V N  Q   +D    K  D   I++R+  ++  + +L   +  +   L ++    +F   + + E W+ E E  L+SDDCGKDL     L  +H  LE ++S     +   +++     D  HF    I+++  +V  ++  L++    RK +L +A  LHQF  DADD + W  +   I  + +VG D    Q L+KKH+    E+  + P +++  +E  + +  +     ++ +++  ++  + ++      RKQ L D+L   +  ++A   E W+ EKE  + S E  +  +  E +  + ++L
Sbjct:  168 LTKLLDPEDISVDHPDEKSVIT-YVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTV--EKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELAL-----RTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFAVDEEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRP-VIDALHEQAQTLPPEQANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESL 815          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 2665.18 bits (6907), Expect = 0.000e+0
Identity = 1379/2491 (55.36%), Postives = 1790/2491 (71.86%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPN-APEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQ-TEAVEKIE--------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGI---------------------------GTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A +  +  LD+ G  MI   H++SE I+TRL +LH LWE LL   +EK   L+     VQ+LR  +++L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E +  K+ +V  + +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALEEKV  L  ++D L   HP +   IQ K E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++N GQ L+D NH  S+++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  + NRY  L+EP+  RK KL+D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ MI+  H+A  +++ K+ ++ + W+ LKNKA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I  LR QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++ QY N+L +G  R+D L+ S + + L REAN+L QW+ EKE  ++T       LE V+  +KK D+F  + K  E ++K++   A++L+  G  TE V+ ++                                  I  L ++++ L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT   G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  A+ I +   E+N+ WN L T+A   K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELA+DVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHY   EIKEKL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FA+QL+  +HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDP TNIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R++ LADQW +LV+KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN+R++++K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LV S+DYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   DEI+++L      W EL++ ++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ +D+C  G+ LI  NNH+ + I  + +GLR K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW++L   S  RK  LL+ QE Y+KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F+NSL +A+ DF  L++LD++I+ Y V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++GI                           GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ + KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P AYDY  FT  LF N
Sbjct:    6 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANAGAIVKLDETGNLMISEGHFSSETIRTRLVELHRLWELLLLKMQEKGVKLQQAQKLVQYLRECEDVLDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFASKLAQEEHPELELIKTKQDEVNASWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIREKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEEKVKALCAESDRLQQSHPMNAPQIQVKGEELITNWEQIRTLAAERHARLNDSYKLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKAADAAGQALLNGGHYASDEVREKLTILAEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERALYRRTQLADSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALENSGQKLIDVNHYASDEVAARMSEVITLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVNRYEALKEPMVARKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGESMISEGHFASDEVKGKLRELNDKWATLKNKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLRAYGSSIQGLREQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDGQYHNILEMGEKRKDMLEKSCKKFMLFREANELQQWINEKE-ASLTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVADELESEGLITEEVQPVQHQVWNRRHIMVFHVLFFFFQSVRTAVLAVATFNSIKDLNERWKSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDSYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESADDIQEKCTELNQAWNSLGTRANQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELARDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYDSPEIKEKLDILEQERASLEKAWVERRMMLDQCLELQLFNRDCEQAENWMAAREAFLNSEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFAEQLIIADHYAKGDIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDP-TNIQSKHQKHQAFEAELHANADRIRGVVDMGNSLIERGACAGSEDAVKARLSALADQWQFLVSKSAEKSQKLKEANKQQNFNTGIKDFDFWLTEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMTSSAFDTTQVKEKRDAINDRFQRIKSMATARRSRLNESHRLHQFFRDLDDEESWIKEKKLLVGSDDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLADDNTIG-KDEIQQRLAQFLEHWKELKEQAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVHDVCANGEDLIQKNNHHVENISAKMKGLRGKVAELEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSRAIESRHASLMKRWNQLLDNSAARKKKLLEAQEHYRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRNSLSSAQTDFNQLAELDRQIKGYRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGIAYRRVIRVYQYEVGDDLSGRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSTDQKPYVTKEELYQNLTREQADYCISHMKPYMDSKGRELPSAYDYVEFTRSLFVN 2471          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 2664.8 bits (6906), Expect = 0.000e+0
Identity = 1378/2484 (55.48%), Postives = 1788/2484 (71.98%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPN-APEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQ-TEAVEKIE--------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A +  +  LD+ G  MI   H++SE I+TRL +LH LWE LL   +EK   L+     VQ+LR  +++L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E +  K+ +V  + +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALEEKV  L  ++D L   HP +   IQ K E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++N GQ L+D NH  S+++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  + NRY  L+EP+  RK KL+D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ MI+  H+A  +++ K+ ++ + W+ LKNKA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I  LR QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++ Q                    Y N+L +G  R+D L+ S + + L REAN+L QW+ EKE  ++T       LE V+  +KK D+F  + K  E ++K++   A++L+  G  TE V+ ++                                  I  L ++++ L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT   G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  A+ I +   E+N+ WN L T+A   K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELA+DVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHY   EIKEKL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FA+QL+  +HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDP TNIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R++ LADQW +LV+KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN+R++++K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LV S+DYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   DEI+++L      W EL++ ++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ +D+C  G+ LI  NNH+ + I  + +GLR K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW++L   S  RK  LL+ QE Y+KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F+NSL +A+ DF  L++LD++I+ Y V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  RS ++E  GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ + KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P AYDY  FT  LF N
Sbjct:    6 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANAGAIVKLDETGNLMISEGHFSSETIRTRLVELHRLWELLLLKMQEKGVKLQQAQKLVQYLRECEDVLDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFASKLAQEEHPELELIKTKQDEVNASWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIREKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEEKVKALCAESDRLQQSHPMNAPQIQVKGEELITNWEQIRTLAAERHARLNDSYKLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKAADAAGQALLNGGHYASDEVREKLTILAEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERALYRRTQLADSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALENSGQKLIDVNHYASDEVAARMSEVITLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVNRYEALKEPMVARKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGESMISEGHFASDEVKGKLRELNDKWATLKNKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLRAYGSSIQGLREQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDGQAHMSKEAGSVSLRMNQVEELYHNILEMGEKRKDMLEKSCKKFMLFREANELQQWINEKE-ASLTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVADELESEGLITEEVQPVQHQVWNRRHIMVFHVLFFFFQSVRTAVLAVATFNSIKDLNERWKSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDSYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESADDIQEKCTELNQAWNSLGTRANQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELARDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYDSPEIKEKLDILEQERASLEKAWVERRMMLDQCLELQLFNRDCEQAENWMAAREAFLNSEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFAEQLIIADHYAKGDIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDP-TNIQSKHQKHQAFEAELHANADRIRGVVDMGNSLIERGACAGSEDAVKARLSALADQWQFLVSKSAEKSQKLKEANKQQNFNTGIKDFDFWLTEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMTSSAFDTTQVKEKRDAINDRFQRIKSMATARRSRLNESHRLHQFFRDLDDEESWIKEKKLLVGSDDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLADDNTIG-KDEIQQRLAQFLEHWKELKEQAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVHDVCANGEDLIQKNNHHVENISAKMKGLRGKVAELEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSRAIESRHASLMKRWNQLLDNSAARKKKLLEAQEHYRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRNSLSSAQTDFNQLAELDRQIKGYRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSTDQKPYVTKEELYQNLTREQADYCISHMKPYMDSKGRELPSAYDYVEFTRSLFVN 2464          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 2661.71 bits (6898), Expect = 0.000e+0
Identity = 1379/2491 (55.36%), Postives = 1791/2491 (71.90%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQ-TEAVEKIE-----GI----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A +  +  LD+ G  MI   H++SE I+TRL +LH LWE LL   +EK   L+     VQ+LR  +++L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E +  K+ +V  + +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALEEKV  L  ++D L   HP +   IQ K E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++N GQ L+D NH  S+++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  + NRY  L+EP+  RK KL+D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ MI+  H+A  +++ K+ ++ + W+ LKNKA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I  LR QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++ Q                    Y N+L +G  R+D L+ S + + L REAN+L QW+ EKE  ++T       LE V+  +KK D+F  + K  E ++K++   A++L+  G  TE V+ ++     G+                            I  L ++++ L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT   G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  A+ I +   E+N+ WN L T+A   K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELA+DVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHY   EIKEKL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FA+QL+  +HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R++ LADQW +LV+KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN+R++++K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LV S+DYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   DEI+++L      W EL++ ++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ +D+C  G+ LI  NNH+ + I  + +GLR K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW++L   S  RK  LL+ QE Y+KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F+NSL +A+ DF  L++LD++I+ Y V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ + KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P AYDY  FT  LF N
Sbjct:    6 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANAGAIVKLDETGNLMISEGHFSSETIRTRLVELHRLWELLLLKMQEKGVKLQQAQKLVQYLRECEDVLDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFASKLAQEEHPELELIKTKQDEVNASWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIREKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEEKVKALCAESDRLQQSHPMNAPQIQVKGEELITNWEQIRTLAAERHARLNDSYKLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKAADAAGQALLNGGHYASDEVREKLTILAEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERALYRRTQLADSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALENSGQKLIDVNHYASDEVAARMSEVITLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVNRYEALKEPMVARKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGESMISEGHFASDEVKGKLRELNDKWATLKNKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLRAYGSSIQGLREQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDGQAHMSKEAGSVSLRMNQVEELYHNILEMGEKRKDMLEKSCKKFMLFREANELQQWINEKE-ASLTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVADELESEGLITEEVQPVQHQEVYGMQRDEADSKSASPWKSVRTAVLAVATFNSIKDLNERWKSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDSYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESADDIQEKCTELNQAWNSLGTRANQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELARDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYDSPEIKEKLDILEQERASLEKAWVERRMMLDQCLELQLFNRDCEQAENWMAAREAFLNSEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFAEQLIIADHYAKGDIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVVDMGNSLIERGACAGSEDAVKARLSALADQWQFLVSKSAEKSQKLKEANKQQNFNTGIKDFDFWLTEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMTSSAFDTTQVKEKRDAINDRFQRIKSMATARRSRLNESHRLHQFFRDLDDEESWIKEKKLLVGSDDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLADDNTIG-KDEIQQRLAQFLEHWKELKEQAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVHDVCANGEDLIQKNNHHVENISAKMKGLRGKVAELEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSRAIESRHASLMKRWNQLLDNSAARKKKLLEAQEHYRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRNSLSSAQTDFNQLAELDRQIKGYRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSTDQKPYVTKEELYQNLTREQADYCISHMKPYMDSKGRELPSAYDYVEFTRSLFVN 2471          

HSP 2 Score: 250.366 bits (638), Expect = 1.519e-65
Identity = 228/931 (24.49%), Postives = 432/931 (46.40%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAEL 6525
            +DS   ++++T    AE I + ++++ + + +    +   + KL +S   Q F  D  +L  WI      ++SDE  KD T  +  L++H+                         AE+ A +G     ++ G  ++  GH++   I+ +L  +    E L  +   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L + EH + + IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  E+++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ +   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +      +  G   SD +RE+  ++ E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+T+L +S   Q+F    +E ++WI EK    +   Y D  + +QG ++KH AFE ++  ++ + + + N GQKLID N++ +  +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  E+ H  +D I+ + + L++R++ L+     RK  L   L+LQ+ ++ VE+             +W    E       R   L  ++ L + H   +  +   E     ++Q  + + S G   +      +  L + W  L+    +R  +L
Sbjct:    1 MDSGGVKVLET----AEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANAGAIVKLDETGNLMISEGHFSSETIRTRLVELHRLWELLLLKMQEKGVKLQQAQKLVQYLRECEDVLDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFASKLAQEEHPELELIKTKQDEVNASWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIREKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEEKVKALCAESDRLQQSHPMNAPQ--IQVKGEELITNWEQIRTLAAERHARLNDSYKLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKAADAAGQALLNGGHYASDEVREKLTILAEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRR-DALLSRRNALHERALYRRTQLADSFHLQQFFRDSDELKSWINEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALENSGQKLIDVNHYASDEVAARMSEVITLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQEAGHFDADNIRKKQEALVNRYEALKEPMVARKQKLSDSLRLQQLFRDVEDE-----------ETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGESMISEGHFASDEVKGKLRELNDKWATLKNKASQRRQDL 886          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 2658.25 bits (6889), Expect = 0.000e+0
Identity = 1378/2490 (55.34%), Postives = 1789/2490 (71.85%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPN-APEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQ-TEAVEKIE--------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A +  +  LD+ G  MI   H++SE I+TRL +LH LWE LL   +EK   L+     VQ+LR  +++L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E +  K+ +V  + +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALEEKV  L  ++D L   HP +   IQ K E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++N GQ L+D NH  S+++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  + NRY  L+EP+  RK KL+D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ MI+  H+A  +++ K+ ++ + W+ LKNKA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I  LR QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++ Q                    Y N+L +G  R+D L+ S + + L REAN+L QW+ EKE  ++T       LE V+  +KK D+F  + K  E ++K++   A++L+  G  TE V+ ++                                  I  L ++++ L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT   G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  A+ I +   E+N+ WN L T+A   K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELA+DVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHY   EIKEKL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FA+QL+  +HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDP TNIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R++ LADQW +LV+KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN+R++++K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LV S+DYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   DEI+++L      W EL++ ++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ +D+C  G+ LI  NNH+ + I  + +GLR K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW++L   S  RK  LL+ QE Y+KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F+NSL +A+ DF  L++LD++I+ Y V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ + KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P AYDY  FT  LF N
Sbjct:   10 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANAGAIVKLDETGNLMISEGHFSSETIRTRLVELHRLWELLLLKMQEKGVKLQQAQKLVQYLRECEDVLDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFASKLAQEEHPELELIKTKQDEVNASWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIREKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEEKVKALCAESDRLQQSHPMNAPQIQVKGEELITNWEQIRTLAAERHARLNDSYKLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKAADAAGQALLNGGHYASDEVREKLTILAEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERALYRRTQLADSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALENSGQKLIDVNHYASDEVAARMSEVITLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVNRYEALKEPMVARKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGESMISEGHFASDEVKGKLRELNDKWATLKNKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLRAYGSSIQGLREQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDGQAHMSKEAGSVSLRMNQVEELYHNILEMGEKRKDMLEKSCKKFMLFREANELQQWINEKE-ASLTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVADELESEGLITEEVQPVQHQVWNRRHIMVFHVLFFFFQSVRTAVLAVATFNSIKDLNERWKSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDSYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESADDIQEKCTELNQAWNSLGTRANQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELARDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYDSPEIKEKLDILEQERASLEKAWVERRMMLDQCLELQLFNRDCEQAENWMAAREAFLNSEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFAEQLIIADHYAKGDIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDP-TNIQSKHQKHQAFEAELHANADRIRGVVDMGNSLIERGACAGSEDAVKARLSALADQWQFLVSKSAEKSQKLKEANKQQNFNTGIKDFDFWLTEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMTSSAFDTTQVKEKRDAINDRFQRIKSMATARRSRLNESHRLHQFFRDLDDEESWIKEKKLLVGSDDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLADDNTIG-KDEIQQRLAQFLEHWKELKEQAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVHDVCANGEDLIQKNNHHVENISAKMKGLRGKVAELEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSRAIESRHASLMKRWNQLLDNSAARKKKLLEAQEHYRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRNSLSSAQTDFNQLAELDRQIKGYRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSTDQKPYVTKEELYQNLTREQADYCISHMKPYMDSKGRELPSAYDYVEFTRSLFVN 2474          
BLAST of Spectrin alpha chain vs. Ensembl Xenopus
Match: sptan1 (spectrin, alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:100036647])

HSP 1 Score: 2655.94 bits (6883), Expect = 0.000e+0
Identity = 1378/2492 (55.30%), Postives = 1789/2492 (71.79%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPN-APEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQ-TEAVEKIE--------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGE--------VEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A +  +  LD+ G  MI   H++SE I+TRL +LH LWE LL   +EK   L+     VQ+LR  +++L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E +  K+ +V  + +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALEEKV  L  ++D L   HP +   IQ K E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++N GQ L+D NH  S+++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  + NRY  L+EP+  RK KL+D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ MI+  H+A  +++ K+ ++ + W+ LKNKA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I  LR QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++ Q                    Y N+L +G  R+D L+ S + + L REAN+L QW+ EKE  ++T       LE V+  +KK D+F  + K  E ++K++   A++L+  G  TE V+ ++                            I  L ++++ L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT   G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  A+ I +   E+N+ WN L T+A   K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELA+DVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHY   EIKEKL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FA+QL+  +HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDP TNIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R++ LADQW +LV+KS +KS+KL+EAN+Q  +N G+KD +FWL E        VE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN+R++++K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LV S+DYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   DEI+++L      W EL++ ++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ +D+C  G+ LI  NNH+ + I  + +GLR K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW++L   S  RK  LL+ QE Y+KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F+NSL +A+ DF  L++LD++I+ Y V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ + KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P AYDY  FT  LF N
Sbjct:    6 VKVLETAEDIQERRQQVLDRYLRFKELSVLRRQKLEDSYRFQFFQRDADELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANAGAIVKLDETGNLMISEGHFSSETIRTRLVELHRLWELLLLKMQEKGVKLQQAQKLVQYLRECEDVLDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFASKLAQEEHPELELIKTKQDEVNASWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIREKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEEKVKALCAESDRLQQSHPMNAPQIQVKGEELITNWEQIRTLAAERHARLNDSYKLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKAADAAGQALLNGGHYASDEVREKLTILAEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERALYRRTQLADSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALENSGQKLIDVNHYASDEVAARMSEVITLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVNRYEALKEPMVARKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGESMISEGHFASDEVKGKLRELNDKWATLKNKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLRAYGSSIQGLREQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDGQAHMSKEAGSVSLRMNQVEELYHNILEMGEKRKDMLEKSCKKFMLFREANELQQWINEKE-ASLTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVADELESEGLITEEVQPVQHQDEADSKSASPWKSVRTAVLAVATFNSIKDLNERWKSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDSYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESADDIQEKCTELNQAWNSLGTRANQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELARDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYDSPEIKEKLDILEQERASLEKAWVERRMMLDQCLELQLFNRDCEQAENWMAAREAFLNSEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFAEQLIIADHYAKGDIASRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDP-TNIQSKHQKHQAFEAELHANADRIRGVVDMGNSLIERGACAGSEDAVKARLSALADQWQFLVSKSAEKSQKLKEANKQQNFNTGIKDFDFWLTEVRNQYKNQVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMTSSAFDTTQVKEKRDAINDRFQRIKSMATARRSRLNESHRLHQFFRDLDDEESWIKEKKLLVGSDDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLADDNTIG-KDEIQQRLAQFLEHWKELKEQAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVHDVCANGEDLIQKNNHHVENISAKMKGLRGKVAELEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSRAIESRHASLMKRWNQLLDNSAARKKKLLEAQEHYRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRNSLSSAQTDFNQLAELDRQIKGYRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSTDQKPYVTKEELYQNLTREQADYCISHMKPYMDSKGRELPSAYDYVEFTRSLFVN 2472          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 2695.61 bits (6986), Expect = 0.000e+0
Identity = 1382/2475 (55.84%), Postives = 1782/2475 (72.00%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEKIE-------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +LD SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+  +H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   E++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP+ D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q  ++NQY++LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++ E                                 I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W  L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIKEKL  +   +  L + W+ R+  LD CLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQVASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQIQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKE-AALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2452          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 2689.83 bits (6971), Expect = 0.000e+0
Identity = 1382/2480 (55.73%), Postives = 1782/2480 (71.85%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEKIE-------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +LD SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+  +H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   E++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP+ D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q  ++NQY++LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++ E                                 I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W  L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIKEKL  +   +  L + W+ R+  LD CLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQVASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQIQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKE-AALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2457          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 2687.52 bits (6965), Expect = 0.000e+0
Identity = 1382/2495 (55.39%), Postives = 1782/2495 (71.42%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEKIE-------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +LD SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+  +H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   E++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP+ D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q  ++NQ                    Y++LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++ E                                 I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W  L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIKEKL  +   +  L + W+ R+  LD CLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQVASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQIQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKE-AALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2472          

HSP 2 Score: 249.595 bits (636), Expect = 1.783e-65
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      V+SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +    SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++  + +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQVASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQ--IQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 2684.44 bits (6957), Expect = 0.000e+0
Identity = 1383/2501 (55.30%), Postives = 1783/2501 (71.29%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEKIE-------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGI---------------------------GTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +LD SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+  +H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   E++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP+ D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q  ++NQY++LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++ E                                 I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W  L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIKEKL  +   +  L + W+ R+  LD CLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++GI                           GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQVASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQIQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKE-AALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGIAYRRVIRVCQYEVGDDLSGRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2478          
BLAST of Spectrin alpha chain vs. Ensembl Mouse
Match: Sptan1 (spectrin alpha, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98386])

HSP 1 Score: 2679.43 bits (6944), Expect = 0.000e+0
Identity = 1382/2500 (55.28%), Postives = 1782/2500 (71.28%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEKIE-------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +LD SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+  +H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   E++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP+ D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q  ++NQ                    Y++LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++ E                                 I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W  L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIKEKL  +   +  L + W+ R+  LD CLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQVASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQIQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKE-AALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2477          

HSP 2 Score: 249.21 bits (635), Expect = 2.262e-65
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      V+SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +    SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++  + +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQVASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQ--IQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|P13395|SPTCA_DROME (Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2)

HSP 1 Score: 2780.74 bits (7207), Expect = 0.000e+0
Identity = 1397/2434 (57.40%), Postives = 1830/2434 (75.18%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYI-SESGQPIPDAYDYRAFTGHLFQN 7344
            PKE+KILET EDIQERREQVL+RY+ FK  T ++R+KLED++++QYFKRDADELESWI EK+Q  S+E+++D TNLQ+K QKHQA E E++A S  + +LD  G +MI   H+ASE IQ RLD+LH LWE LL+   EK   L+  L  VQFLR+ +E++FW K+KETFVT++EFGQDLEHVEVLQ+KF+EF KD+  QE +  E+   AD L+Q+  PE++++  +K+++ +A +RLK LA  RQ+KLF AHEIQ+F RD D+T++W+ EK + L+S+D+GRDLASVQAL+RKHE ++RDL ALE+KV+ L  +A  L + H D  D I+DK+  + + W  L  K+ ER ++LD SY LHRFL+D+RDL+SW+  MKA+I+ADELAKDVAG EAL+ERH EHK EID+R++SFK     G++L+   H  + +I  KL  L+ ++  L+ LW +RR+LYEQ MDLQLFYRDTEQA+ W+AKQEAFL N D+GDSLDSVEALI+KHEDFEKSLAAQEEK + LD  A +L++  HYAA DV ++R  LL R++ L+EK+  R+  LEDS+ YQ F+RD DE K WI EKLK A+D++Y +PTNL  K+QKHQNF  E+ AN+SRI+D+ N G  L++  H  ++ I  R++E+  LW  LV AS  K   L +A  QQQF R +ED+E+WL+E+E QL S+D GKDL SV NLQKKH LLEAD+ +HQDRI+S    A++F++  HFDAD I+ K+  +S RY  L  P+ +RK  L D+ ++ Q +RD +DE  WI EKEPIA STN GRDLIGVQNLIKKHQA+ AEI  HE R+L V + G+ M+    +A  DI ++++ ++  W+ LK K+ +RKQ LDDSL+A QY ADA+EAESWMREKEP+   +++GKDEDS+EALLKKH+AL++D+EA+ +TI +L+ QA  C+ QE PV D  GKE V+ALYDY EK+PREVSM+KGDVLTLLNSN+KDWWKVE+NDRQG VPAAY+KK+DA +S    N  +  ++A +Q  + +QY+NLL+L R+R+++L ++V+AY LVREA DL QW+ +KE  A    +    LE V+  +KK D+F ++ K  E ++  + + A +L   GQTEA  KI+  +  L +K+  L+ +T  K   L   + VQR+HR+ DE K+WI EK   LN  D+GKDL SVQ L RKH+ +ERDL AL ++++ LD  A  L+Q+HP+ AE     Q+EINEMW+++ TK+   K KL +S DLQ+FL+DYRDL++WIN+M +LV+SDELA DVTGAEAL+ERH                      +EH  EIDAR+GTF  FE FG ELL+  HYA  EIKEK++ +A A+E L + W  R+ QL+Q L+LQLY+RDCE AE WM+ RE+ L  +D  +    V++LIKKHEDF++AIN  E K+ AL+  ADQL+   HY  + + +K ++VL RW  LKE +I  RSRLGD QTLQ F RDADE+E WI EKLQ   +ESYKDP  NIQ+KHQKHQAFEAELAANA+R+QS+L  G  L +K QC G E+AV++R+ ++ADQW+YL +K+ +KS KL+EAN+Q  Y A +KD++FWLGEVE  L++ D GKD ASV +L+ KHQ++  DI AHEDRIKD+N +AD  +ESG  D+  I+E+++ INERYE++  LA +R   L +A  LH F+R I DEE+WI+EKK+LV S+DYGRDL GV+NLKKKH+RLE E+ +HEP IQ+V++ G +LM+ S L  P EI+++L+ L  AW EL+ L++ R  KL+ES  YQ+FL  VEEEEAWI EKQ LLS  DYGD++AAVQGLLKKHDAFETD   H+D+C+ IC++G +L++  NH+ ++I QRC+ LR KLD L   A RRK  L DNSA+LQFMWK DVVESWI DKE  V+SD++GRDLS+VQTLLTK ETFD GL +F  EGI  IT+L +QLI ++HAQS AI  R+ +++ RW KL+  S  RKD LL +QE+++++EELYLTFAKKASAFNSWFENAEEDLTDPVRCNS+EEI+AL +AH+ F+ SL +AE DF  L+ LD++I+S+ VG NPYTWFTMEALEETW+NLQ+II+ERD EL +E KRQEEND LR+EFA  A+ FHQWL   R+++MEG G+LE+QLEA + K+ EV+ R++DLK+IEE GA+LEE LILDNR+TEHSTVGL+Q WDQLDQL+MRM HNLEQQIQARN SGVSE++L+EFSMMFKHFDKDKSG+L+H+EFKSCLRALG DL  VEEGQ DPEFE IL VVDPNRDG+V+LQE++AFMIS+ETENVQS +E+E AF A+T   +PY+TK+ELY NLTKD A++C++ M P+    SGQPI DA DY  FT  LFQN
Sbjct:    6 PKEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEKLQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDELHKLWELLLSRLAEKGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRKEELNEAWQRLKQLAIVRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAEIANYWQSLTTKARERKQKLDESYYLHRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAALENDKSSLLSLWEDRRILYEQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETLVQASDKKGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGVQNLIKKHQAVLAEINNHEARLLNVISSGENMLKDQPFASDDIRQRLEALQEQWNTLKEKSSQRKQDLDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPVVDITGKECVVALYDYTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKKIDAGLSASQQNLVDNHSIAKRQNQINSQYDNLLALARERQNKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQTEAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEINEMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALIERH----------------------QEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERRLQLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSRDADEIENWIAEKLQLATEESYKDP-ANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVP-EIEQRLKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFHQWLTETRTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSGKLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETENVQSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDALDYIDFTRTLFQN 2415          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|P16546|SPTN1_MOUSE (Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptan1 PE=1 SV=4)

HSP 1 Score: 2687.52 bits (6965), Expect = 0.000e+0
Identity = 1382/2495 (55.39%), Postives = 1782/2495 (71.42%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEKIE-------------------------------GIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +LD SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+  +H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   E++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP+ D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q  ++NQ                    Y++LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++ E                                 I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W  L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIKEKL  +   +  L + W+ R+  LD CLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQVASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQIQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKE-AALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2472          

HSP 2 Score: 249.595 bits (636), Expect = 1.247e-64
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      V+SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +    SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++  + +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQVASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVSQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSASQ--IQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAASHYASDEVREKLSILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|P16086|SPTN1_RAT (Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Sptan1 PE=1 SV=2)

HSP 1 Score: 2683.67 bits (6955), Expect = 0.000e+0
Identity = 1382/2495 (55.39%), Postives = 1785/2495 (71.54%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEK--IEGI-----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L+QE  PE+E +  K+++V  A +RLK LA +RQ KLF A E+Q+F RD D+TI W+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S + IQ K+E L++ W  ++  + ER+ +LD SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   E++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP+ D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q  ++NQ                    Y++LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++  + G+                             I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W  L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIKEKL  +   +  L + W+ R+  LD CLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++E++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQVASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQEEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSANQIQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLSILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGVKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKE-AALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2472          

HSP 2 Score: 254.218 bits (648), Expect = 4.355e-66
Identity = 213/829 (25.69%), Postives = 405/829 (48.85%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      V+SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K +EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++        N ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +G   SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++  + +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQVASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQEEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSA--NQIQVKREELITNWEQIRTLAAERHARLDDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLSILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLEATELKGVKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|Q13813|SPTN1_HUMAN (Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3)

HSP 1 Score: 2679.43 bits (6944), Expect = 0.000e+0
Identity = 1378/2495 (55.23%), Postives = 1782/2495 (71.42%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVEK--IEGI-----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDA+ELE WI EK+Q  SDEN+KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH  WE LL   +EK   L      VQ+LR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  D+   EE+  E+   A  L+QE  PE+E +  K+ +V  A +RLK LA +RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KV  L  +AD L   HP S   IQ K+E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFKS    G+ L+   H  S+++  KL  L +ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH   +++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL +V NLQKKH LLEAD+++HQDRID    QA QF D  HFDA+ IKKKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K+ ++   W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++NQ                    Y +LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   A  L+  G    + +AV++  + G+                             I +L +++  L+++   + + L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W+ L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIK+KL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+   HY +  I  +  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW +LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  IN R++K+K +A +R   L ++ +LH F+R +DDEE+WI+EKK+LV SEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  GQ LI  NNH+ + I  + +GL  K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW +L   S  RK  LL+ Q  ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P A+DY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKE-AALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGK-EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN 2472          

HSP 2 Score: 251.521 bits (641), Expect = 3.523e-65
Identity = 211/829 (25.45%), Postives = 403/829 (48.61%), Query Frame = 1
Query: 3754 LDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            +D    ++++T    AE I + ++++ + +++    +   + KL +S   Q F  D  +L  WI      ++SDE  KD T  +  L++H+                         AE+ A SG     ++ G  ++  GH+A   I+ +L  +    E L E+   +  +L Q  +L  YLR+CE   DW+  +E+ +  E++  D + V+ L KK E+F   +   E+++  + +FA +L++ +H +++ IK K  EV A W  LK   +  + +L     +Q F RD DE   WI EK Q    + +     ++QA  +KH+  E +LAA  ++++++     RL++       +  ++ +  +L   W+ +   + ++  +L ++ R   + A  +D+  W+ E++  +++ +   D A  ++LL +HQ    +I AHED  K  +E     + +G   SD +RE+  +++E    + +L E R     +   L  FYR  +  + W+ +++  + +ED G  L  V  L KKH+  E  + A E  I ++++   +L+  +  A  D   R+ + L +    L + +  R+ +L +S   Q+F    +E ++W+ EK    +   Y D  + +QG ++KH AFE ++  ++ + + +   GQKLID N++    +  R   +      L +A   +   L + +   QF    + +E W+ + E  + SDDYG+DL++VQ L  KH     D      RI+GI +      Q  ++ H  ++ IK + + L+ R++ L+     RK  L   L+LQ+ ++ VE+
Sbjct:    1 MDPSGVKVLET----AEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAF----------------------EAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQ--IQVKREELITNWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRR-DALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDP-SNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQA---RQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 795          
BLAST of Spectrin alpha chain vs. UniProt/SwissProt
Match: sp|P07751|SPTN1_CHICK (Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3)

HSP 1 Score: 2665.18 bits (6907), Expect = 0.000e+0
Identity = 1376/2500 (55.04%), Postives = 1786/2500 (71.44%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG----QTEAVE--KIEGI-----------------------------ITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            P  +K+LET EDIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADEL  WI EK+Q  SDEN+KD +NLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL +LH LWE LL   +EK   L      VQFLR  ++++ W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L+QE  PE+E + +K+ +V  + +RLK LA++RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL A   KV  L  +AD L   HP +   IQ K+E L++ W  ++  + ER+ +L+ SY L RFL+D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SF+S    G+ L+   H  S+++  KL  L  ER  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A  R++ L DS + Q F RD+DE+K+W+ EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D NH  S+++  R+ E+  LW  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL SV NLQKKH LLEAD+++HQD ID    QA QF D  HFDAD IKKKQ  +  RY  L++P+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G  M+   H+A  D++ K++++   W  LK KA +R+Q L+DSL+AQQY ADA+EA+SWMREKEP+VGST++GKDEDS EALLKKH+ALM+D+ AY S+I +LR QA +C+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++A +Q+ ++NQ                    Y +LL LG  R+  L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E ++K++   AN L+  G    + +AVE  ++ G+                             I +L +++  L+++   + + L     VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L R  +  ERDL ALG++V  L   A  L+Q+HP  AE + +   E+N+ W+ L  +A+  K KL +S DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EIKEKL  +   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  ED  D   +V++LIKKHEDF++AIN+QE+K+  L+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++  G  L E+G C G E+AV+ R+  LADQW++LV KS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  ++++++ IN R++++K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQ V   G +L +++ +   +EI+++L      W EL+QL++ R  +LEES EYQ+F+  VEEEEAWI EK  L++S DYGDTLAA+QGLLKKH+AFETD  VH+D+ ND+C  G+ LI  NNH+ + I  + +GL+ K+  L KAA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+ +LM RW++L   S  RK  LL+ QE ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL EAH  F++SL +A+ DF  L++LD++I+S+ V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQW+Q  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDKDKSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE+IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E KPY+TK+ELY NLT++QA++C+  M PY+   G+ +P AYDY  FT  LF N
Sbjct:    3 PSGVKVLETAEDIQERRQQVLDRYHRFKELSSLRRQKLEDSYRFQFFQRDADELGKWIQEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANSGAIVKLDETGNQMINEGHFASETIRTRLQELHRLWELLLEKMREKGVKLLQAQKLVQFLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAGKLIQEQHPEEELIKSKQDEVNASWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKGQLMASDDFGRDLASVQALLRKHEGLERDLAAFHHKVKALCAEADRLQQSHPINASQIQVKREELIANWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFRSADESGQALLAAGHYASDEVKEKLTILSDERSALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMDDVATRRDALLSRRNALHERAMKRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYASDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQDPIDGITIQARQFQDAGHFDADNIKKKQEALVARYEALKDPMVARKQKLADSLRLQQLFRDIEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKIKLNELNQKWDSLKAKASQRRQDLEDSLQAQQYFADANEAQSWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDNQTLITKEVGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKE-AALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVANDLESEGLMAEEVQAVEHQEVYGMMPRDETDSKTVSPWKSARMMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSADEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRNDEGFERDLAALGDKVNSLGETAQRLIQSHPELAEDLQEKCTELNQAWSSLGKRADQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAVLQSFADQLIAADHYAKGVIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIEMGNPLIERGACAGSEDAVKARLAALADQWEFLVQKSSEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRETINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGK-EEIQQRLAQFVDHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEVRHASLMKRWNQLLANSAARKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSERKPYVTKEELYQNLTREQADYCISHMKPYMDGKGRELPSAYDYIEFTRSLFVN 2477          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A0V0J9I2 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR123433 PE=4 SV=1)

HSP 1 Score: 3451.76 bits (8949), Expect = 0.000e+0
Identity = 1703/2429 (70.11%), Postives = 2028/2429 (83.49%), Query Frame = 1
Query:   58 EIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQ-ITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQ 7341
            E +ILETPEDI+ RR QVL+RY+AFKEAT+ERR++LE+AK+YQYFKRDADELESW+LEK+QTY +E+FKDL NLQSK QKHQALELE+ AQSE L +LDK+G +MI  +HYASEII+ RLD LHALW+KL+ MF+EKSRLL LTL+YV FLRRVDEILFW +EKETFVTSEEFGQDLEHVE LQKK++EF+KDLEYQE +AAEIY+KAD L+QE  PE+  +++KK++V++ALERLK+LA++RQQKLFEAHEIQ+FFRDTDKTISW+NEKSIPL+ ED GRDL SVQAL+RKHEAL+RDL ALE+KV+QL  DAD LS KHPDS+D I+ K  AL+ AW  LK K+ +R  +L+ S+ L+RFL+D+RDL  W+ D KA+IAADELAKDVAG EA +ERHNEHK EIDSR+ES+KSC  EG+ L+ M HP S DI++K+  L++ER  L+ LW+ERR+ +EQ MDLQLFYRD EQAEAW+AKQEAFL+N DVGDSLD+ EALIRK EDFEKSLAAQEEK + L+  A +LV+ GHYA+ ++  +++ LL R++ L+EKA LR + LEDSH Y +FDRDADEIKAWIVEK+KTA+DE+YK+PTNLQ+KVQKH NF +EI+ANE RI+DVK  G +LL++NH KS+DI+ RI ELD LW  LV A   K KNL QA+ QQQFVRN+ED+E+WL+EVE+Q+ASDD G+DLNSV N+QKKHNL+E+D+ SH+DRI +F  Q  +F+ E H+DA  +++KQ +V +RY  L EPL K++ +L D+Y+LHQFYRD +DEEDWI EKEP+A S NVGRDLIGVQNLIKKHQA+ AEI GHEPRI +VC  G+ MIN  H+A  DI K+I D++N W  L+ ++  R+QLL+DSL+AQQY ADASEAESWM EKEPLV S EFG+DEDSTEALLKKHDALMADIEAY STI+ LRTQ++AC+MQE PVSD  GK+ VMALYDYQEK PR+VSMRKG+ LTLLNS+ KDWWKVEINDRQG VPAAY+KK+DA ++D   +  +Q +TVA QQ+ LENQY+NLL LGRDRR+RL+DSVQAYQLVREANDLHQWVVEKELVAVTE I PG LE V+ E+K+++  ++EQK++E ++ +L+DKA KLKR GQTEAVEKIEGI+ QLQKKYEQLEEV  +KVK+L+D  AVQRYHR+CDEAK+WI EKD RL+T DVGKDLTSVQRL RKHDALERDLVALG+RVK LD KAA+L QTHP EAEGI +HQEEIN +WN LT KAE  K KL +S+DLQKF+AD+RDL SW+NTMNALV+SDELA DVTGAEALLERH                      +EH AEIDAR+GTF NF+ FG ELL+  HYA  EI   L+  A ++  L + W  R+K L+QCL+ Q +LRDCEQAEDWM++RE++L  +DVD   VD LIKKHEDFNRAIN+QE K+ AL   AD L++  HYD +GI  K  EVL RW +LK+ MI NRS+LGDVQTLQAF+RDADEMEIWI+EKLQ T D+SYKDPT N+QAKHQKHQAF+AELAANAERLQ+ILG+GQRL EKGQC GQE AVE R+ K+ADQWD L+ K+++KS+KL+EANRQA YNAG+KDIEFWLGEVE SL+SPDYGKDSASV+SLLSKHQVL TDI AHEDRI +LN RADEF++SG  D+DTIRERKKMINERYEK++ L ENRA+TLGKAK LHDFYR IDDEE+WIREKKILV SEDYGRDLI VRNL+KKH+RLE EI AH+P IQ V +QG +LM  ++LA+P EI+++++HL  AW ELQ  ++ R  KLEESS YQ FLD VEEE AWILEKQHLL S DYGDTLAAVQGLLK+H+AFE D+KVH++KC+DIC  G+ LI+  NHN  AIEQ+CEGL EK+ VL + A RRK  L DN A LQFMWKTDVVE WIAD+E QV S+DYGRDLSSVQTLLTKHETFDT LESFR EGIE IT+LHNQL++S HAQ+ AIK R+  L++RW++LQRES RRK  LL+LQERYK+VE+L+L FAK+AS FNSWFENAEEDLTDPVRCNSL+EI+AL +A   FK SLK AE DF  L QLD +I+ YGVG NPYTWFTMEAL+ TW+NLQ+IIQERD EL RE  RQE+ND LRQEFA  A+ FH WLQ VR++LME  GTLEEQLEAT+AKS E++ RK+DLK+IEE GA LEERLILDNR+TEHSTVGLSQAWDQLDQLAMRM HNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALG DL  VEE QVD EFE+IL+VVDPNRDG++TLQEFMAFMISRETENVQSR EVEEAF +LTKE K YIT+ ELYANL+K+QA++C++TMPPY ++SGQPI DAYDY++FT  LFQ
Sbjct:   24 EPQILETPEDIRNRRNQVLDRYAAFKEATDERRRRLEEAKRYQYFKRDADELESWMLEKLQTYQNEDFKDLANLQSKKQKHQALELEVKAQSETLASLDKSGEEMISQNHYASEIIRNRLDDLHALWDKLMAMFREKSRLLNLTLEYVLFLRRVDEILFWIREKETFVTSEEFGQDLEHVETLQKKYDEFVKDLEYQEGRAAEIYTKADELIQE-LPEETLVMDKKREVQEALERLKDLARRRQQKLFEAHEIQRFFRDTDKTISWINEKSIPLSIEDCGRDLVSVQALQRKHEALERDLAALEDKVSQLGVDADALSEKHPDSRDNIKGKHGALVEAWQRLKDKAADRRHRLEESFLLNRFLTDWRDLTLWIADTKAIIAADELAKDVAGAEAHVERHNEHKGEIDSREESYKSCMEEGQRLVDMGHPTSGDIISKMNTLERERAALLALWDERRIQFEQCMDLQLFYRDAEQAEAWMAKQEAFLDNKDVGDSLDAAEALIRKQEDFEKSLAAQEEKIKHLEAFAGKLVDGGHYASPEIATRKEALLRRRTALQEKAALRHNQLEDSHRYHMFDRDADEIKAWIVEKMKTATDESYKDPTNLQTKVQKHHNFESEISANEPRIEDVKKMGTDLLEANHYKSDDIRARINELDDLWVKLVDAMTKKGKNLEQANNQQQFVRNIEDIELWLSEVEAQIASDDQGRDLNSVMNMQKKHNLIESDVQSHRDRITAFEDQVAKFIQEGHYDAPILEQKQQQVMSRYEALSEPLQKKRSRLADSYRLHQFYRDVEDEEDWIREKEPVAASNNVGRDLIGVQNLIKKHQAVMAEISGHEPRIDDVCAAGEDMINEGHFAADDIRKRIADLRNYWDSLRQQSQNRRQLLEDSLQAQQYFADASEAESWMHEKEPLVDSNEFGRDEDSTEALLKKHDALMADIEAYGSTIEHLRTQSEACRMQEVPVSDILGKQLVMALYDYQEKAPRDVSMRKGETLTLLNSSSKDWWKVEINDRQGFVPAAYLKKIDAPLTDSQTHLNDQPLTVAVQQQRLENQYKNLLQLGRDRRERLQDSVQAYQLVREANDLHQWVVEKELVAVTETIVPGRLEEVECERKRVENLLSEQKDREARVNDLRDKAEKLKRGGQTEAVEKIEGIVMQLQKKYEQLEEVAAKKVKELDDINAVQRYHRDCDEAKDWINEKDVRLSTDDVGKDLTSVQRLIRKHDALERDLVALGDRVKQLDVKAADLAQTHPQEAEGICKHQEEINGLWNDLTAKAETRKAKLLDSLDLQKFMADHRDLQSWMNTMNALVNSDELASDVTGAEALLERH----------------------QEHRAEIDARAGTFDNFDAFGHELLENKHYASPEIASVLEQTAQSRNALADSWKARQKALEQCLKQQQFLRDCEQAEDWMSMREATLAVDDVDSNKVDVLIKKHEDFNRAINIQESKINALNAAADGLIKEGHYDANGIDQKRNEVLTRWANLKDAMIENRSKLGDVQTLQAFLRDADEMEIWISEKLQATTDDSYKDPTINVQAKHQKHQAFQAELAANAERLQAILGAGQRLIEKGQCKGQEGAVEARLAKIADQWDNLIKKAEEKSDKLKEANRQAAYNAGIKDIEFWLGEVEASLASPDYGKDSASVESLLSKHQVLETDIQAHEDRIVELNARADEFLQSGALDADTIRERKKMINERYEKIRALTENRAITLGKAKGLHDFYRNIDDEESWIREKKILVGSEDYGRDLISVRNLRKKHKRLETEIAAHDPTIQQVIQQGKDLMTSTELADPAEIQKRIDHLAQAWEELQAATTNRHRKLEESSNYQDFLDAVEEETAWILEKQHLLGSEDYGDTLAAVQGLLKQHEAFEADLKVHQNKCSDICTVGRDLIEAGNHNKPAIEQKCEGLMEKVGVLVQNAERRKALLSDNYALLQFMWKTDVVELWIADREAQVHSEDYGRDLSSVQTLLTKHETFDTALESFRTEGIETITALHNQLVQSQHAQAPAIKQRFNLLIERWERLQRESDRRKKGLLELQERYKQVEKLFLDFAKRASTFNSWFENAEEDLTDPVRCNSLDEIRALIDAQDQFKASLKPAEADFEQLRQLDVKIKEYGVGANPYTWFTMEALDGTWRNLQKIIQERDDELRRELARQEQNDQLRQEFASAANSFHHWLQNVRNSLMESSGTLEEQLEATRAKSVEIRARKVDLKKIEELGARLEERLILDNRYTEHSTVGLSQAWDQLDQLAMRMQHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGHDLQLVEENQVDTEFESILNVVDPNRDGYITLQEFMAFMISRETENVQSRDEVEEAFRSLTKEGKDYITRAELYANLSKEQADYCVQTMPPYYTKSGQPIQDAYDYQSFTQQLFQ 2429          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A504Y9H5 (Spectrin alpha chain non-erythrocytic OS=Fasciola gigantica OX=46835 GN=FGIG_09949 PE=4 SV=1)

HSP 1 Score: 3399.76 bits (8814), Expect = 0.000e+0
Identity = 1688/2440 (69.18%), Postives = 2002/2440 (82.05%), Query Frame = 1
Query:   49 LPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQ-ITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALT-------KESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            LP ++KILETPEDIQERREQVL+RYSAFKEATE RR +LE AK+YQ+FKRDADELE WILEK+QTYS+E+FK+L+NLQ+K QKHQA ELE+ A +E L++LD  G  MI   HYASEII+ RLD+LHALWEKL+ MF+EKSRLL LTL + QFLR  D++LFW +EKET+VTSEE+G DLEHVE LQKKF+EF+KDLE+QE +A E+Y K D LL+E FPE   +  K ++V +ALERLK  A+ R  KLFEAHEIQ+FFRDTDK ISWVNEKSIPL+ +D GRDLASVQAL+RKHE L+RDL ALEEK+ QL  DA  L+ KHPDSK+TI +K   LLSAW  LK ++ ER  +LD +  L RFL+D+RDL  W+++MKA+I ADELAKDVAG EA +ERHNEHK+EI SR++SF++C  EG  LI      S DI  KL  L++ER  L+ LW  RR+ +EQ MDLQL+YRDTEQAE+W++KQEA LEN DVGDSLD+VEAL+RKHEDFEKSL AQEEK + +D+ A +L+EN HYAA+ V + +  +  R++ L +KA  R+  LEDSH YQ+FDRDADE+++WI+EKL+ A DE++K+PTNLQ+K QKHQNF AEI AN+SR+DD++  GQ+L+ + H  + +I  RIE+LD  W  LV A   K+KNL QAS QQQFVRNVED+E+WL EVE+QL+SDD G+DLN V N QKKHNLLEAD+ +H+DR+D+F  QAD F  E HFDA  I +KQ ++  RY  L EPL  R+ KL DAYKLHQF+RD +DE+DWIHEKEP+AGSTNVGRDLIGVQNLIKKHQA+ AE+ GHEPRI EV  EG  M+   HYA  +I K+I +++  W  L  K D+R+QLL+DSL+AQQY ADASEAESWMREKEPLVGS+EFG+DEDSTEALLKKH+ALMADIEAY STI+ L  QA+AC+MQEAP+SD  GK+ VMALYDYQEK+PREVSMRKG++LTLL SNHKDWWKVE+NDRQG VPAAYVK+VDA +SD      E+ +TVASQQ+ LE QY+ LL LG DRR+RL+DSV+AYQLVREANDLHQWVVEKELVAVTE I PG LE V+SE+KK+D+ V EQKE+E ++ EL  KA+KLKR GQTEAVEKIEGII QLQKKYEQLEEVTTRK KDL+D  AVQRYHRECDEAK+WIEEK++RL T D+G DLTSVQRL RKHDALERD+VAL +RVK LDSKAA+LVQTHP+EAE I +HQEEIN+ WN L + AE  K KL +S+DLQKFLAD RDL SWINTM+ALV+SDELAKDVTGAEALLERHRD                      +  EID R   F N E FGKELL  GHYA  +++E LQ I +A++ LN++WL R+K L+QCLE QL+LRDCEQAEDWM IRE+SL+G+DVD   VD+LIKKHEDFNRAIN+QE K+Q+L   A +L+E +HYD D I++K  +VL RW  LK+ MI NRS+L DVQT QAFIRDADEME+WI +K+Q T+DESYKDP  N+QAKHQKHQAFEAELAANAERLQ I+G+GQRL +  QC GQE+ V+ER+ KLADQWD+LVN+SK+KSEKLQEANRQA Y+AG+KDIEFWLGE+E SL+SPDYGKDSASVDSLLSKHQV+ TDI AHEDRIK+L+ RADEFI SG  D++TI ERKKMINERYEK++  +ENRAVTLGKAK+LHDFYR +DDEE WIREKKI+VSSEDYGRDLIGVRNL KKHQR+E E+ AH P IQ V +QG EL   + L +P+ +++++EHL  AW ELQ L+++R+ KLEES  YQ FLD+VEEEEAWILEKQHLLSS DYGDTLAAVQGL KKH+AFETD+K+H+DKC ++C  G +LI   NHN  AI+QR EGLREKLD L++AA RRK  L DNSAFLQFMWKTDVVESWIAD+ETQV+S+DY RDLSSVQTLLTKHETFDT LESF  EGI+ IT+LH+QL+ +NHAQ+ AIK R+  LMDRW++L+R+S+RRK  LL+LQE+YKKVEELYLTFAK+AS FNSWFENAEEDLTDPVRCNSL+E++AL EA + FK SLKAAE DF  L+QLD EI++YGVG NPYTWFTMEAL +TW+NLQ+II ERDAEL  ET RQE+ND LRQEFAH A+ FHQWL  +R+++ME  GTLEEQLEAT+AK+ EV  RK DL++IEE GA L+ERLILDNR+TEHSTVGLSQAWDQL+QLAMRM HNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALG DL  V EGQVD EFETIL+VVDPNRDG VTLQEFMAFMISRETENVQSR EVEEAF ALT       KE K YITK++LYANL+K+QAE+C R MPPY ++SGQPIPDAYDY  FT  LFQ+
Sbjct:    4 LPTKVKILETPEDIQERREQVLSRYSAFKEATEFRRHRLEQAKRYQFFKRDADELEGWILEKLQTYSNEDFKELSNLQAKKQKHQAFELEVTAHAEILSSLDTAGEQMISEQHYASEIIKNRLDELHALWEKLMAMFREKSRLLNLTLKFGQFLRLADDLLFWIREKETYVTSEEYGSDLEHVEALQKKFDEFLKDLEFQETRAQEVYDKEDELLKEGFPEDRLVSEKSREVREALERLKEQAEHRHHKLFEAHEIQRFFRDTDKAISWVNEKSIPLSVDDCGRDLASVQALQRKHETLERDLAALEEKLVQLGVDAGALAEKHPDSKETIHEKHRTLLSAWEKLKAQAAERRARLDEALKLQRFLADWRDLNLWISEMKALIEADELAKDVAGAEAHVERHNEHKAEIASREDSFQTCMQEGRNLIESGITNSADIATKLSELEREREALLSLWEARRIQFEQCMDLQLYYRDTEQAESWMSKQEALLENKDVGDSLDAVEALMRKHEDFEKSLVAQEEKMKHIDDFATKLIENQHYAASQVAELQRTMSDRRAALRDKAAARRQRLEDSHRYQMFDRDADEMQSWIMEKLRCACDESHKDPTNLQTKCQKHQNFEAEIQANQSRVDDIRKMGQDLIQAGHYNAPEIGSRIEQLDDTWLRLVDAMSKKKKNLDQASRQQQFVRNVEDVELWLGEVEAQLSSDDVGRDLNGVMNAQKKHNLLEADVQAHRDRVDAFKSQADTFAAEGHFDAPIIAEKQVQLMQRYRALDEPLRARREKLKDAYKLHQFFRDVEDEQDWIHEKEPVAGSTNVGRDLIGVQNLIKKHQAVSAEVSGHEPRIEEVIQEGNAMVCTKHYAAEEITKRISELRADWRHLCEKTDRRRQLLEDSLQAQQYFADASEAESWMREKEPLVGSSEFGRDEDSTEALLKKHNALMADIEAYGSTIEDLAAQANACRMQEAPISDVLGKDVVMALYDYQEKSPREVSMRKGEILTLLASNHKDWWKVEVNDRQGFVPAAYVKRVDAPLSDSQAELAEKPLTVASQQQRLEEQYQYLLQLGHDRRERLQDSVEAYQLVREANDLHQWVVEKELVAVTETIVPGRLEEVESERKKVDDLVVEQKEREARVTELCAKADKLKRGGQTEAVEKIEGIIMQLQKKYEQLEEVTTRKAKDLDDINAVQRYHRECDEAKDWIEEKESRLLTDDLGSDLTSVQRLIRKHDALERDMVALDDRVKQLDSKAADLVQTHPSEAEAICRHQEEINQNWNALASIAEQRKAKLLDSLDLQKFLADCRDLQSWINTMDALVASDELAKDVTGAEALLERHRD----------------------YRTEIDTRGPAFDNLEAFGKELLDHGHYAGEQVQENLQRITEARKALNDDWLKRQKTLEQCLEEQLFLRDCEQAEDWMAIRETSLVGDDVDGNKVDALIKKHEDFNRAINLQEAKIQSLTTGASKLLETDHYDSDAIREKLTDVLDRWSHLKDAMIENRSKLRDVQTFQAFIRDADEMELWITKKMQMTMDESYKDPKINVQAKHQKHQAFEAELAANAERLQGIIGAGQRLIQNEQCKGQEDIVQERIEKLADQWDHLVNRSKEKSEKLQEANRQAQYDAGIKDIEFWLGEMETSLASPDYGKDSASVDSLLSKHQVIVTDIQAHEDRIKELDARADEFIRSGAGDAETILERKKMINERYEKIRAQSENRAVTLGKAKRLHDFYRNMDDEETWIREKKIIVSSEDYGRDLIGVRNLHKKHQRIEAEVAAHAPAIQQVLQQGEELTVGTLLTDPEVVRQRMEHLRAAWEELQTLTALRRQKLEESLAYQDFLDSVEEEEAWILEKQHLLSSEDYGDTLAAVQGLQKKHEAFETDLKIHDDKCEELCVLGSELIQAENHNRAAIDQRREGLREKLDTLKRAAQRRKSNLTDNSAFLQFMWKTDVVESWIADRETQVRSEDYARDLSSVQTLLTKHETFDTALESFHAEGIQTITALHDQLVNANHAQTPAIKQRFNTLMDRWERLRRDSERRKTDLLQLQEQYKKVEELYLTFAKRASMFNSWFENAEEDLTDPVRCNSLDEVRALSEAQNQFKESLKAAEVDFQQLAQLDHEIKNYGVGMNPYTWFTMEALIDTWRNLQKIIAERDAELRNETLRQEQNDQLRQEFAHAANAFHQWLTNLRTSMMEAGGTLEEQLEATRAKANEVNARKNDLREIEELGARLKERLILDNRYTEHSTVGLSQAWDQLNQLAMRMEHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGHDLHEVGEGQVDEEFETILNVVDPNRDGVVTLQEFMAFMISRETENVQSRDEVEEAFRALTREGKEHLKEGKEYITKEQLYANLSKEQAEYCCRVMPPYYTKSGQPIPDAYDYHGFTKQLFQS 2421          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A5K4F8H0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 3397.83 bits (8809), Expect = 0.000e+0
Identity = 1694/2430 (69.71%), Postives = 2010/2430 (82.72%), Query Frame = 1
Query:   52 PKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPN-APEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLF 7338
            P ++KILETPEDI+ERREQVL+RYSAFKEAT+ RR KLE+AK+YQYFKRDADELESWI EK+QTY++E+FK+L+NLQ+K QKHQA ELE+ A +E L+ALD +G +MI   HYASEII+ RLD+LHALWE+L+ MF+EKSRL+ LTL +VQFLR+VDEILFWT+EKET+VTSE+FGQDLEHVE LQKKF+EFMKDLEYQE +A +IY KAD LL+E+FPE   +I K ++V +ALERLKNLAK RQ KL EA+EIQ+FFRDTDK ISWVNEKSIPL+ ED GRDLASVQAL+RKH+AL+RDL AL+EK+ QL  DA  L+ KHPDSKDTIQ K EAL++AW  LK + V+R  +L+ S+ + RFL+D++DL  W+TDMK +I++D+LAKDVAG EA +ERH E+ +EI+SR++SF +C +EG+ LI++ HP S +I  KL  L++E+  L++L  ERR   EQ M LQ FYRD EQ+E+WI KQEA LE  DVGDSLDSVEALIRKHEDFEKSL AQEEK    D +A +L+E  HYAAA V++ +     R+  L+EKAK R+  LEDSH YQ+FDRDADE+++WI EKLK+A DE+YK+ TNLQ+KVQKHQNF AEI AN+SR++D+K  GQ+LL++NH  S +IK +I++LD+ W+ L++A   K+KNL QAS QQQFVRNVED+E+WL +VE+Q+AS+D G+DLN V N QK+ NLLE+D+++H++RI++F  QAD F  E HFDA  I++KQ ++S RY  LQ+PL++R+ KL+DAYKLHQF+RD +DEEDWI EKEP+AGSTNVGRDLIGVQNLIKKHQAI AEI GH PRI EV  EGQ M+ A+HY   DIE+++ D+   WS L  KAD+R+QLL+DSL+AQQY ADASEAESWMREKEPLVGS+EFG+DEDSTEALLKKH+AL+ADIEAY STI++L  QA +C+MQEAPVSD  GK+ VMALYDYQEK+PREVSMRKG++LTLL SNHKDWWKVE+NDRQG VPAAYVKKV+A +SD     A + +TVASQQ+ LE QY  LL LGRDRR+RL+DSV+AYQLVREANDLHQWVVEKELVAVTE I PG LE V+SEKKK+DEFV EQKE+E ++ EL  KA+KLKR GQTEAVEKIEGII QLQKKYEQLEEVT +K K+LED  AVQRYHRECDEAKEWIEEK+ RL T DVG D TSVQRL RKHDALERDLVALGERVK LDSKAA+LVQ HP +AE I  HQEEIN +W+ L   AE  K KL +S+DLQKFLAD RDL SWI+TMNALVSS ++   VT AE+LL+ HR                      E+  EID R+  FQNFE FGKELL  GHYA + +++KLQ I +A+E LN  WLNR K L+Q LE QL+LRDCEQAEDWM IRE+SL G+DVD   VD+LIKKHEDFNRAI +QE K+Q+L   AD+L+E +HYD   I+ K  EVL RW  LK  MI NRSRLGDVQTLQAFIRDADEME+WINEK+Q T+DE YKDPTTNIQAKHQKHQAFEAELAANAERLQ IL +GQRLK+K QCMGQE+AVEER+ KLA+QWD LVN+S +KSEKLQEANRQA YNAG+KDIEFWLGE+E SL SPD+G+DSASVDSLLSKHQVL TDI AHEDRIK+L+ RADEFI SG  D+D +RERKKMINERYEK+  ++ENRAVTLGKAK+LHDFYR IDDEEAWIREKKILVSSEDYGRDLIGVRNL+KKH+R+ENE+ AH+P I+ V  QG EL    QLA+P+EIK++++ L+TAW ELQ L+++R+ KLEES  YQ F+D VEEEEAWILEKQHLLSS DYGDTLAAVQGLLKKHDAFETD+ +H +KC ++C  G  L+   NHN  +I+QRCEGL EKL+ L +AA RRK  L DNSAFLQFMW+TDVVESWIAD+ETQV+SDDYGRDLSSVQ LL KH TFDT LESF  EGI+ IT LH++LI + H QS AIK R+ +LMDRW++L+RES RRK  L++LQE+Y+KVEELYL FAK+AS FNSWFENAEEDLTDPVRCNSL+E+ ALCEA   FK SLKAAE DF  L+ LD+EI+SYGVG NPYTWFTME+L ETW+NLQ+II ERDAEL RET RQE+ND LRQ+FA  A+ FHQWLQ VR+++ME  GTLEEQLE  + KS EV+ RK DL+++E+ G +LEE LILDNR+TEHSTVGLSQAWDQLDQLAMRM HNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALG DL  V EGQVD EFE+IL+VVDPNRDG++TLQEFMAFMIS+ETENVQSR EVEEAF ALTKE K YITK+ELYANL+K+QAE+C R MPPY ++SGQ I DAYDY+AFT  LF
Sbjct:    5 PTKVKILETPEDIRERREQVLSRYSAFKEATQYRRHKLEEAKRYQYFKRDADELESWINEKLQTYANEDFKELSNLQAKKQKHQAFELEVTAHAETLSALDSSGEEMIGQGHYASEIIKNRLDELHALWERLMAMFREKSRLINLTLKFVQFLRQVDEILFWTREKETYVTSEDFGQDLEHVEALQKKFDEFMKDLEYQESRAEDIYHKADELLKEEFPEDTLVIEKSREVREALERLKNLAKMRQDKLLEAYEIQRFFRDTDKAISWVNEKSIPLSIEDCGRDLASVQALQRKHDALERDLTALDEKIGQLGDDASALAQKHPDSKDTIQGKYEALIAAWGKLKNQFVDRKSKLEESFKMQRFLADWKDLNIWMTDMKGLISSDDLAKDVAGAEAQVERHKEYTAEINSRNDSFDTCMSEGQALISVGHPSSGEIAAKLSNLEREKAALLELCEERREQLEQCMGLQYFYRDAEQSESWIGKQEALLEIKDVGDSLDSVEALIRKHEDFEKSLLAQEEKMHHFDELAKKLIETDHYAAAQVSELQHSSEDRRRALKEKAKRRRQCLEDSHRYQMFDRDADEMQSWISEKLKSALDESYKDSTNLQTKVQKHQNFEAEIQANQSRVEDIKKTGQDLLNANHCNSAEIKLKIDQLDETWSYLINAMANKKKNLDQASRQQQFVRNVEDVELWLDDVETQIASEDVGRDLNGVMNAQKRLNLLESDVAAHRERIEAFKVQADTFAAEGHFDAPIIQEKQRQLSQRYHDLQKPLNQRREKLSDAYKLHQFFRDVEDEEDWIREKEPVAGSTNVGRDLIGVQNLIKKHQAIYAEINGHSPRIEEVIQEGQAMVRANHYGANDIERRMADLTTDWSQLCEKADRRRQLLEDSLQAQQYFADASEAESWMREKEPLVGSSEFGRDEDSTEALLKKHNALLADIEAYGSTIEALGIQASSCRMQEAPVSD-LGKDVVMALYDYQEKSPREVSMRKGEILTLLASNHKDWWKVEVNDRQGFVPAAYVKKVEAPVSDTQAGLATKPLTVASQQQRLEEQYNYLLQLGRDRRERLQDSVEAYQLVREANDLHQWVVEKELVAVTETIVPGRLEEVESEKKKVDEFVMEQKEREARVTELCAKADKLKRGGQTEAVEKIEGIIMQLQKKYEQLEEVTAKKAKELEDIDAVQRYHRECDEAKEWIEEKENRLLTDDVGNDFTSVQRLIRKHDALERDLVALGERVKQLDSKAADLVQIHPQDAEAICTHQEEINHLWDGLAATAEKRKAKLLDSLDLQKFLADARDLQSWISTMNALVSSKQVGTYVTSAESLLDSHR----------------------EYRTEIDTRAPAFQNFESFGKELLDNGHYASDIVQQKLQEITEAREALNVAWLNRHKLLEQNLEEQLFLRDCEQAEDWMAIREASLAGDDVDGNKVDALIKKHEDFNRAITLQEVKIQSLMANADKLLEADHYDAAAIEAKRGEVLNRWTHLKNAMIDNRSRLGDVQTLQAFIRDADEMELWINEKMQFTMDEPYKDPTTNIQAKHQKHQAFEAELAANAERLQGILAAGQRLKQKNQCMGQESAVEERIAKLANQWDNLVNRSHEKSEKLQEANRQAAYNAGIKDIEFWLGEMETSLVSPDHGRDSASVDSLLSKHQVLVTDIRAHEDRIKELDARADEFIRSGAWDADMVRERKKMINERYEKILDMSENRAVTLGKAKRLHDFYRNIDDEEAWIREKKILVSSEDYGRDLIGVRNLRKKHERIENEVAAHDPFIKQVITQGEELTVGVQLADPEEIKKRIQRLQTAWEELQGLTALRRQKLEESLAYQDFIDGVEEEEAWILEKQHLLSSEDYGDTLAAVQGLLKKHDAFETDLNIHNEKCKELCLTGSDLVQSENHNRLSIQQRCEGLIEKLNALNQAAQRRKTNLTDNSAFLQFMWRTDVVESWIADRETQVRSDDYGRDLSSVQILLAKHATFDTALESFHTEGIQTITELHDRLIAAEHNQSPAIKQRFTSLMDRWERLRRESARRKADLIQLQEQYRKVEELYLAFAKRASTFNSWFENAEEDLTDPVRCNSLDEVHALCEAQEQFKASLKAAEADFQQLAHLDREIKSYGVGMNPYTWFTMESLVETWRNLQKIILERDAELRRETVRQEQNDQLRQQFAVAANSFHQWLQKVRTSMMEASGTLEEQLEGIREKSSEVRARKNDLREVEKLGTLLEEHLILDNRYTEHSTVGLSQAWDQLDQLAMRMQHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGHDLHEVGEGQVDAEFESILNVVDPNRDGYITLQEFMAFMISKETENVQSRDEVEEAFRALTKEGKEYITKEELYANLSKEQAEYCSRVMPPYYTKSGQAILDAYDYQAFTRQLF 2411          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A0R3U6U6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2523 PE=4 SV=1)

HSP 1 Score: 3393.21 bits (8797), Expect = 0.000e+0
Identity = 1685/2435 (69.20%), Postives = 2004/2435 (82.30%), Query Frame = 1
Query:   46 TLPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQ-ITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDD-KTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKE-SKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQ 7341
            T+ KE  ILETPED+  RR QVL+RY+AFKEAT+ERR++LEDAK+YQYFKRDADELE+WI EK+QTYS+E+FKDLTNLQSK QKHQALELE+ A  E LNALD +G +MI   HYASEII+  LD+LHALWEKL+ MFK+KSRLL LTL+YVQ+LRRVDEILFW +EKETFVTSEEFGQDLEHVE LQKK++EFMKDLEYQE +A EIY+KAD LL+E+FPE+  ++ KK +V +ALERLK+LA+KRQ KL+EAHEIQ+FFR+TDK ISW+NEKSIPL+ +D GRDL SVQAL+RKH+AL+RDL  LEEKV+QL  DAD LS KHPDSKDTIQ+K+  L +AW +LK ++ +R  +L+ S+ LHRFL+D+RDL  W+ D KA+I+ADELAKDVAG EA +ERHNEHK EI+SR++++KSC  EG+ L+ M HP S D+V K+  L KER  L++LW  RRV +EQ MDL LF+RD EQAEAWIAKQEAFLEN DVGDSLD+ EAL+RK EDFEKSL AQEEK + L+  A++L+ + HYA+ +V  +R+ LL R++ L+EKA LR   L DSH YQ+FDRDADE+KAWIVEKLKTA+DENYK+PTNLQ+KVQKH NF +EI AN SR+D+VK  G +L+D++H KS+DI+ RI ELD++W  L+ A   K KNL QA+ QQQFVRNVED+E+WL+EVE+QLASDD G+DLN+V N+QKKHNLLE+D+ SH+DRI +F  Q ++F  E H+DA  +++KQ +V  RY  L EPL  ++ +L+DAY+LHQFYRD +DEEDWI EKEP+A S+NVGRDLIGVQNLIKKHQA+ AEI GHEPRI++VC  G+ M N  H+A  +I+ +I  +   W  L+ K+D R++LLDDSL+AQQY ADA+EAESWM EKEPLV S E G+DEDSTEALLKKHDALMADIEAY STI+SL  QA  C MQE PV D  GKE V+ALYDYQEK PR+VSMRKG++LTLLNS+ KDWWKVEINDRQG VPAAY+KK+DA  +D   +  +Q +TVA QQ+ LE QY NLL LGRDRR+RL+ SVQAYQLVREANDLHQWVVEKE+ A+TE I P  LE V+ E+K++D  + EQK+++ +++EL DKA  LKR   TEAVEKIEGII QLQK YEQLEEVTT+KVK+L+D  AVQRYHR+CDEAKEWIEEKD RL T DVGKDLTSVQRL RKHDALERDLVALG+RVK LD KAA+L QTHP EAEGI QHQE+IN+ WN LT KAE  K KL +S+DLQKFLAD RDL SW+NTMNALV+S++LA DVTGAEAL+ERH                      +EH AEIDAR+ TF NF+ FG ELL+  HYA  EI+E++++   A++ L + W +R+K LDQ L+ Q +LRDCEQAEDWM++RESSL+G   DD   VD+LIKKHE+FNRAIN QE K+QAL   A+ L+   HYD DGI+ K  EVL RW  LK++MI NRSRLGDVQTLQAF+RDADEMEIWINEKLQ T DESYKDPT N+QAKHQKHQAF+AELAANAERLQ+ILG+G RL EKGQC GQENAVEER+ KLADQWD L+ +S++KS KLQEANRQA YNAG+KDIEFWLGEVE SL+SPDYGKDSASVDSLLSKHQVL TDI AHEDRI +LN RADE   +G  D+DTI+ERK+ INERYEK++ L+ENRA+TLGKAK LHDFYR +DDEEAWIREKKILVSSEDYGRDLI VRNL+KKH+RLE EI AHE  +  V +QG +LM  ++L +P EI+++++HL  AW ELQ L++ R  KL+ESS+YQ FLD VEEE AWILEKQHLLSS D+GD+LAAVQGLLK+HD FE D+KVH DKC +IC  G  LI+  NHN  AIEQ+CEGLREKLDVL + A RRK  L DN AFLQFMWKTDVVE WIAD+E QV+S+DYGRDLSSVQTLLTKHETFDT LESFR EGI+ IT+LH+QLI+S HAQS  I+ R+ +L+ RW++L+ ES+RRK+ LL+LQ +YKKVEELYL FAK+AS FNSWFENAEEDLTDPVRCNSL+EI+AL EA   FK SLK AE DF  L QLD+EI+ YGVG NPYTWFTMEALE+TW+NLQ+IIQERD EL RE  RQE+ND LRQEFA +A+ FH WLQ VR++LME  GTLEEQLEAT+AKS E++ RK++LKQIE+ GA LEERLILDNR+TEHSTVGLSQAWDQLDQL MRM HNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALG DL  VEE Q DPEFE IL+VVDPNRDG++TLQEFMAFMISRETENVQSR EVEEAF +LTK+ +K YITK+ELYANL+K+QA++C +TMPPY ++SGQP+ DAYDY  FT  LFQ
Sbjct:   20 TMFKEPSILETPEDVSNRRNQVLDRYAAFKEATDERRRRLEDAKRYQYFKRDADELENWIQEKLQTYSNEDFKDLTNLQSKKQKHQALELEVCAHLETLNALDASGEEMISQQHYASEIIRGILDELHALWEKLMAMFKQKSRLLNLTLEYVQYLRRVDEILFWIREKETFVTSEEFGQDLEHVEALQKKYDEFMKDLEYQEGRAVEIYAKADELLKEEFPEEAVVMEKKTEVREALERLKDLARKRQNKLYEAHEIQRFFRETDKAISWLNEKSIPLSIDDCGRDLVSVQALQRKHDALERDLTTLEEKVSQLGVDADALSEKHPDSKDTIQEKRNTLNTAWQNLKAQACDRRAKLEESFLLHRFLADWRDLTLWIADTKAIISADELAKDVAGAEAQVERHNEHKGEIESREDAYKSCMEEGQRLVDMGHPTSADVVQKMNTLQKERDSLLELWESRRVQFEQCMDLMLFFRDAEQAEAWIAKQEAFLENKDVGDSLDAAEALMRKQEDFEKSLTAQEEKIKNLEAFADKLIASNHYASPEVADRRESLLRRRTALQEKAALRHQQLVDSHRYQMFDRDADEMKAWIVEKLKTATDENYKDPTNLQTKVQKHHNFESEINANRSRMDEVKKMGTDLIDAHHCKSDDIQARINELDEIWLQLLDAMSKKGKNLEQANNQQQFVRNVEDVELWLSEVEAQLASDDHGRDLNNVINIQKKHNLLESDVQSHRDRISAFRDQVEKFKAEGHYDAPILEQKQQQVMARYDALAEPLKNKRARLDDAYRLHQFYRDVEDEEDWIREKEPVAASSNVGRDLIGVQNLIKKHQAVMAEIAGHEPRIVDVCQTGENMANQGHFASDEIKARIAGLNAAWEALRQKSDNRRKLLDDSLQAQQYFADANEAESWMHEKEPLVDSKELGRDEDSTEALLKKHDALMADIEAYGSTIESLGKQAAECNMQEVPVGDLMGKELVVALYDYQEKAPRDVSMRKGEILTLLNSSSKDWWKVEINDRQGFVPAAYLKKIDAPFTDSQSHLLDQPLTVALQQRRLEEQYNNLLKLGRDRRERLQSSVQAYQLVREANDLHQWVVEKEIFALTETIVPVGLEEVECERKRVDNLMAEQKDRKARVQELCDKAEGLKRGAPTEAVEKIEGIIMQLQKNYEQLEEVTTKKVKNLDDINAVQRYHRDCDEAKEWIEEKDLRLATDDVGKDLTSVQRLIRKHDALERDLVALGDRVKQLDVKAADLAQTHPQEAEGICQHQEQINQAWNDLTAKAEARKAKLLDSLDLQKFLADGRDLQSWMNTMNALVTSNDLATDVTGAEALIERH----------------------QEHRAEIDARASTFDNFDAFGHELLENKHYASPEIEERIEATRVARDNLLKAWQDREKALDQNLKQQQFLRDCEQAEDWMSMRESSLVGTSGDDVDKVDALIKKHENFNRAINAQEAKIQALDASANALLAEGHYDADGIEAKRAEVLGRWAKLKQDMIENRSRLGDVQTLQAFLRDADEMEIWINEKLQATTDESYKDPTINVQAKHQKHQAFQAELAANAERLQAILGAGHRLIEKGQCKGQENAVEERLAKLADQWDDLIRRSEEKSVKLQEANRQAAYNAGVKDIEFWLGEVEASLASPDYGKDSASVDSLLSKHQVLTTDIQAHEDRISELNARADELYAAGAIDADTIKERKRAINERYEKIRALSENRAITLGKAKCLHDFYRNLDDEEAWIREKKILVSSEDYGRDLISVRNLRKKHKRLETEIAAHEAAVHQVAQQGQDLMCNTELVDPAEIQKRIDHLNQAWEELQTLAANRHRKLDESSDYQDFLDAVEEETAWILEKQHLLSSGDHGDSLAAVQGLLKQHDGFEADLKVHHDKCAEICQAGAGLIERGNHNKPAIEQKCEGLREKLDVLMRNAERRKALLCDNYAFLQFMWKTDVVELWIADREVQVRSEDYGRDLSSVQTLLTKHETFDTALESFRTEGIQTITNLHDQLIQSKHAQSPVIQQRFDSLIGRWERLKSESERRKNELLQLQNQYKKVEELYLDFAKRASTFNSWFENAEEDLTDPVRCNSLDEIRALVEAQEQFKASLKPAETDFQRLRQLDQEIKEYGVGANPYTWFTMEALEDTWRNLQKIIQERDDELRRELARQEQNDQLRQEFASVANTFHAWLQSVRNSLMESSGTLEEQLEATRAKSVEIRARKVELKQIEDLGARLEERLILDNRYTEHSTVGLSQAWDQLDQLVMRMQHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGHDLQLVEENQADPEFEAILAVVDPNRDGYITLQEFMAFMISRETENVQSRDEVEEAFRSLTKDGTKEYITKEELYANLSKEQADYCAQTMPPYYTKSGQPVQDAYDYVGFTQQLFQ 2432          

HSP 2 Score: 73.1738 bits (178), Expect = 1.307e-8
Identity = 57/222 (25.68%), Postives = 107/222 (48.20%), Query Frame = 1
Query: 5395 PVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNA---KAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEV 6051
            PV+Q    +       S L  P+++  +   +   +   ++ +  R+ +LE++  YQ F    +E E WI EK    S+ D+ D L  +Q   +KH A E ++  H +  N +   G+++I   ++ +   + I      L EKL  + K   ++   L     ++Q++ + D +  WI +KET V S+++G+DL  V+ L  K++ F   LE      +E+
Sbjct:   13 PVVQP---EATMFKEPSILETPEDVSNRRNQVLDRYAAFKEATDERRRRLEDAKRYQYFKRDADELENWIQEKLQTYSNEDFKD-LTNLQSKKQKHQALELEVCAHLETLNALDASGEEMISQQHYASEIIRGILDELHALWEKLMAMFK---QKSRLLNLTLEYVQYLRRVDEILFWIREKETFVTSEEFGQDLEHVEALQKKYDEFMKDLEYQEGRAVEI 227          
BLAST of Spectrin alpha chain vs. TrEMBL
Match: A0A5J4P2W7 (Spectrin alpha OS=Paragonimus westermani OX=34504 GN=DEA37_0010677 PE=4 SV=1)

HSP 1 Score: 3370.48 bits (8738), Expect = 0.000e+0
Identity = 1674/2451 (68.30%), Postives = 2011/2451 (82.05%), Query Frame = 1
Query:   49 LPKEIKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEII-----------QTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQ-ITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALT-------KESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            LP ++KILETPEDIQERREQVL+RYSAFKEATE RR KLE AK+YQYFKRDADELESWILEK+QTYS+E+FK+L NLQ+K QKHQA ELE+ A +E L +LD++G +MI++ HYASEII           Q RLD+LHALW KL+ M  EKSRLL LTL +VQFLR+ D++LFW +EKET+VTSE++G DLEHVEVLQKKF EF+KDLEYQE++A ++Y K + LL+E+FPE   +I K  +V +AL+RL +LA  R+ KLFEAHEIQ+FFRDTDK ISWVNEKSIPLT ED GRDLASVQAL+RKHE L+RDL AL++K+ Q+  DA+EL+ KHPDS+DTI  K + LL+AW  LK ++  R+ +LD ++ L RFL+D+RD+  W+ DMKA+I ADELAKDVAG EA +ERHNEHK+EI SR++S+ SC  EG+ LI +    S DI  KL  L++ER  L+ LW  RRV +EQ MDLQLFYRD EQAE+WI+KQEA LEN DVGDSLDSVEALIRKHEDFEKSLAAQEEK + +D+ A +L+EN HYAA +V + +  L  R+S L +KA   +  LEDSH YQ+FDRDADE++ WI+EKL++A+D+++K+PTNLQ+KVQKHQNF AE+ AN+SR+D +K  GQ+L+ + H  S +I  RIE+LD  W+ L+ A  +K+ NL QA+ QQQFVRNV+D+E+WL EVE+QLASD+ G+DLN V N+QKKHNLLEAD+ +H+DRI++F  Q D F  E HFDA  I +K +++S RY+ ++EP+  R+ KL DAY+LHQF+RD +DE+DWIHEKEPIAGSTNVGRDLIGVQNLIKKHQA+ AE+ GH PRI +V  EG  MI A HYA  DI K+I ++++ W  L NK D+R QLL+DSL+AQQY ADASEAESWMREKEPLVGS+EFG+DEDSTEALLKKH+ALMADIEAY STID+L  QA AC+MQEAP+SD  GK+ VMALYDYQEK+PREVSMRKG++LTLL SNHKDWWKVE+NDRQG VPAAYVKK+DA +SD   +  E+ +TVASQQ+ LE QY+ LL LGRDRR+RL+DS++AY LVREANDLHQWV+EKELVAVTE I PG LE V+S +KK+D+FV EQKE+E ++ EL  KA++LKR GQTEAVEKIEGII QLQKKYEQLEEVTT+K+KDLED  AVQRYHRECDEAKEW++EK ARL T D+G DLTSVQRL RKHDALERDLVALG+RVK LD+KAA+LVQ HP +A+ I  HQ+++N+ WN L   AE  K KL +S+DLQKFLAD RDL SWI TM+ LV+SDELAKDVT AEALLERHRD                      +  EID RS  F N E FGKELL  GHYA   ++E+LQ +A+A+  L+ +W +R K+L+QCLE+QL+LRDCEQAEDWM +RESSL G+DVD   VD+LI+KHEDFNRA+N+QE K+Q+L+  A++L++ +HYD + IK K QEVL RW  LK+ MI NRS+L DVQT QAFIRDADEME+WI +K+Q T+DESYKDP  N+QAKHQKHQAFEAELAANAERLQSI+G+GQRL +  QC GQE+ V+ER+ KLA+QWD+LVN+SK+KSEKLQEANRQA Y+AG+KDIEFWLGE+E +L+SPDYGKDSASVDSL+SKHQVL TDI AHEDRI++L+ RADEFI SG  D++TI ERKK+INERYEK++ L+ENRAVTLGKAK+LHDFYR IDDEEAWIREKKI+VSSEDYGRDLIGVRNL KKHQR+E E+ +HEP I+   +QG ELM  + L +P+ ++ +++ L+ AW ELQ L+++R+ KLEES  YQ FLD+VEEEEAWILEKQHLLSS DYG TLAAVQGL KKH+AFE D+K+HEDKC+++C EG  LI   NHN  AIEQR EGLREKL+ L++AALRRK CL DNSAFLQFMWKTDVVESWIAD+ETQV+S+DY RDLSSVQTLLTKHETFDT LESFR EGI+ IT+L+ QLIE+ HAQ+  I+ R+  LMDRW++L R+S RRK  LL+LQE+YKKVEELYL FAK+AS FNSWFENAEEDLTDPVRCNSL+E++ALC+A   FK SLKAAE DF  L QLD EI+SYGVG NPYTWFTMEAL ETW+NLQ+II ERD EL RET RQE+ND LRQEFA +A+ FHQWLQ VR+++ME  G+LEEQLEAT+ K+ EV  R+ DL++IEE GA LEERLILDNR+TEHSTVGLSQAWDQL+QLAMRM HNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALG DL  V EGQVD EFE IL+ VDPNRDGFVTLQEFMAFMISRETENVQSR EVEEAF ALT       K+ K YITK++LYANL+K+QAE+C R MPPY ++ GQPIPDAYDY AFT  LFQN
Sbjct:    4 LPLKVKILETPEDIQERREQVLSRYSAFKEATEYRRYKLEQAKRYQYFKRDADELESWILEKLQTYSNEDFKELNNLQAKKQKHQAFELEVTAHAETLASLDRSGEEMIQDDHYASEIIKVRRRYLILTLQNRLDELHALWNKLMAMLGEKSRLLNLTLKFVQFLRQADDLLFWIREKETYVTSEDYGNDLEHVEVLQKKFEEFLKDLEYQEQRAQDVYEKEEELLKEEFPEDALVIAKAGEVREALKRLNDLADHRRHKLFEAHEIQRFFRDTDKAISWVNEKSIPLTVEDCGRDLASVQALQRKHETLERDLAALKDKLVQIGLDAEELAEKHPDSRDTIHGKHQTLLAAWEKLKAQADLRSSKLDEAFKLQRFLADWRDISVWIADMKALIEADELAKDVAGAEAHVERHNEHKAEIASREDSYLSCVQEGQNLIDLGIADSADIATKLSELERERDALLNLWETRRVQFEQCMDLQLFYRDAEQAESWISKQEALLENKDVGDSLDSVEALIRKHEDFEKSLAAQEEKMRHIDDFATKLIENNHYAAPEVAQLQTLLSDRRSALRDKAGDHRKRLEDSHRYQMFDRDADEMQLWIIEKLRSATDDSHKDPTNLQTKVQKHQNFEAEVQANQSRVDGIKKMGQDLIQAGHYNSPEIGARIEQLDDTWSRLIDAMTIKKTNLDQANRQQQFVRNVDDVELWLGEVEAQLASDELGRDLNGVINVQKKHNLLEADVQAHRDRIEAFKAQVDTFAAEGHFDAPIIAEKYSQLSQRYLAMEEPIRLRREKLRDAYRLHQFFRDVEDEQDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAVSAEVTGHHPRIQDVVQEGNAMIAAQHYAADDIAKRIKELEDDWKSLCNKTDRRHQLLEDSLQAQQYFADASEAESWMREKEPLVGSSEFGRDEDSTEALLKKHNALMADIEAYGSTIDALGNQASACRMQEAPISDILGKDVVMALYDYQEKSPREVSMRKGEILTLLASNHKDWWKVEVNDRQGFVPAAYVKKIDAPLSDSQNDLMEKPLTVASQQQRLEEQYQYLLQLGRDRRERLQDSLEAYHLVREANDLHQWVIEKELVAVTETIVPGKLEEVESARKKVDDFVVEQKEREARVTELCAKADRLKRGGQTEAVEKIEGIIMQLQKKYEQLEEVTTKKMKDLEDIDAVQRYHRECDEAKEWVDEKQARLMTDDLGTDLTSVQRLIRKHDALERDLVALGDRVKQLDTKAADLVQIHPQDADAIFDHQQDLNQSWNALAESAEQRKAKLLDSLDLQKFLADARDLQSWIATMDGLVTSDELAKDVTSAEALLERHRD----------------------YRTEIDTRSPAFTNLEMFGKELLDHGHYAAPVVQEQLQKLAEARAVLDNDWCDRNKKLEQCLEMQLFLRDCEQAEDWMGMRESSLAGDDVDGNKVDALIRKHEDFNRALNLQEAKIQSLQVGAEKLLDMDHYDSEAIKGKLQEVLGRWKELKDAMIENRSKLRDVQTFQAFIRDADEMELWITKKMQLTMDESYKDPKINVQAKHQKHQAFEAELAANAERLQSIIGAGQRLIQNDQCKGQEDIVQERIEKLANQWDHLVNRSKEKSEKLQEANRQAAYDAGIKDIEFWLGEMETTLASPDYGKDSASVDSLMSKHQVLATDIQAHEDRIRELDARADEFIHSGAGDAETILERKKLINERYEKIRALSENRAVTLGKAKRLHDFYRNIDDEEAWIREKKIIVSSEDYGRDLIGVRNLHKKHQRIEAEVASHEPAIRQTLEQGEELMVGTLLTDPEVVRSRMQQLDNAWDELQSLTALRRQKLEESLAYQDFLDSVEEEEAWILEKQHLLSSEDYGSTLAAVQGLQKKHEAFEADLKIHEDKCDNLCAEGAGLIRTGNHNCPAIEQRREGLREKLETLKRAALRRKSCLTDNSAFLQFMWKTDVVESWIADRETQVRSEDYARDLSSVQTLLTKHETFDTALESFRNEGIQTITTLYEQLIEAKHAQTPTIQSRFTTLMDRWNRLCRDSDRRKADLLQLQEQYKKVEELYLAFAKRASTFNSWFENAEEDLTDPVRCNSLDEVRALCDAQEQFKASLKAAEVDFQKLGQLDHEIKSYGVGMNPYTWFTMEALVETWRNLQKIILERDTELRRETARQEQNDQLRQEFAAVANSFHQWLQNVRTSMMEASGSLEEQLEATRIKATEVNARRNDLREIEELGARLEERLILDNRYTEHSTVGLSQAWDQLNQLAMRMQHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGHDLHEVGEGQVDEEFEAILNAVDPNRDGFVTLQEFMAFMISRETENVQSRDEVEEAFKALTKDGKEYLKDGKEYITKEQLYANLSKEQAEYCCRVMPPYYTKGGQPIPDAYDYHAFTRQLFQN 2432          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 2678.66 bits (6942), Expect = 0.000e+0
Identity = 1368/2445 (55.95%), Postives = 1782/2445 (72.88%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPN-APEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG-QTEAVEKIE-----GIIT--QLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDE++KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL++LH LW+ LL   KEK   L      VQ+LR  ++ L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E ++ K+++V  A +RLK LA++RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KVN L  +A+ L   HP +   I  K++ L++ W  ++  + ER+  L+ SY L RF +D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  SE++  KL  L +E+  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A+ R+++LEDS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D  H  S ++  R++E+   W  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL SV NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ M+   H+A  D++ K+ ++ N W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGS ++GKDEDS EALLKKH+ALM+D+ AY S+I +L+ QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++  +Q+ +ENQY  LL LG  R+D L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E +++++   A++L+  G   E    ++     G++   +L  ++  L+++   +   L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP   + I +   E+N  W+ L  +A+  K KL NS DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EI++KL+++   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  +D  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDP TNIQ+KHQKHQAFEAEL ANA+R++ ++ +G  L ++G C G E+AV+ R+  L +QW +LVNKS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  +N R+ K+K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQSV   G +L +++ +   +EI+++L      W EL+ L++ R  +LEES EYQ+F+  VEEEEAWI EK +L+ S DYGDTLAAVQGLLKKH+AFETD  VH D+ +D+C  G +LI   NH+   I  + + LR K+  L +AA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+  LM RW++L   S  RK  LL+ QE ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI+AL EAH  F++SL +AE DF  L++LD++I+SY V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQWLQ  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+KSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE+IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E+KPY+TK+ELY NLTK+QA++C+  M PY+   G+ +P A+D+  FT  LF N
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQIASDESYKDPTNLQGKLQKHQAFEAEVQANSGAIIKLDETGNLMISESHFASETIRTRLEELHRLWDLLLQKTKEKGVRLLQAQKLVQYLRECEDALDWITDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQAAAKLTQENHPEAELILKKQEEVNAAWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVNTLGGEAERLQQTHPQNASQIHLKRDELITNWEQIRTLAAERHAHLNDSYRLQRFTADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKATDEAGQALLNTGHYASEEVKEKLGILTEEKESLLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELIDGKHYASGEVATRMDEVSSQWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVARYEALKEPMAARKQKLCDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEISGHEPRIKAVTQKGEAMVEEGHFAGEDVKAKLGELNNRWDTLKGKATQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSPDYGKDEDSAEALLKKHEALMSDLSAYGSSIHALKEQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPTQSSSRENLLDEQGSIGLRQEQIENQYGTLLELGEKRKDMLEKSCKKFMLFREANELQQWINEKE-GALTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVASELESEGLMAEEAPLVQAQVRTGMLCFQELNNRWRALQQLAEDRSNMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVDDIQEKCTELNTAWSSLVGRADQRKDKLGNSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIQQKLEALDRERADLEKAWVQRRMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQSFADQLISADHYAKPEIFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTATDESYKDP-TNIQSKHQKHQAFEAELHANADRIRGVIDTGNALIQRGACAGSEDAVKSRLVALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMASNAFDTSQVKDKRDAVNGRFGKIKSMAAGRRAKLNESHRLHQFFRDLDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKDLAAARGQRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGDELIKKENHHVDNITAKMKALRGKVSELERAAAQRKSKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSKAIEARHATLMKRWNQLLSNSAARKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHDAFRSSLSSAEADFNQLAELDRQIKSYQVVSNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGNVSLQEYMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTKEQADYCISHMKPYLDSKGRELPSAFDFVEFTRSLFVN 2425          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 2659.4 bits (6892), Expect = 0.000e+0
Identity = 1372/2490 (55.10%), Postives = 1782/2490 (71.57%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPN-APEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG-----------QTEAVEKIEG----------------IITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGI---------------------------GTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDE++KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL++LH LW+ LL   KEK   L      VQ+LR  ++ L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E ++ K+++V  A +RLK LA++RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KVN L  +A+ L   HP +   I  K++ L++ W  ++  + ER+  L+ SY L RF +D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  SE++  KL  L +E+  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A+ R+++LEDS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D  H  S ++  R++E+   W  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL SV NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ M+   H+A  D++ K+ ++ N W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGS ++GKDEDS EALLKKH+ALM+D+ AY S+I +L+ QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++  +Q+ +ENQY  LL LG  R+D L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E +++++   A++L+  G           Q EA  K                    I +L  ++  L+++   +   L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP   + I +   E+N  W+ L  +A+  K KL NS DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EI++KL+++   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  +D  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDP TNIQ     +KHQKHQAFEAEL ANA+R++ ++ +G  L ++G C G E+AV+ R+  L +QW +LVNKS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  +N R+ K+K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQSV   G +L +++ +   +EI+++L      W EL+ L++ R  +LEES EYQ+F+  VEEEEAWI EK +L+ S DYGDTLAAVQGLLKKH+AFETD  VH D+ +D+C  G +LI   NH+   I  + + LR K+  L +AA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+  LM RW++L   S  RK  LL+ QE ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI+AL EAH  F++SL +AE DF  L++LD++I+SY V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQWLQ  R+ L++GI                           GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+KSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE+IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E+KPY+TK+ELY NLTK+QA++C+  M PY+   G+ +P A+D+  FT  LF N
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQIASDESYKDPTNLQGKLQKHQAFEAEVQANSGAIIKLDETGNLMISESHFASETIRTRLEELHRLWDLLLQKTKEKGVRLLQAQKLVQYLRECEDALDWITDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQAAAKLTQENHPEAELILKKQEEVNAAWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVNTLGGEAERLQQTHPQNASQIHLKRDELITNWEQIRTLAAERHAHLNDSYRLQRFTADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKATDEAGQALLNTGHYASEEVKEKLGILTEEKESLLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELIDGKHYASGEVATRMDEVSSQWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVARYEALKEPMAARKQKLCDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEISGHEPRIKAVTQKGEAMVEEGHFAGEDVKAKLGELNNRWDTLKGKATQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSPDYGKDEDSAEALLKKHEALMSDLSAYGSSIHALKEQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPTQSSSRENLLDEQGSIGLRQEQIENQYGTLLELGEKRKDMLEKSCKKFMLFREANELQQWINEKE-GALTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVASELESEGLMAEEAPLVQAQDEADSKSASPWKSIRMAVQTTANFNTIKELNNRWRALQQLAEDRSNMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVDDIQEKCTELNTAWSSLVGRADQRKDKLGNSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIQQKLEALDRERADLEKAWVQRRMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQSFADQLISADHYAKPEIFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTATDESYKDP-TNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDTGNALIQRGACAGSEDAVKSRLVALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMASNAFDTSQVKDKRDAVNGRFGKIKSMAAGRRAKLNESHRLHQFFRDLDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKDLAAARGQRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGDELIKKENHHVDNITAKMKALRGKVSELERAAAQRKSKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSKAIEARHATLMKRWNQLLSNSAARKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHDAFRSSLSSAEADFNQLAELDRQIKSYQVVSNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLQETRTYLLDGIAYRRVIRVYQYEVDDDLSGRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGNVSLQEYMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTKEQADYCISHMKPYLDSKGRELPSAFDFVEFTRSLFVN 2470          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 2654.4 bits (6879), Expect = 0.000e+0
Identity = 1371/2503 (54.77%), Postives = 1781/2503 (71.15%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEII-----------------------QTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPN-APEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG------------QTEAVEKIEG--------------------------IITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDE++KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I                       QTRL++LH LW+ LL   KEK   L      VQ+LR  ++ L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E ++ K+++V  A +RLK LA++RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KVN L  +A+ L   HP +   I  K++ L++ W  ++  + ER+  L+ SY L RF +D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  SE++  KL  L +E+  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A+ R+++LEDS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D  H  S ++  R++E+   W  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL SV NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ M+   H+A  D++ K+ ++ N W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGS ++GKDEDS EALLKKH+ALM+D+ AY S+I +L+ QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++  +Q+ +ENQY  LL LG  R+D L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E +++++   A++L+  G            Q E +    G                           I +L  ++  L+++   +   L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP   + I +   E+N  W+ L  +A+  K KL NS DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EI++KL+++   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  +D  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDP TNIQ     +KHQKHQAFEAEL ANA+R++ ++ +G  L ++G C G E+AV+ R+  L +QW +LVNKS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  +N R+ K+K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQSV   G +L +++ +   +EI+++L      W EL+ L++ R  +LEES EYQ+F+  VEEEEAWI EK +L+ S DYGDTLAAVQGLLKKH+AFETD  VH D+ +D+C  G +LI   NH+   I  + + LR K+  L +AA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+  LM RW++L   S  RK  LL+ QE ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI+AL EAH  F++SL +AE DF  L++LD++I+SY V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQWLQ  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+KSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE+IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E+KPY+TK+ELY NLTK+QA++C+  M PY+   G+ +P A+D+  FT  LF N
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQIASDESYKDPTNLQGKLQKHQAFEAEVQANSGAIIKLDETGNLMISESHFASETIRSFTPYRTAQRPIVKSVNYGNYIQTRLEELHRLWDLLLQKTKEKGVRLLQAQKLVQYLRECEDALDWITDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQAAAKLTQENHPEAELILKKQEEVNAAWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVNTLGGEAERLQQTHPQNASQIHLKRDELITNWEQIRTLAAERHAHLNDSYRLQRFTADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKATDEAGQALLNTGHYASEEVKEKLGILTEEKESLLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELIDGKHYASGEVATRMDEVSSQWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVARYEALKEPMAARKQKLCDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEISGHEPRIKAVTQKGEAMVEEGHFAGEDVKAKLGELNNRWDTLKGKATQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSPDYGKDEDSAEALLKKHEALMSDLSAYGSSIHALKEQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPTQSSSRENLLDEQGSIGLRQEQIENQYGTLLELGEKRKDMLEKSCKKFMLFREANELQQWINEKE-GALTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVASELESEGLMAEEAPLVQAQQQEMLGSAPGKDEADSKSASPWKSIRMAVQTTANFNTIKELNNRWRALQQLAEDRSNMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVDDIQEKCTELNTAWSSLVGRADQRKDKLGNSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIQQKLEALDRERADLEKAWVQRRMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQSFADQLISADHYAKPEIFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTATDESYKDP-TNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDTGNALIQRGACAGSEDAVKSRLVALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMASNAFDTSQVKDKRDAVNGRFGKIKSMAAGRRAKLNESHRLHQFFRDLDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKDLAAARGQRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGDELIKKENHHVDNITAKMKALRGKVSELERAAAQRKSKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSKAIEARHATLMKRWNQLLSNSAARKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHDAFRSSLSSAEADFNQLAELDRQIKSYQVVSNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGNVSLQEYMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTKEQADYCISHMKPYLDSKGRELPSAFDFVEFTRSLFVN 2483          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 2650.16 bits (6868), Expect = 0.000e+0
Identity = 1371/2521 (54.38%), Postives = 1782/2521 (70.69%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG------------QTEAVEKIEG--------------------------IITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQ-----AKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGI---------------------------GTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDE++KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I+TRL++LH LW+ LL   KEK   L      VQ+LR  ++ L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E ++ K+++V  A +RLK LA++RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KVN L  +A+ L   HP +   I  K++ L++ W  ++  + ER+  L+ SY L RF +D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  SE++  KL  L +E+  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A+ R+++LEDS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D  H  S ++  R++E+   W  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL SV NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ M+   H+A  D++ K+ ++ N W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGS ++GKDEDS EALLKKH+ALM+D+ AY S+I +L+ QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++  +Q+ +ENQ                    Y  LL LG  R+D L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E +++++   A++L+  G            Q E +    G                           I +L  ++  L+++   +   L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP   + I +   E+N  W+ L  +A+  K KL NS DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EI++KL+++   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  +D  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ     +KHQKHQAFEAEL ANA+R++ ++ +G  L ++G C G E+AV+ R+  L +QW +LVNKS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  +N R+ K+K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQSV   G +L +++ +   +EI+++L      W EL+ L++ R  +LEES EYQ+F+  VEEEEAWI EK +L+ S DYGDTLAAVQGLLKKH+AFETD  VH D+ +D+C  G +LI   NH+   I  + + LR K+  L +AA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+  LM RW++L   S  RK  LL+ QE ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI+AL EAH  F++SL +AE DF  L++LD++I+SY V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQWLQ  R+ L++GI                           GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+KSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE+IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E+KPY+TK+ELY NLTK+QA++C+  M PY+   G+ +P A+D+  FT  LF N
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQIASDESYKDPTNLQGKLQKHQAFEAEVQANSGAIIKLDETGNLMISESHFASETIRTRLEELHRLWDLLLQKTKEKGVRLLQAQKLVQYLRECEDALDWITDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQAAAKLTQENHPEAELILKKQEEVNAAWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVNTLGGEAERLQQTHPQNASQIHLKRDELITNWEQIRTLAAERHAHLNDSYRLQRFTADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKATDEAGQALLNTGHYASEEVKEKLGILTEEKESLLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELIDGKHYASGEVATRMDEVSSQWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVARYEALKEPMAARKQKLCDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEISGHEPRIKAVTQKGEAMVEEGHFAGEDVKAKLGELNNRWDTLKGKATQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSPDYGKDEDSAEALLKKHEALMSDLSAYGSSIHALKEQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPTQSSSRENLLDEQGSIGLRQEQIENQTMVTKEVCSVSVRMKQVEELYGTLLELGEKRKDMLEKSCKKFMLFREANELQQWINEKE-GALTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVASELESEGLMAEEAPLVQAQQQEMLGSAPGKDEADSKSASPWKSIRMAVQTTANFNTIKELNNRWRALQQLAEDRSNMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVDDIQEKCTELNTAWSSLVGRADQRKDKLGNSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIQQKLEALDRERADLEKAWVQRRMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQSFADQLISADHYAKPEIFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTATDESYKDPT-NIQLSKLLSKHQKHQAFEAELHANADRIRGVIDTGNALIQRGACAGSEDAVKSRLVALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMASNAFDTSQVKDKRDAVNGRFGKIKSMAAGRRAKLNESHRLHQFFRDLDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKDLAAARGQRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGDELIKKENHHVDNITAKMKALRGKVSELERAAAQRKSKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSKAIEARHATLMKRWNQLLSNSAARKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHDAFRSSLSSAEADFNQLAELDRQIKSYQVVSNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLQETRTYLLDGIAYRRVIRVYQYEVDDDLSGRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGNVSLQEYMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTKEQADYCISHMKPYLDSKGRELPSAFDFVEFTRSLFVN 2501          
BLAST of Spectrin alpha chain vs. Ensembl Cavefish
Match: sptan1 (spectrin alpha, non-erythrocytic 1 [Source:NCBI gene;Acc:103022593])

HSP 1 Score: 2648.62 bits (6864), Expect = 0.000e+0
Identity = 1371/2518 (54.45%), Postives = 1781/2518 (70.73%), Query Frame = 1
Query:   61 IKILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEII-----------------------QTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDIDPNA-PEQITVASQQKNLENQ--------------------YENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSG------------QTEAVEKIEG--------------------------IITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEG------IGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            +K+LET +DIQERR+QVL+RY  FKE +  RR+KLED+ ++Q+F+RDADELE WI EK+Q  SDE++KD TNLQ K QKHQA E E+ A S  +  LD+ G  MI   H+ASE I                       QTRL++LH LW+ LL   KEK   L      VQ+LR  ++ L W  +KE  VTSEE GQDLEHVEVLQKKF EF  DL   EE+  E+   A  L QE+ PE E ++ K+++V  A +RLK LA++RQ KLF A E+Q+F RD D+TISW+ EK   + S+DFGRDLASVQAL RKHE L+RDL ALE+KVN L  +A+ L   HP +   I  K++ L++ W  ++  + ER+  L+ SY L RF +D+RDL SW+T+MKA+I ADELA DVAG EAL++RH EHK EID+ ++SFK+    G+ L+   H  SE++  KL  L +E+  L++LW  RR  YEQ MDLQLFYRDTEQ + W++KQEAFL N D+GDSLDSVEAL++KHEDFEKSL+AQEEK   LD  A +L++N HYA  DV  +RD LL R++ L E+A+ R+++LEDS + Q F RD+DE+K+WI EK+KTA+DE YK+P+NLQ KVQKHQ F AE++AN+SRID ++  GQ L+D  H  S ++  R++E+   W  L+ A+++K   L +A+ QQQF RNVED+E+WL EVE  LASDD GKDL SV NLQKKH LLEAD+++HQDRID    QA QF +  HFDAD I+KKQ  +  RY  L+EP+  RK KL D+ +L Q +RD +DEE WI EKEPIA STN G+DLIGVQNL+KKHQA+QAEI GHEPRI  V  +G+ M+   H+A  D++ K+ ++ N W  LK KA +R+Q L+DSL+AQQY ADA+EAESWMREKEP+VGS ++GKDEDS EALLKKH+ALM+D+ AY S+I +L+ QA AC+ Q AP  D  GKE V+ALYDYQEK+PREV+M+KGD+LTLLNS +KDWWKVE+NDRQG VPAAYVKK+D   S    N   EQ ++  +Q+ +ENQ                    Y  LL LG  R+D L+ S + + L REAN+L QW+ EKE  A+T       LE V+  +KK D+F  + K  E +++++   A++L+  G            Q E +    G                           I +L  ++  L+++   +   L   + VQR+HR+ DE KEWIEEK+  LNT + G DL SVQ L RKH+  ERDL ALG++V  L   A  L+Q+HP   + I +   E+N  W+ L  +A+  K KL NS DLQ+FL+D+RDLMSWIN +  LVSSDELAKDVTGAEALLERH                      +EH  EIDAR+GTFQ FE FG++LL  GHYA  EI++KL+++   +  L + W+ R+  LDQCLELQL+ RDCEQAE+WM  RE+ L  +D  D   +V++LIKKHEDF++AIN+QE+K+ AL+ FADQL+  +HY +  I ++  EVL RW  LK  MI  RS+LG+ QTLQ F RD DE+E WI+EKLQ   DESYKDPT NIQ+KHQKHQAFEAEL ANA+R++ ++ +G  L ++G C G E+AV+ R+  L +QW +LVNKS +KS+KL+EAN+Q  +N G+KD +FWL EVE  L+S DYGKD ASV++LL KHQ+L  DI AHEDR+KDLN +AD  + S   D+  +++++  +N R+ K+K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LVSSEDYGRDL GV+NL+KKH+RLE E+ AHEP IQSV   G +L +++ +   +EI+++L      W EL+ L++ R  +LEES EYQ+F+  VEEEEAWI EK +L+ S DYGDTLAAVQGLLKKH+AFETD  VH D+ +D+C  G +LI   NH+   I  + + LR K+  L +AA +RK  L++NSAFLQF WK DVVESWI +KE  +K+DDYGRDLSSVQTLLTK ETFD GL++F+ EGI  IT+L +QL+ + H QS AI+ R+  LM RW++L   S  RK  LL+ QE ++KVE+L+LTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI+AL EAH  F++SL +AE DF  L++LD++I+SY V  NPYTWFTMEALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQWLQ  R+ L++G       GTLE QLEATK K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+KSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE+IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E+KPY+TK+ELY NLTK+QA++C+  M PY+   G+ +P A+D+  FT  LF N
Sbjct:    6 VKVLETADDIQERRQQVLDRYRRFKELSAMRRQKLEDSYRFQFFRRDADELEKWIQEKLQIASDESYKDPTNLQGKLQKHQAFEAEVQANSGAIIKLDETGNLMISESHFASETIRSFTPYRTAQRPIVKSVNYGNYIQTRLEELHRLWDLLLQKTKEKGVRLLQAQKLVQYLRECEDALDWITDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQAAAKLTQENHPEAELILKKQEEVNAAWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLAALEDKVNTLGGEAERLQQTHPQNASQIHLKRDELITNWEQIRTLAAERHAHLNDSYRLQRFTADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKATDEAGQALLNTGHYASEEVKEKLGILTEEKESLLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELIDGKHYASGEVATRMDEVSSQWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVARYEALKEPMAARKQKLCDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEISGHEPRIKAVTQKGEAMVEEGHFAGEDVKAKLGELNNRWDTLKGKATQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSPDYGKDEDSAEALLKKHEALMSDLSAYGSSIHALKEQAQACRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPTQSSSRENLLDEQGSIGLRQEQIENQTMVTKEVCSVSVRMKQVEELYGTLLELGEKRKDMLEKSCKKFMLFREANELQQWINEKE-GALTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVASELESEGLMAEEAPLVQAQQQEMLGSAPGKDEADSKSASPWKSIRMAVQTTANFNTIKELNNRWRALQQLAEDRSNMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVDDIQEKCTELNTAWSSLVGRADQRKDKLGNSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERH----------------------QEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIQQKLEALDRERADLEKAWVQRRMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQSFADQLISADHYAKPEIFNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTATDESYKDPT-NIQSKHQKHQAFEAELHANADRIRGVIDTGNALIQRGACAGSEDAVKSRLVALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMASNAFDTSQVKDKRDAVNGRFGKIKSMAAGRRAKLNESHRLHQFFRDLDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQ-EEIQQRLAQFVEHWKELKDLAAARGQRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGDELIKKENHHVDNITAKMKALRGKVSELERAAAQRKSKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGITNITALKDQLLAAKHVQSKAIEARHATLMKRWNQLLSNSAARKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHDAFRSSLSSAEADFNQLAELDRQIKSYQVVSNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGNVSLQEYMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTKEQADYCISHMKPYLDSKGRELPSAFDFVEFTRSLFVN 2498          
BLAST of Spectrin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 412.535 bits (1059), Expect = 3.599e-116
Identity = 278/960 (28.96%), Postives = 510/960 (53.12%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYS-DENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKS-IPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNH--PLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYG 2949
            +DI+ R  ++   +++ ++   +R+++L+ A+    F+ DAD++E W+ + ++  S DE   D  + QS N+KH+ +  EI++    L+AL +    +  +    S  +  RL+ L   + +L+ + + + + L+  L   +     +    W  EK  ++ + +  + LE +EV+Q +F  F  ++  Q  + A +   A  L+    P ++ +  K+  +       + L  ++++ L  A  IQ F  + ++T +W+ EK+ +  ++++ G DLA V AL+RK   ++RDL A++ K+  L  +A+ L++ HP+ +D I  +   +   W +LK+    R E L  +  L +FL D  D  +WL+  +  IA++++   +   E L+ +H   K+EID+  + ++  ++ GE ++T +   P    +  +L+ LD     L ++W  R  L  Q+   Q F +D  QA+ +++ QE  L + ++  +L+S E  I+ HED   ++   +EK         RL+   +  A  + +K D +  R       A+   + L+D+ + Q F +D  E+  WI EK+ TA D +Y E  NL +K QKHQ F+AE+A+N+  ++ +   GQ L+         +KE++ EL +LW++L + +++K + L  A+  + F ++  D++ W+ ++ESQ++SDD G DL SV  L KK  +LE  +   +  ++    QA     E     D +  ++  V NR+ ++  PL +R+ KL  + ++HQ+ RD +DE  W+ E+ P+A S + G +L  VQ LIKK+Q +Q EI GHEPRI ++   G+ +I         I ++++D++ +W+ +  +A  R   L++SL+AQQY  D +EAE+WM E+E  + + E  KDE S  A+LKKH  L   +E Y   I  L   +        P S+  G
Sbjct:  716 DDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGL-PDEVTVSAGVPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMGE-VVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDNTYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINEKMLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEEGQQLMVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANRAELFTQSCADLDKWVNQIESQISSDDHGNDLTSVNILIKKQQMLENQMEVRKKEVEELQSQATVLCQEGK-GRDEVDSQRLTVENRFEQVLAPLQQRRDKLLASKEVHQYIRDLEDEILWVEERMPLAASRDHGNNLQTVQLLIKKNQNLQKEIQGHEPRIEDIRERGEDLIARGSVDPEAIHERLEDLRALWATMIVEAKDRHIRLEESLKAQQYYFDVAEAEAWMSEQELYMIADEKAKDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIG 1672          

HSP 2 Score: 308.531 bits (789), Expect = 2.873e-84
Identity = 381/1713 (22.24%), Postives = 779/1713 (45.48%), Query Frame = 1
Query:  151 RRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFK-DLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQED---FPEQESLINKKKD-VEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEEL---ITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLA----EIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFV----DEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDED-STEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDY--------QEKNPREVSMRKGDVLTLLNSNHKDWW------------------------KVEINDRQGHVPAAYVKKVDAMMSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKY-EQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLN-------RKKQLDQCLELQLYLRDCEQAEDWMTIRESSL---LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKD---KCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSE--KLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDL 5094
            R++KLE   +   F R A   E+W+ E  +  + +NF  DL  +++  +KH+A+E +IAA  E + A+     ++    ++    + +R D +  LWE L  +   +   L+  L   +  + +  I+ W  E +  + S+++G+ L  VE L +K      D+  Q ++   + + A     ED    P    +++++   +E+    L +LA +R+ KL E+ ++ +FF +  +   WV EK   L+S D G+DL  V  L  +H A++ +L      + Q  ++ +E+++      D I+ +   +   W+ L+  + +R  +L V+ SL++F +D  D+  W+ D   ++++DE+  D    ++L ++H +   EI S      +   + + L   +T    +S  + ++LE L++    L++L   R+   +  + L   Y + E  E WI ++  +L   DV + L+ +E +  + E FE  + +Q  +   ++ +A +L+  GH +  D+  K+D L    S+  E    +K +L  + + Q F  + +E KAWI EK K    E+ +E  N  + V   Q  L+    ++AA ++++ D++   + L   +  + + I  R+ E++++W++L    + +E++LG+AS  QQF+R+++D + WL++ ++ +AS+D    L     L  +H  ++ +I ++QD         +       D Q+     + ++   +   + +L +  + R   L+ ++    F +DA   + ++  +E + G   +   L   +  IK H+ +   +  ++ +I+     G++++  D+     I++K+D +       +  A+     L D+ + Q++L D  E   W+ EK  ++ + +   DE  +     +KH A MA++ + +  ++ +  +     M E P ++   KE +  L++         Q K  R     + ++ T   ++   W                         K ++ + Q  V    V+++ +  + +      +  V SQ+  +EN++E +L+  + RRD+L  S + +Q +R+  D   WV E+  +A +      +L+ VQ   KK      E +  E +I++++++   L   G  +  E I   +  L+  +   + E   R ++ LE+    Q+Y+ +  EA+ W+ E++  +   +  KD  S   + +KH  LE+ +    + +  L   +  LV +   E+E I   Q + ++++  L   AE+ + +L     L +   +  DL  WI     +  S EL +D      L ER             +F  D   IG+E       R  +     D    L++ GH           S+AD K+ LNE W +       R + L    EL  +  D  +    +  ++  L   LG   D  TV+SL +KH  F   I     +++ L+E A++L     Y  + ++D   + +EV+  W  L +   A + RL D      F     ++ +W+   ++    +      ++++     HQ  +AE+    +   +++  G+ L  +      E  ++E++ +L D+   +V+K ++++   KL     Q   +AG+   E WL   E  +++ + G+    V+ LL +H+     +   ++R   L
Sbjct:  419 RQEKLEQLARR--FDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDAYKPCDSHVVSERATHLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGLPDEVT----VSAGVPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVI--ESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMGEVVTRDQSDPQYM---FLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDNTYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINEK--MLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEEGQQL-MVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANRAELFTQSCADLDKWVNQIESQISSDDHGNDLTSVNILIKKQQMLENQMEVRKKEVEELQSQATVLCQEGKGRDEVDSQRLTVENRFEQVLAPLQQRRDKLLASKEVHQYIRDLEDEILWVEERMPLAASR-DHGNNLQTVQLLIKKNQNLQKEIQGHEPRIEDIRERGEDLIARGSVDP-EAIHERLEDLRALWATMIVEAKDRHIR-LEESLKAQQYYFDVAEAEAWMSEQELYMIADEKAKDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIGLRQSQADKLYAGLKDLAEERRGRLEERHKLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLSERF-----------AEFARDTATIGQE-------RVDSVNRIAD---ALIEAGHSDS-------ASVADWKDGLNEAWADLLELIDTRTQMLAASYELHRFNHDAREVLSRINEKQMQLPEELGR--DQNTVESLQRKHTTFENDIQALGVQVKVLQEDAERL--RGSYAGEKVEDIERREEEVVTAWKGLLDACEARKLRLADTGEKFRFFSLVRDLMLWMENTIRQINAQEKPRDVSSVELLMNNHQGIKAEIDTRNDNFTTVIELGKSLLARQHYATDE--IKEKLGQLTDKRKEMVSKWEERAHWLKLILEVHQFARDAGVA--EAWLLAQEPHITTQEVGESVDEVEQLLKRHEAFEKSVSTWDERFNVL 2078          

HSP 3 Score: 254.603 bits (649), Expect = 7.558e-68
Identity = 209/821 (25.46%), Postives = 408/821 (49.70%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAA-QEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHN-KSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEI 2544
            IQE+ + +  R+   +   E+   +L+D +  Q F +D  EL  WI EK+ T  D ++ +  NL +K QKHQA   E+A+  E L  +D+ G  ++        +++ +L +LH LW++L N  + K++ L        F +   ++  W  + E+ ++S++ G DL  V +L KK       +E ++++  E+ S+A  L QE     E + +++  VE+  E++    ++R+ KL  + E+ ++ RD +  I WV E+     S D G +L +VQ L +K++ L +++   E ++  + +  ++L  +     + I ++ E L + W+ +  ++ +R+ +L+ S    ++  D  +  +W+++ +  + ADE AKD     A++++H   +  +++  +           L+T  HP SE I  +  + DK    L  L  ERR   E+   L    R+ +  E WIA++E    ++++G   + V  L  +  +F +  A   +E+   ++ IA+ L+E GH  +A V   +D L    ++L E    R   L  S+    F+ DA E+ + I EK     +E  ++   ++S  +KH  F  +I A   ++  ++   + L  S    K EDI+ R EE+   W  L+ A + ++  L     + +F   V D+ +W+     Q+ + +  +D++SV  L   H  ++A+I +  D   + ++     +  QH+  D IK+K  +++++  ++    ++R   L    ++HQF RDA   E W+  +EP   +  VG  +  V+ L+K+H+A +  +
Sbjct: 1249 IQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINEKMLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEEGQQLMVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANRAELFTQSCADLDKWVNQIESQISSDDHGNDLTSVNILIKKQQMLENQMEVRKKEVEELQSQATVLCQEGKGRDE-VDSQRLTVENRFEQVLAPLQQRRDKLLASKEVHQYIRDLEDEILWVEERMPLAASRDHGNNLQTVQLLIKKNQNLQKEIQGHEPRIEDIRERGEDLIARGSVDPEAIHERLEDLRALWATMIVEAKDRHIRLEESLKAQQYYFDVAEAEAWMSEQELYMIADEKAKDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIGLRQSQADKLYAGLKDLAEERRGRLEERHKLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLSERFAEFARDTATIGQERVDSVNRIADALIEAGHSDSASVADWKDGLNEAWADLLELIDTRTQMLAASYELHRFNHDAREVLSRINEKQMQLPEELGRDQNTVESLQRKHTTFENDIQALGVQVKVLQEDAERLRGSYAGEKVEDIERREEEVVTAWKGLLDACEARKLRLADTGEKFRFFSLVRDLMLWMENTIRQINAQEKPRDVSSVELLMNNHQGIKAEIDTRNDNFTTVIELGKSLLARQHYATDEIKEKLGQLTDKRKEMVSKWEERAHWLKLILEVHQFARDAGVAEAWLLAQEPHITTQEVGESVDEVEQLLKRHEAFEKSV 2068          

HSP 4 Score: 228.794 bits (582), Expect = 5.305e-60
Identity = 179/757 (23.65%), Postives = 364/757 (48.08%), Query Frame = 1
Query:  706 PEQESLINKKKDVEDALERLKNLAKKRQ----QKLFEAHEIQKFFRDTDKTI----SWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERH-----------------NEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLK-TASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTN-VGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLR 2895
            P +  L+N   ++  A ERL+    +R+     +L    ++++  R  D+      +W++E    +T ++FG DL +V+A  +KHEA++ D+ A EE+V  +   A EL  +       +  +++ +L  W +L++    R  +L+ + +L R   +   ++ W+ +MK  + + +  K + GVE L+++H                 N       S D+++K C +         H +SE   +  ER  +    L  L  ERR   E++  L  F+ +  + E W+ ++E  L + DVG  L  V  L+ +H   E  L  +    ++       + + GH+ A D+  +  ++ +  ++LE+ A  RK  L+ + +   F  DAD+I+ W+ + L+  +SDE   +  + QS  +KH++   EI++    +D +  + Q L D     S  + +R+E L++ + +LV  S+V+++ L  A    +     E  E+W+ E    L + D  + L  +  +Q +    E +++S   RI    Q A Q +   H     IK KQ+ +++ +   +E +D++K  L+ A  +  F+ + ++ + WI EK  +  ST  +G DL GV  L +K   ++ ++   + ++ ++  E +++ +        I  ++ ++  +W +LK     R++ L ++ + QQ+L D  + ++W+ + +  + S +        E LL +H+A+  +I+ Y+     +R
Sbjct:  386 PREGKLVN---EINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDAYKPCDS---------HVVSERATHLEERYAE----LCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGLPDEV-TVSAGVPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMR 1125          

HSP 5 Score: 228.409 bits (581), Expect = 7.369e-60
Identity = 237/981 (24.16%), Postives = 459/981 (46.79%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTY--SDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLE-YQEE-----KAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNE--------RRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSK---VQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQ--AIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETV 2961
            +DI+ +++ + + +S F+E  +++++ L  A   Q F  + +E ++WI EK +    + E   DL  + +  +K   +E ++AA    L  L      +   H    + I  RL +++ +W+ L    + +   L       QFLR +D+   W  + +T + SE+    L   E L  +      +++ YQ++        E+ ++     Q D P+   L  + + ++     L  + + R   L ++H  Q F +D  +   +++ +   L   +    L S +   + HE +   +   +EK+    +    L  +     D IQ+K +++       +  + +   +L  +  L RFL D ++L  W+ + K + A D    +   +    ++H    +E+ S  E  +    EG++L+ +  P +E +V   E+L +    L +LW+E         + L++ N   +LF +     + W+ + E+ + ++D G+ L SV  LI+K +  E  +  ++++ + L + A  L + G     +V+ +R  +  R   +    + R+  L  S     + RD ++   W+ E++  A+  ++    NLQ+    ++K+QN   EI  +E RI+D++ RG++L+       E I ER+E+L  LW  ++  +K +   L ++   QQ+  +V + E W++E E  + +D+  KD  S   + KKH +LE  + ++ D I    + +   V  +H +++ I  +Q++    Y  L++  ++R+ +L + +KL Q  R+ DD E WI E+E +AGS  +G+D   V  L ++    A     IG E R+  V      +I A H     +    D +   W+DL    D R Q+L  S E  ++  DA E  S + EK+ +    E G+D+++ E+L +KH     DI+A    +  L  Q DA +++      SY  E V
Sbjct:  927 QDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMGEVVTRD----QSD-PQYMFLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDNTYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINE-KMLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEEGQQLM-VEKPETEPMVK--EKLSE----LHELWDELENTTQLKAQRLFDANR-AELFTQSCADLDKWVNQIESQISSDDHGNDLTSVNILIKKQQMLENQMEVRKKEVEELQSQATVLCQEGK-GRDEVDSQRLTVENRFEQVLAPLQQRRDKLLASKEVHQYIRDLEDEILWVEERMPLAASRDHG--NNLQTVQLLIKKNQNLQKEIQGHEPRIEDIRERGEDLIARGSVDPEAIHERLEDLRALWATMIVEAKDRHIRLEESLKAQQYYFDVAEAEAWMSEQELYMIADEKAKDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIGLRQSQADKLYAGLKDLAEERRGRLEERHKLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLSERFAEFARDTATIGQE-RVDSVNRIADALIEAGHSDSASVADWKDGLNEAWADLLELIDTRTQMLAASYELHRFNHDAREVLSRINEKQ-MQLPEELGRDQNTVESLQRKHTTFENDIQALGVQVKVL--QEDAERLR-----GSYAGEKV 1881          

HSP 6 Score: 223.016 bits (567), Expect = 3.212e-58
Identity = 159/514 (30.93%), Postives = 272/514 (52.92%), Query Frame = 1
Query:   79 PEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDL-EYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSK-DTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEK 1611
            PE I ER E +   ++      ++R  +LE++ K Q +  D  E E+W+ E+ +   +DE  KD  +  +  +KHQ LE  +   S+ ++ L +   +++ + H  SE I  R  Q   L+  L ++ +E+   L+      Q  R VD++  W  E+E    S E GQD EHV +L ++F EF +D     +E+   +   AD L++    +  S+ + K  + +A   L  L   R Q L  ++E+ +F  D  + +S +NEK + L  E+ GRD  +V++L+RKH   + D+ AL  +V  L +DA+ L   +   K + I+ ++E +++AW  L      R  +L  +    RF S  RDL+ W+ +    I A E  +DV+ VE LM  H   K+EID+R+++F +    G+ L+   H  +++I  KL +L  +R  ++  W ER    +  +++  F RD   AEAW+  QE  +   +VG+S+D VE L+++HE FEKS++  +E+
Sbjct: 1562 PEAIHERLEDLRALWATMIVEAKDRHIRLEESLKAQQYYFDVAEAEAWMSEQELYMIADEKAKDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIGLRQSQADKLYAGLKDLAEERRGRLEERHKLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLSERFAEFARDTATIGQERVDSVNRIADALIEAGHSDSASVADWKDGLNEAWADLLELIDTRTQMLAASYELHRFNHDAREVLSRINEKQMQL-PEELGRDQNTVESLQRKHTTFENDIQALGVQVKVLQEDAERLRGSYAGEKVEDIERREEEVVTAWKGLLDACEARKLRLADTGEKFRFFSLVRDLMLWMENTIRQINAQEKPRDVSSVELLMNNHQGIKAEIDTRNDNFTTVIELGKSLLARQHYATDEIKEKLGQLTDKRKEMVSKWEERAHWLKLILEVHQFARDAGVAEAWLLAQEPHITTQEVGESVDEVEQLLKRHEAFEKSVSTWDER 2074          

HSP 7 Score: 218.394 bits (555), Expect = 9.182e-57
Identity = 228/960 (23.75%), Postives = 425/960 (44.27%), Query Frame = 1
Query: 3523 YEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQ----THPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWM--TIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQ--NTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQE-NAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSL-SSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADK--ETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSL 6366
            +E L+E+   +   LE   A+QR  +E     +W++E   RL + D GK L  V+ L +KH  +E D+    +RVK +++ A           P ++  + +    + E + +L + A + + KL  S  L +F  +  +L  W+     L+SS ++ KD+TG   LL +HR +  E+  R+ D    ++ + E                   G+E+   GH+  ++I+ ++  +      L +    RK++L     L  +  D +  E WM  T+R  S      D+ +  SL KKH+D    I+     + AL E A  L + E     G+ D+ + +  R+  L E     + RL D   L     +A+  E+WI+EK Q  N +D   K    +++    + + FE E+ + A R+  +    ++L   G    Q+  A ++ +N +   +  LV++ K   E L  A     ++    + + W+ E    + S+ + G D A V +L  K   +  D+ A + ++ DL   A+          D I  R   IN+ ++ +K+  +NR  +LG+A KL  F R +DD + W+ + +  ++SED    L     L  +H+ ++NEI  ++   Q +   G  +  +        + ++L+ L+T W EL ++   R + L +S  +Q FL    + + ++  ++++L   +   TL + +  +K H+   T M  +++K       G++L+ ++N  A  I+++ + + E+    R  A      L+DN    +F+     +  WI +K    Q  S D  R+L    T   KH+ F   L S + E +E I     QL+         +K +   L + WD+L+  ++ +   L           EL   F +  +  + W    E  ++     N L  +  L +     +N +
Sbjct:  513 WEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDAYKPCDSHVVSERATHLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADL---KQTVRE-------------------GEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGLPD-EVTVSAGVPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEK--LEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKK---EALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMGEVVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDNTYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINEKMLTAQDMSYDEARNL---HTKWQKHQAFMAELASNK-EWLEKIDEEGQQLMVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANR-----AEL---FTQSCADLDKWVNQIESQISSDDHGNDLTSVNILIKKQQMLENQM 1432          

HSP 8 Score: 188.348 bits (477), Expect = 1.032e-47
Identity = 207/918 (22.55%), Postives = 417/918 (45.42%), Query Frame = 1
Query: 3505 TQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSLIKKH--EDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEK---LQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHED---RIKDLNERADEFIESGTCDSDT--IRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYG-DTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAA-LRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEEL 6222
            T L+++Y +L  +   +   LE+   + R+  E  E + W+ EK+  L++ DVGKDLT V RL  +H A+E +L      +K    +  E+       A+ I     E++ +W  L   A   K +L  +  L +F AD  D+  W+     +VSSDE+  D    ++L ++H+D+  EI++          P+       +DA     Q   D  +  +  G      + ++L+++     +L E    RK++L   L L     + E  E W+  +   L   DV +K  D  + +H  E F   +N Q  ++  + + A QL+   H  +  IK K   + + W   +E +   +  L    ++Q F  + +E + WI EK   +++T  +   +    + A  +K    E +LAA   +L  + G  +RL        QE+A+  R+ ++   WD L    +++ E L EA++   +   L D + WL + + +++S D        + LL++H+ +  +I  ++D   R++D+     E +     D     + +R + ++  + ++ ++ ENR   L ++     F +     + ++  ++ ++   +    L       K H+ +   +  ++  I    + G  L+ E      D+I+ K++ ++    + +  +     +L+++ + Q+FL   +E   WI EK  +L++ D   D    +    +KH AF  ++  +++    I  EGQ+L+ +       ++++   L E  D L     L+ +   + N A L F      ++ W+   E+Q+ SDD+G DL+SV  L+ K +  +  +E  R + +E + S    L +    + +    R   + +R++++    ++R+D LL  +E ++ + +L
Sbjct:  617 THLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISS--------YRPV-------LDALHEQAQGLPD--EVTVSAG------VPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIEST--QELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERL--ASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMG----EVVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDN-TYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINEK--MLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEEGQQLMVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANRAEL-FTQSCADLDKWVNQIESQISSDDHGNDLTSVNILIKKQQMLENQME-VRKKEVEELQSQATVLCQEGKGRDEVDSQRL-TVENRFEQVLAPLQQRRDKLLASKEVHQYIRDL 1497          

HSP 9 Score: 184.496 bits (467), Expect = 1.631e-46
Identity = 207/900 (23.00%), Postives = 394/900 (43.78%), Query Frame = 1
Query: 3928 DLMSWINTMNALVSSDELAKDVTGAEALLERHRDL-AVEIANRTGDFG-------IDQEPIGEEHHAEIDARSGTFQN-FEDFGKELLKTGHYAE----NEI--KEKLQSIA---DAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQ--ENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLAN--PDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKS-DDYGRDLSSVQTLLTKHETFDTGLESFR-----IEG-IEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWF--TMEALEETWKNLQRIIQERDAEL 6525
            +L+ WI     ++++ + A  +TG +  L+       VE  N+  + G         Q  +   +      R G   N      + L K  H  E    NE+  +EKL+ +A   D K  L E WL+  ++L                     + + +     VD   V++  KKHE     I   E+++QA+ + A +L   ++++   +  +   VL  W  L+E + A R RL     LQ   ++   +  W++E     L + Y      ++   QKH   EA++   A+R++++  + QR   +         + V ER   L +++  L + + ++  KL+E+ +   +   + ++E W+ E E  LSS D GKD   V  LL +H+ +  +++     +K      +E  ++G   +D IR R   ++  +  ++ LA  R   L  A+ L+ F    DD E W+ +   +VSS++ G D    ++L KKH+ +  EI ++ PV+ ++ +Q   L +E  ++   PD    +LE LE  + EL +LS +RK +L+++    K     E  E WI EK   L++ D  + L  ++ +  + + FE +M     +   +    ++L+   + + + I+ + + L       R+   ++K  L    +   F  + +  ++WI +K   ++S  + G DL+ V  L  K    +  L + +     ++G  E + S+H +       Q DAI  R   +   WD L+   + R++ L    KLQ+           F +    F +W   A+  +      N+L E + L   H   KN +   ++D+  +  +  E+ +       Y +    ++AL+  W  L ++ + R + L
Sbjct:  316 ELLEWIEQTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVNEINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSENQRL---------------------VTQDNF---GVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDAYKPCDSHVVSERATHLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGLPDEVTVSAGVPD----RLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPE-------QEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQ-----------FLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMG-EVVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENRHSLL 1168          

HSP 10 Score: 179.874 bits (455), Expect = 4.569e-45
Identity = 123/411 (29.93%), Postives = 221/411 (53.77%), Query Frame = 1
Query: 1699 LIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYK-EPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLW---NDLVSASKVK-EKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDE----QHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQA 2904
            LIR+  LE+ A+              FDR A   + W+ E  +  + +N+  +   +++  +KH+   A+IAA E R+  V +  + L   ++++   +  R + + +LW    +L++A + + E NL      Q+ +  V+    W+ E++ +L S D GK L  V +L +KH L+EADI+   DR+ +    A +F  E    +  D+  + ++   +  RY +L     +R+ KL ++ KL +F+ +  + E W+ EKEP+  S +VG+DL GV  L+ +H+A++ E+ G    + +   EG++M +A H+   DI  ++ +M  +W+ L++ A +RK+ L  +    Q+ ADA + E WM +   +V S E G DE ST++L KKH  +  +I +YR  +D+L  QA
Sbjct:  417 LIRQEKLEQLARR-------------FDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVD----WMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDAYKPCDSHVVSERATHLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQA 810          

HSP 11 Score: 168.703 bits (426), Expect = 1.025e-41
Identity = 166/821 (20.22%), Postives = 373/821 (45.43%), Query Frame = 1
Query: 3583 VQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREK-KILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHEL--MNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLI-DDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLES 6027
             +R+ R+    + W+ E    +   + G DL +V+   +KH+A+E D+ A  ERV+ +   A EL     +E   +   ++ +  +W  L       + +L  ++ LQ+   +   ++ W++ M   + S +  K + G E LL++H  +  +I             +  +    ++A +  F + +D  K      H     + E+   + +   +L      R+ +L++  +L  +  +  + E W+  +E  L   DV  D   V  L+ +H      +N +   ++      +++ +  H+  D I+ +  E+   W SL++     + RL   ++L  F  DAD++E+W+ + L+    +       + Q+ ++KH+    E+++    L ++    Q L ++         V +R+  L  ++  LV  S+ + ++LQ+A       +  +  E W+ E    L++ D  +    ++ +  + +    ++++   RI  +N+ A + + +G      I+ ++  +N  +   ++L + +   L  A  + +F+   ++ +AWIREK K++ S+++ G DL GV  L++K   +E ++ A +  +  ++ +   L  M+  Q    D I  +L  +   W  L++    R+  L E+S+ Q+FL  +++ + W+ + Q  ++S D  +TL   + LL +H+A + ++  ++D    + + G+ +  D ++     + QR + L    + L K    R   L  +  F  F+      + +++++E  +   +    L S +  +  HE   T +++
Sbjct:  427 ARRFDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADIT------------VQADRVKAVNAAAQRFSSEDDAYKPC--DSHV----VSERATHLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGLPDEVTVSA---GVPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQ---EDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMGEVVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDT 1223          

HSP 12 Score: 165.622 bits (418), Expect = 9.684e-41
Identity = 212/952 (22.27%), Postives = 412/952 (43.28%), Query Frame = 1
Query: 3565 LEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIA-NRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGED--VDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHA-HEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDD-NNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQER---YKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYL 6396
            L   +  Q + ++  +A  ++  ++  L   ++   L S +   + H+ +   +    E++         L+      A+ I +  + I+E   K    AED   +L ++ DLQ+FL D ++L  WIN    L + D    +        ++H+    E+A N+     ID+E                       G++L+      E  +KEKL  + +  ++L      + ++L      +L+ + C   + W+   ES +  +D   D  +V+ LIKK +     + +++ +++ L+  A  L + E   +D +  +   V  R+  +   +   R +L   + +  +IRD ++  +W+ E++       + +    +Q   +K+Q  + E+  +  R++ I   G+ L  +G       A+ ER+  L   W  ++ ++KD+  +L+E+ +   Y   + + E W+ E E  + + +  KD  S  ++L KHQ+L   +  + D I  L+E +   + S   +S+ I  R+   ++ Y  +K LAE R   L +  KL    R +DD E WI E++++  S + G+D   V  L ++      +     +  + SV +    L+ E+  ++   +    + L  AW +L +L   R   L  S E  +F     E  + I EKQ  L   + G     V+ L +KH  FE D++    +   +  + ++L         + IE+R E +      L  A   RK  L D     +F      +  W+ +   Q+ + +  RD+SSV+ L+  H+     +++ R +    +  L   L+   H  +D IK +   L D          +RK+ + K +ER    K + E++  FA+ A    +W    E  +T      S++E++ L + H  F+ S+   +E F  L
Sbjct: 1168 LSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDNTYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINE-KMLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEE-----------------------GQQLMVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANRAELFTQSCADLDKWVNQIESQISSDDHGNDLTSVNILIKKQQMLENQMEVRKKEVEELQSQATVLCQ-EGKGRDEVDSQRLTVENRFEQVLAPLQQRRDKLLASKEVHQYIRDLEDEILWVEERMPLAASRDHGNNLQTVQLLIKKNQNLQKEIQGHEPRIEDIRERGEDLIARGSV--DPEAIHERLEDLRALWATMIVEAKDRHIRLEESLKAQQYYFDVAEAEAWMSEQELYMIADEKAKDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIGLRQSQADKLYAGLKDLAEERRGRLEERHKLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLSERFAEFARDTATIGQERVDSVNRIADALI-EAGHSDSASVADWKDGLNEAWADLLELIDTRTQMLAASYELHRFNHDAREVLSRINEKQMQLPE-ELGRDQNTVESLQRKHTTFENDIQALGVQVKVLQEDAERLRGSYAGEKVEDIERREEEVVTAWKGLLDACEARKLRLADTGEKFRFFSLVRDLMLWMENTIRQINAQEKPRDVSSVELLMNNHQGIKAEIDT-RNDNFTTVIELGKSLLARQHYATDEIKEKLGQLTD----------KRKEMVSKWEERAHWLKLILEVH-QFARDAGVAEAWLLAQEPHITTQEVGESVDEVEQLLKRHEAFEKSVSTWDERFNVL 2078          

HSP 13 Score: 68.9366 bits (167), Expect = 2.056e-11
Identity = 72/288 (25.00%), Postives = 139/288 (48.26%), Query Frame = 1
Query: 5245 DFYRTIDDEEA-WIREKKILVSSEDYGRDLIGV----------RNLKKKHQRLE-NEIHAHEPVIQSVEKQGHELM---NESQLANPDEIKRKLEHLETAWVELQQLSS----IRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGI 6045
            D Y T+  E   WI +  I++++  +   L GV          R ++K ++  E   +      IQS  +  ++ +    E +L N  EI +  E LE A  E ++L+     IR+ KLE+ +  ++F       E W+ E Q L++  ++G  L AV+   KKH+A E D+  +E++   + +  ++L  ++ H  + +  R + +    + L++    R+H LE N A  +   +   +  W+ + + ++ S DYG+ L  V+ LL KH     D  +++ R++ +
Sbjct:  308 DKYETLASELLEWIEQTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVN--EINKAWERLEKAEHE-RELALRNELIRQEKLEQLA--RRFDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAV 590          
BLAST of Spectrin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.493 bits (724), Expect = 5.325e-80
Identity = 169/497 (34.00%), Postives = 278/497 (55.94%), Query Frame = 1
Query: 5884 QFMWKTDVVESWIADKETQVKSDDY-GRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQ----SYGV---GGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQG----VRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLF 7338
            +F  K  + E+W A KE  ++  DY    L+ ++ LL KHE F++ L + + + +E I ++  +L E ++    ++  R Q++   WDKL   ++RRKD L + ++  + +++LYL FAK+A+ FN+W + A EDL D    ++++EI+ L  AH  FK++L  AE++   +  +  EIQ    +Y V   G NPY+  T   +   W+ + + +  RD  L     RQ+ N+ LR++FA  A+    W+Q     +    +E  GTLE+QL   +   + + + K ++ ++E +  +++E LI DN+HT ++   +   W+QL     R  + +E QI  R+  G+S+E + EF   F HFDKD SG+L   EFK+CL +LG D+   ++G+   EF  I++VVDPN  G VT Q F+ FM +RET +  +  +V  +F  L  + K +IT  EL   L  DQAE+C+  M PY       +P A DY +F+  L+
Sbjct:  362 KFRQKAKIHEAWTAGKEAMLEKRDYDSVSLTELKALLRKHEAFESDLAAHQ-DRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRKDTLERTEKVLETIDQLYLEFAKRAAPFNTWMDGAVEDLQDMFIVHTIDEIQGLISAHEQFKDTLPEAEKEKSAILGVHNEIQKVAQTYNVKLAGPNPYSAITPHDISSKWERMTQQVPLRDDSLRDLLARQQANETLRRQFAASANIVGPWIQTKMEEIGHISIEMHGTLEDQLNQLRRYEQNIINYKPNIDKLESEYQLVQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVETQILTRDAKGISQEQMHEFRASFNHFDKDHSGKLGAEEFKACLISLGYDVGNDQQGEA--EFARIMTVVDPNNTGLVTFQSFIDFM-TRETTDTDTADQVIASFKILAGD-KNFITADELRRELPPDQAEYCIARMAPY--RGPDAVPGALDYMSFSTALY 851          

HSP 2 Score: 83.1889 bits (204), Expect = 6.669e-16
Identity = 93/382 (24.35%), Postives = 163/382 (42.67%), Query Frame = 1
Query: 5563 QKFLDTVEEEEAWILEKQHLLSSTDYGD-TLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLED--------NSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGL-----ESFRIEG----IEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKAL-CEAHSHFK---NSLKAAEEDFM-YLSQLDK------EIQSYGVGGNPYTWFTMEALEETWKNL----QRIIQERDAELI-RETK--RQEENDVLRQEFAHMADKFH 6600
            +KF    +  EAW   K+ +L   DY   +L  ++ LL+KH+AFE+D+  H+D+   I    Q+L + + H+  ++  RC+ +  + D L     RRK  LE         +  +L+F  +     +W+      ++       +  +Q L++ HE F   L     E   I G    I+ +   +N  +   +  S    H   ++  +W+++ ++   R D L  L  R +  E L   FA  A+    W +              +EEI  +  E H   +   N L+  E++ + Y   +DK       +Q   +  N +T +TME +   W+ L     R I E + +++ R+ K   QE+    R  F H  DK H
Sbjct:  361 EKFRQKAKIHEAWTAGKEAMLEKRDYDSVSLTELKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRKDTLERTEKVLETIDQLYLEFAKRAAPFNTWMDGAVEDLQDMFIVHTIDEIQGLISAHEQFKDTLPEAEKEKSAILGVHNEIQKVAQTYNVKLAGPNPYSAITPH---DISSKWERMTQQVPLRDDSLRDLLARQQANETLRRQFAASANIVGPWIQ------------TKMEEIGHISIEMHGTLEDQLNQLRRYEQNIINYKPNIDKLESEYQLVQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVETQILTRDAKGISQEQMHEFRASFNHF-DKDH 726          

HSP 3 Score: 55.8398 bits (133), Expect = 1.407e-7
Identity = 35/92 (38.04%), Postives = 52/92 (56.52%), Query Frame = 1
Query: 1483 EAWIAKQEAFLENNDVGD-SLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLE 1755
            EAW A +EA LE  D    SL  ++AL+RKHE FE  LAA +++ +++  IA  L E  ++  A VN +  D+      L +  + RK +LE
Sbjct:  371 EAWTAGKEAMLEKRDYDSVSLTELKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRKDTLE 462          
BLAST of Spectrin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004478.1 (pep scaffold:Pmarinus_7.0:GL493983:47:4449:1 gene:ENSPMAG00000004079.1 transcript:ENSPMAT00000004478.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.631 bits (566), Expect = 2.971e-62
Identity = 140/470 (29.79%), Postives = 245/470 (52.13%), Query Frame = 1
Query: 1534 DSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQ--QYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVS 2937
            DS+ + E+L+++H +FE  L A +   + L   A  LV++G      + +K   ++ R++ +++ +  R++ LE ++ YQ+F R+A E+ AW+ EK   A DE+Y++ + L  ++++      E+  N+  +  V+  G++L+   H  S +I+  +EEL   W +L      + + L QA  Q+Q  + ++D    L  +E+QL S+D G DL S   L   H   EA + S  +RI + + Q +   D  HFD+ GI+++  E   R   L EP  KR+ +L +A + ++  R  + E  WI E+ P A S + GR L   Q L+++   +QAE   H P +  V   G  M  A+H   RD+ ++ ++++  W  L    + R++LL  +  A   Q  A+A+E E W+ E+     S E G+DED+   L+ +H  L  ++E     +D L   A   K + AP +
Sbjct:    1 DSVGATESLLKRHAEFENRLGAMDRPIRHLKKHAAELVKSGVAPPDGLEQKVGAVVARRNAVQDASDRRRALLEAAYKYQVFTRNAAELLAWVAEKRVLADDESYRDLSLLSRELKRQNAAEGELRTNQQALAAVQEVGRDLVKGRHFASREIQATLEELHARWAELEKKMTERGRKLRQAVDQRQLNQLLQDARERLDALENQLRSEDVGTDLRSSKTLLAHHVHTEAALDSLVERILAVVAQGESLAD-GHFDSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPLARDVTRRCEEVRAAWDALLRALENRRRLLALAERAHTTQASANAAELEVWLAERAEQARSDECGRDEDAARNLIARHKDLEQEMEVNGRLVDELVRAARELKAEGAPTA 469          

HSP 2 Score: 137.887 bits (346), Expect = 8.815e-34
Identity = 123/521 (23.61%), Postives = 243/521 (46.64%), Query Frame = 1
Query:  904 LASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIA-NRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA-SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQA--SGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEK 2454
            + + ++L ++H   +  L A++  +  L K A EL        D ++ K  A+++  + ++  S  R   L+ +Y    F  +  +LL+W+ + K V+A DE  +D++ +   ++R N  + E+ +  ++  + +  G +L+   H  S +I   LE L      L +   ER     Q +D +   +  + A   +   E  L + DVG  L S + L+  H   E +L +  E+   L  +A    + +GH+ +  + ++  +   R + L E    R++ LE++  Y    R  ++  AWI E++ +A S +  +     Q  +++     AE  A+   +  V   G  +  + H  + D+  R EE+   W+ L+ A + + + L  A  +   Q   N  ++E+WLAE   Q  SD+CG+D ++  NL  +H  LE ++  +   +D  ++ A +   E    A  +  + +E+  +   L++   +R  +L  A  LH + R+  D E+WI ++
Sbjct:    3 VGATESLLKRHAEFENRLGAMDRPIRHLKKHAAELVKSGVAPPDGLEQKVGAVVARRNAVQDASDRRRALLEAAYKYQVFTRNAAELLAWVAE-KRVLADDESYRDLSLLSRELKRQNAAEGELRTNQQALAAVQEVGRDLVKGRHFASREIQATLEELHARWAELEKKMTERGRKLRQAVDQRQLNQLLQDARERLDALENQLRSEDVGTDLRSSKTLLAHHVHTEAALDSLVERI--LAVVAQGESLADGHFDSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPLARDVTRRCEEVRAAWDALLRALENRRRLLALAERAHTTQASANAAELEVWLAERAEQARSDECGRDEDAARNLIARHKDLEQEMEVNGRLVDELVRAARELKAEGAPTAQELPARADEIQAKMTDLRQLSAERLGRLEGALALHAYLRECADLEEWISQQ 520          

HSP 3 Score: 131.724 bits (330), Expect = 1.085e-31
Identity = 123/491 (25.05%), Postives = 232/491 (47.25%), Query Frame = 1
Query:   76 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEK----ETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTK-DADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLH--RFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHN--EHKSEIDSR--DESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFL 1515
             P+ ++++   V+ R +A ++A++ RR  LE A KYQ F R+A EL +W+ EK     DE+++DL+ L  + ++  A E E+    + L A+ + G D+++  H+AS  IQ  L++LHA W +L     E+ R L+  +D     R+++++L   +E+    E  + SE+ G DL   + L          L+   E+   + ++ + L    F +   +  + ++ +  L  L     KR+ +L EA    +  R  ++  +W+ E+     S D GR L + Q L  +   L  +  A    V ++    A   + +HP ++D +  + E + +AW  L +    R   L ++   H  +  ++  +L  WL +      +DE  +D      L+ RH   E + E++ R  DE  ++ +    EL     P ++++  + + +  +   L QL  ER    E  + L  + R+    E WI++Q A +
Sbjct:   44 PPDGLEQKVGAVVARRNAVQDASDRRRALLEAAYKYQVFTRNAAELLAWVAEKRVLADDESYRDLSLLSRELKRQNAAEGELRTNQQALAAVQEVGRDLVKGRHFASREIQATLEELHARWAELEKKMTERGRKLRQAVDQ----RQLNQLLQDARERLDALENQLRSEDVGTDLRSSKTLLAHHVHTEAALDSLVERILAVVAQGESLADGHF-DSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPLARD-VTRRCEEVRAAWDALLRALENRRRLLALAERAHTTQASANAAELEVWLAERAEQARSDECGRDEDAARNLIARHKDLEQEMEVNGRLVDELVRAAR----ELKAEGAPTAQELPARADEIQAKMTDLRQLSAERLGRLEGALALHAYLRECADLEEWISQQLATV 524          

HSP 4 Score: 129.028 bits (323), Expect = 8.498e-31
Identity = 130/528 (24.62%), Postives = 242/528 (45.83%), Query Frame = 1
Query: 4375 TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHEL-MNESQLANPDEIKRKLEHLETAW-VELQQLSSIRK-TKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKS 5949
              +SL+K+H +F   +   +  ++ LK+ A +LV+      DG++ K   V+AR  ++++     R+ L      Q F R+A E+  W+ EK     DESY+D +  +  + ++  A E EL  N + L ++   G+ L +      +E  ++  + +L  +W  L  K  ++  KL++A  Q   N  L+D    L  +E+ L S D G D  S  +LL+ H      + +  +RI  +  +  E +  G  DS  I+   +   +R   + +    R   L +A + ++  R ++ E AWI E+     S D GR L   + L ++  +L+ E  AH P +  V   G  +   E  LA   ++ R+ E +  AW   L+ L + R+   L E +   +      E E W+ E+     S + G    A + L+ +H   E +M+V+    +++    ++L  +    A+ +  R + ++ K+  LR+ +  R   LE   A   ++ +   +E WI+ +   V +
Sbjct:    5 ATESLLKRHAEFENRLGAMDRPIRHLKKHAAELVKSGVAPPDGLEQKVGAVVARRNAVQDASDRRRALLEAAYKYQVFTRNAAELLAWVAEKRVLADDESYRDLSL-LSRELKRQNAAEGELRTNQQALAAVQEVGRDLVKGRHFASRE--IQATLEELHARWAELEKKMTERGRKLRQAVDQRQLNQLLQDARERLDALENQLRSEDVGTDLRSSKTLLAHHVHTEAALDSLVERILAVVAQG-ESLADGHFDSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPLAR--DVTRRCEEVRAAWDALLRALENRRRLLALAERAHTTQASANAAELEVWLAERAEQARSDECGRDEDAARNLIARHKDLEQEMEVNGRLVDELVRAARELKAEGAPTAQELPARADEIQAKMTDLRQLSAERLGRLEGALALHAYLRECADLEEWISQQLATVAA 526          

HSP 5 Score: 102.064 bits (253), Expect = 3.492e-22
Identity = 103/435 (23.68%), Postives = 194/435 (44.60%), Query Frame = 1
Query: 5014 ASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLL-----TKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQR--ESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWF-ENAEEDLTD 6294
             + +SLL +H      + A +  I+ L + A E ++SG    D + ++   +  R   V+  ++ R   L  A K   F R   +  AW+ EK++L   E Y RDL  +    K+    E E+  ++  + +V++ G +L+     A+  EI+  LE L   W EL++  + R  KL ++ + ++    +++    +   ++ L S D G  L + + LL  H   E  +    ++   +  +G+ L  D + +++ I++     +++L  L +   +R+  LE+   + + M   +   +WIA++    +S D GR L + Q LL      + E    G    R+ G      L   +  + H  +  +  R + +   WD L R  E++RR   LL L ER    +      +  A+    W  E AE+  +D
Sbjct:    4 GATESLLKRHAEFENRLGAMDRPIRHLKKHAAELVKSGVAPPDGLEQKVGAVVARRNAVQDASDRRRALLEAAYKYQVFTRNAAELLAWVAEKRVLADDESY-RDLSLLSRELKRQNAAEGELRTNQQALAAVQEVGRDLVKGRHFAS-REIQATLEELHARWAELEKKMTERGRKLRQAVDQRQLNQLLQDARERLDALENQLRSEDVGTDLRSSKTLLAHHVHTEAALDSLVERILAVVAQGESLA-DGHFDSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAG------LGAAMQAAEHPLARDVTRRCEEVRAAWDALLRALENRRR---LLALAERAHTTQ-----ASANAAELEVWLAERAEQARSD 421          

HSP 6 Score: 98.2117 bits (243), Expect = 6.704e-21
Identity = 120/558 (21.51%), Postives = 240/558 (43.01%), Query Frame = 1
Query: 3673 LTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERH--RDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCL---ELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANR----QAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSE 5313
            + + + L ++H   E  L A+   ++ L   AAELV++     +G+ Q    +    N +   ++  +  L  +   Q F  +  +L++W+     L + DE  +D++    LL R   R  A E     G+   +Q+ +                  ++ G++L+K  H+A  EI+  L+ +     +L ++   R ++L Q +   +L   L+D  +  D +   E+ L  EDV  D ++  +L+  H     A++   +++ A+    + L +  H+D  GI+ + +E   R  +L E     R+RL +       +R  ++   WI E++ +             Q   ++    +AE  A+   +  + G G  ++     + ++  V  R  ++   WD L+   +++   L  A R    QA  NA   ++E WL E      S + G+D  +  +L+++H+ L  ++  +   + +L   A E    G   +  +  R   I  +   ++QL+  R   L  A  LH + R   D E WI ++   V+++
Sbjct:    3 VGATESLLKRHAEFENRLGAMDRPIRHLKKHAAELVKSGVAPPDGLEQKVGAVVARRNAVQDASDRRRALLEAAYKYQVFTRNAAELLAWVAEKRVL-ADDESYRDLS----LLSRELKRQNAAE-----GELRTNQQALA---------------AVQEVGRDLVKGRHFASREIQATLEELHARWAELEKKMTERGRKLRQAVDQRQLNQLLQDARERLDAL---ENQLRSEDVGTDLRSSKTLLAHHVHTEAALDSLVERILAVVAQGESLADG-HFDSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPLARD--VTRRCEEVRAAWDALLRALENRRRLLALAERAHTTQASANAA--ELEVWLAERAEQARSDECGRDEDAARNLIARHKDLEQEMEVNGRLVDELVRAARELKAEGAPTAQELPARADEIQAKMTDLRQLSAERLGRLEGALALHAYLRECADLEEWISQQLATVAAQ 527          

HSP 7 Score: 93.2041 bits (230), Expect = 2.588e-19
Identity = 112/536 (20.90%), Postives = 226/536 (42.16%), Query Frame = 1
Query: 1222 VAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGD-SLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLE---DSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNR-------GQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLH--QFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGS 2790
            V   E+L++RH E ++ + + D   +  K    EL+       + +  K+  +   R  +    + RR L E     Q+F R+  +  AW+A++    ++    D SL S E  +++    E  L   ++    +  +   LV+  H+A+ ++    ++L  R + LE+K   R   L    D        +DA E         +  + EN     ++ + ++  +  LA     E+ +D +  R       G++L D  H  S  I+    E  K    L      +   L +A    + +R +E    W+AE      S D G+ L++   L ++   L+A+ ++H   +             +H  A  + ++  EV   +  L   L+ R+  L  A + H  Q   +A + E W+ E+   A S   GRD    +NLI +H+ ++ E+  +   + E+    +++        +++  + D+++   +DL+  + +R   L+ +L    YL + ++ E W+ ++   V +
Sbjct:    3 VGATESLLKRHAEFENRLGAMDRPIRHLKKHAAELVKSGVAPPDGLEQKVGAVVARRNAVQDASDRRRALLEAAYKYQVFTRNAAELLAWVAEKRVLADDESYRDLSLLSRE--LKRQNAAEGELRTNQQALAAVQEVGRDLVKGRHFASREIQATLEELHARWAELEKKMTERGRKLRQAVDQRQLNQLLQDARE---------RLDALENQLRSEDVGTDLRSSKTLLAHHVHTEAALDSLVERILAVVAQGESLAD-GHFDSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPLARDVTRRCEEVRAAWDALLRALENRRRLLALAERAHTTQASANAAELEVWLAERAEQARSDECGRDEDAARNLIARHKDLEQEMEVNGRLVDELVRAARELKAEGAPTAQELPARADEIQAKMTDLRQLSAERLGRLEGALALHAYLRECADLEEWISQQLATVAA 526          

HSP 8 Score: 92.4337 bits (228), Expect = 3.838e-19
Identity = 116/495 (23.43%), Postives = 228/495 (46.06%), Query Frame = 1
Query:  718 SLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASV-QALKRKHEA-----LDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSY---SLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRD------DLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA-SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLAS 2154
            +++ ++  V+DA +R + L       L  A++ Q F R+  + ++WV EK +    E + RDL+ + + LKR++ A      ++  +A  ++V +     D +  +H  S++ IQ   E L + W+ L+KK  ER  +L  +     L++ L D R+ L  L +    + ++++  D+   + L+  H   ++ +DS  E   +   +GE L    H  S  I  +     K    L +   +RR   E+ +      R  EQ  AWIA++    E++D G +LD+ + L+ +    +    A      R+  +   +    H  A DV ++ +      D L+R   LE + +L   + E +H  Q    +A E++ W+ E+ + A SDE  ++    ++ + +H++   E+  N   +D++    + L       ++++  R +E+     DL   S  +   L  A     ++R   D+E W+++   QLA+
Sbjct:   54 AVVARRNAVQDASDRRRAL-------LEAAYKYQVFTRNAAELLAWVAEKRVLADDESY-RDLSLLSRELKRQNAAEGELRTNQQALAAVQEVGR-----DLVKGRHFASRE-IQATLEELHARWAELEKKMTERGRKLRQAVDQRQLNQLLQDARERLDALENQ---LRSEDVGTDLRSSKTLLAHHVHTEAALDSLVERILAVVAQGESLAD-GHFDSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPLARDVTRRCEEVRAAWDALLRA--LENRRRLLALA-ERAHTTQ-ASANAAELEVWLAERAEQARSDECGRDEDAARNLIARHKDLEQEMEVNGRLVDELVRAARELKAEGAPTAQELPARADEIQAKMTDLRQLSAERLGRLEGALALHAYLRECADLEEWISQ---QLAT 523          

HSP 9 Score: 80.8777 bits (198), Expect = 2.153e-15
Identity = 75/293 (25.60%), Postives = 130/293 (44.37%), Query Frame = 1
Query: 5152 ERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAA--LRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLE 6024
            E +K + ER  K++Q  + R +     + L D    +D  E  +R       SED G DL   + L   H   E  + +    I +V  QG  L +     +   I+R+    +     L +  + R+ +LEE+  Y + +  +E+E AWI E+     S D G TL A Q LL++    + +   H      +   G  +    +  A+ + +RCE +R   D L +A    RR   L + +   Q       +E W+A++  Q +SD+ GRD  + + L+ +H+  +  +E
Sbjct:  166 ELEKKMTERGRKLRQAVDQRQLN----QLLQDARERLDALENQLR-------SEDVGTDLRSSKTLLAHHVHTEAALDSLVERILAVVAQGESLADGH--FDSRGIQRETREFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPLARDVTRRCEEVRAAWDALLRALENRRRLLALAERAHTTQASANAAELEVWLAERAEQARSDECGRDEDAARNLIARHKDLEQEME 445          

HSP 10 Score: 53.9138 bits (128), Expect = 4.925e-7
Identity = 61/278 (21.94%), Postives = 104/278 (37.41%), Query Frame = 1
Query: 3508 QLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERV-KLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYK--IKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMT 4332
            + +K+   L E   ++   LE+        R  ++   WI E+     + D G+ L + Q L  +   L+ +  A G  V ++    AA     HP  A  + +  EE+   W+ L    E+ +  + L       +  A+  +L  W+        SDE  +D   A  L+ RH+DL                    E   E++ R           +EL   G     E+  +   I      L +    R  +L+  L L  YLR+C   E+W++
Sbjct:  264 EFKKRLAALAEPRAKRRARLEEAVRYYEAMRALEQEAAWIAERVPSAESHDTGRTLDATQLLLEQAMKLQAECTAHGPHVARVAGLGAAMQAAEHPL-ARDVTRRCEEVRAAWDALLRALENRRRLLALAERAHTTQASANAAELEVWLAERAEQARSDECGRDEDAARNLIARHKDL--------------------EQEMEVNGR--LVDELVRAARELKAEGAPTAQELPARADEIQAKMTDLRQLSAERLGRLEGALALHAYLRECADLEEWIS 518          
BLAST of Spectrin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001834.1 (pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1 gene:ENSPMAG00000001663.1 transcript:ENSPMAT00000001834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.364 bits (503), Expect = 3.738e-51
Identity = 195/856 (22.78%), Postives = 395/856 (46.14%), Query Frame = 1
Query:  151 RRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDM-IENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILF---WTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQE------DFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAAD-ELAKDVAGVEALMERHNEHKSEIDS-RDESFKSCKNEGEELITMNHPLSE--DIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLA----EIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFV----DEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDM 2649
            R++KLE   +   F R A   E+W+ E  +    +NF  DL  +++  +KH+A+E ++AA    + A++    ++  E +H  + +++ R D +  LW +L  +   +   L++TL      R   E+L+   W  E +  + S+E G+ L  VE L +K      D+  Q ++   + + A    +E        PE  S   +   +E +   L  L   R+ +L EA  +  F  + ++  +WV +    L SED G DLA+V  L  +H A + +L     ++ Q  +  +E   +        + +   L   W+ L+  +  R E+L  S +LH+ LSD  D+ +W  D   ++AA  ++  D    +AL  +H +   EI+  R +S +      E+   +   L+E   +  +L RL++    L  L  ER    +  + L   + +T     W+ ++  +L+  D+ + L+ +E +  + E  E  +     +   ++ +A +L+ + H +  D+  K+D L  R S   E A+ +K +L+     Q F  +  E +AWI EK +    E+ +   N  + V   Q  L+    ++AA E ++ D++   + L   +  ++  ++ ++ +   +W  L    + +E +LG+AS  Q+F+++V+D + WL++ +  +AS+D    L     L  +H  ++ +IS++ +      +  ++      D QH     ++++   +   + +L    D R+  L   +    F RDA   +  +  +E       +   L   +  IKKH+ +   +  ++ ++  V + G+K++   ++    I++K+D +
Sbjct:  317 RQEKLEQLARR--FDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRR-DGVLQLWRRLQELLAARRTRLEMTL---ALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVAS--ERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYRIDSLQ------EQAAALPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLI--ESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHV---FLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEANDEKVGSVLDTGRKLVGEGNFNADKIQEKMDSI 1153          

HSP 2 Score: 186.422 bits (472), Expect = 2.003e-47
Identity = 168/708 (23.73%), Postives = 329/708 (46.47%), Query Frame = 1
Query:  784 RQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEG---EELITMNHPLSEDIVN-KLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLA---AQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWI--VEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGST-NVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHR--DIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAY 2871
            RQ+KL +    ++F R      +W+ E    +  ++FG DLA+V+A  +KHEA++ D+ A E +V  +   A EL  +       +  +++ +L  W  L++    R  +L+++ +L R   +     +W+ +MK  + + E  K + GVE L+++H   ++++ ++ +  K+         E +    P   ++ + +  +L+     L  L   RR   E+   L LF  + E+ EAW+ + E  L + D G  L +V  L+ +H  FE  L+   AQ ++T RL     R  E    AA   + + D L    ++LE  A  R   L  S        D+ +++AW      L  A  +   +  + Q+  +KH++ + EI     RID ++ +    L ++  +   ++ER+  L++ + +L + +  + + L  A              +WL E    L + D  + L  +  +Q +   LE +++    R+    Q A Q +  +H   D IK KQ+ ++ R+ + +E  + +K  L     L  F  +  + + WI EK  +  ST  +G DL GV  L +K   ++ ++   E ++ ++  E +++  A H+  R   +  ++ D  ++W  L+     R+  L ++ + Q++L D  + ++W+ + +  V S +        E LL +H+A+  +I  Y
Sbjct:  317 RQEKLEQL--ARRFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLW---ASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGY--RIDSLQEQAAA-LPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERL--AQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNY 1014          

HSP 3 Score: 160.229 bits (404), Expect = 2.138e-39
Identity = 175/857 (20.42%), Postives = 365/857 (42.59%), Query Frame = 1
Query: 3583 VQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINE-KLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILV-SSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKA-IEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDR 6138
             +R+ R+    + W+ E    +   + G DL +V+   +KH+A+E D+ A   RV+ ++  A EL     +E   +V+ ++ + ++W +L       + +L  ++ LQ+   +     +W++ M   + S E  K + G E LL++H  +  ++A                  A+ D           F +E+            E+   +  +  +L      R+ +L++   L L+L + E+ E W+   E  L  ED   D   V  L+ +H  F   ++ +  ++Q      ++       D    + +  E+   W SL+        RL   + L   + D+ ++E W  +  L         +   + QA  +KH+    E+     R+ S+      L      + +   V ER+ +L + +  L   + ++  +LQ+A      ++       WL E    L + D  +    ++ +  + + L  +++    R+  +N+ A + + S     D I+ ++ ++N R+ + ++LAE++   L     L  F     + +AWIREK  L+ S++  G DL GV  L++K   +E ++ A E  +  ++ +  E + +        ++ +L      W  L+     R+  L E+S+ QKFL  V++ +AW+ + Q  ++S D   TL   + LL +H+A + ++  + +    +   G+++  D +      + QR + L      L      R+  L    A+L F       +  ++++E  +   +    L S +  + KHE   T +E+   E +  +     +L+   +  +D I+ +  ++ +R
Sbjct:  325 ARRFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVA------------------AQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEI--EGYRIDSLQEQAAALP---ASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEA-ERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEA-NDEKVGSVLDTGRKLVGEGNFNADKIQEKMDSISER 1156          

HSP 4 Score: 160.229 bits (404), Expect = 2.193e-39
Identity = 219/973 (22.51%), Postives = 391/973 (40.18%), Query Frame = 1
Query: 3583 VQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRL---------------FRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLA------DYRDLM--SWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALK----EFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQ--EANRQAVYNAGLKDIEFWLGEVEHSLSSP-DYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSST-DYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESF-------RIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEE 6381
            V+RY     E  EWI      LN+ D    L  VQ+                F +   LE  L  +  +++  + K    V T P E + +     EIN  W +L       ++ L + +  Q+ L       D +  M  +W+     LV  D    D+   EA  ++H  +  ++A                      A  G  +  E   +EL    ++    +  +   +     +L E    R+ +L+  L LQ    +      WM   +  LL ++       V+ L++KH      +  Q D+++A+      FA+++  +   D +   ++  ++ A +  L     A R+RL + + L  F+ +A+E+E W+ +       E        +     +H+AFE EL+    +LQ  L  G+  +EK +      A   R  +L   W  L   +  ++E+L+  EA  Q + ++   D+E W  +    +++  D G D  S  +L  KH+ +  +I  +  RI  L E+A   + +   +   +RER + + E Y ++  LA  R   L  A  L+  +        W+ EK   + + D    L  +  ++ + + LE E++     +  V +   +L+  S+ A+ D+IK K + L   W E ++L+  +K  L+     Q F     E +AWI EK  L+ ST   G+ LA V  L +K    E D+   E K  D+  E ++L   +   A A+  +     +    LR     R+  L + S   +F+   D  ++W++  +  V S+D    L   + LL +HE     + ++       R  G EV         + +  Q   ++ R Q L   W +L      R+  L             YL FA+ A   +    N E  L+      +L+  +A  + H     S++A +E
Sbjct:  205 VERYESLASELLEWIGRTITALNSRDFPNSLVGVQQQLHAFSSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQK----VYT-PREGKLVA----EINRAWERLEKAEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMA----------------------AYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGE--EEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSA--DVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGY--RIDSLQEQAAA-LPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLG-SEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTR-------DQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHA--------YLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEANDE 1123          

HSP 5 Score: 155.992 bits (393), Expect = 4.061e-38
Identity = 177/802 (22.07%), Postives = 351/802 (43.77%), Query Frame = 1
Query: 3481 VEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKA---AELVQTH-PNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLN-------RKKQLDQCLELQLYLRDCEQAEDWMTIRESSLL---GEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQ--NTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNK----LADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSL-SSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREK 5817
            V + +G++ QL ++ ++L  +  R+ + LE   A+QR   E      W++E   RL + + GK L  V+ L +KH  +E D+ A  +RVK +++ A   AE V  + P + E   +   ++   + +L       + +L  +  L  FL +  ++ +W+  +  L++S++   D+     LL RHR    E++ R                                 ++ L+ G   + E +   Q+      +L++ W +       R ++L     L   L D    E W   R++SLL   G DV  D+ +  +L +KH D    I  +  ++ +L+E A  L      +  G++++ + +   +G L         RL D   L     +     +W++EK Q  + LD    +   +++    + ++ E E+   A R+ +++    R     Q +G E+A E+ +      L  +W      ++ K E LQ       +     + + W+ E    + S+   G D A V +L  K   +  D+ A E ++ DL   A+   +     +  +R +     + +  ++     R  +LG+A KL  F + +DD +AW+ + +  V+SED    L     L  +H+ ++NEI  +    + + + G E+  +        ++++L+ L T W EL  +   R+  L     Y  F     + +  +  +++ LS  +   TL + +  +KKH+   T M+ +++K   + + G+KL+ + N NA  I+++ + + E+
Sbjct:  401 VRRRDGVL-QLWRRLQEL--LAARRTR-LEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQL-----------------------------QQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWA--RDASLLVAAGGDVGNDEFSTQALARKHRDVVEEI--EGYRIDSLQEQAAAL-PASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALD--IPEKLEDLEVVQHRFESLEPEMNGLASRV-AVVNQLAR-----QLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEANDEKVGSVLDTGRKLVGEGNFNADKIQEKMDSISER 1156          

HSP 6 Score: 140.584 bits (353), Expect = 2.315e-33
Identity = 173/804 (21.52%), Postives = 344/804 (42.79%), Query Frame = 1
Query:  700 DFPEQESLINKKKDVEDALERLKNLA--KKRQQKLFEA-----HEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDAD------ELSNKHPDSKDTIQDKKEALL-----SAWSHLKKKSVERNEQLDVSYSL----------HRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNE-------RRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVEN-GHYAAAD---VNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWI--VEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLAS-DDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTE-FGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD-----------ACKMQEAPVSDSYG 2949
            D P+++S+I           ++K LA   KR  K+ ++       ++++     + + W+      L S DF   L  VQ  ++ H       +   EK  + T+  +       + +K   +   +   +E  L      AW  L+K   E   +L +   L           RF        +WL + + ++  D    D+A VEA  ++H   ++++ + +   ++ +    EL    +       +++ R+ + R  ++QLW         RR   E  + LQ  + +     AW+ + +  L + + G  L  VE L++KH   E  +AAQ ++ + ++  A R  E    Y   D    +++   L    + L      R++ LE++    LF  +A+E++AW+  VE L  + D  +     L+  + +H+ F  E++   +++      G+         ++  + R  ELDKLW  L  A+  + + L  +    Q + +  D+E W  +    +A+  D G D  S   L +KH  +  +I  +  RIDS  +QA         +  G++++   +   Y +L     +R  +L DA  L+  + +      W+ EK     + ++   L  ++ +  + ++++ E+ G   R+  V    ++++ ++H +  DI+ K D +   WS+ +  A+ +K+ L   L  Q +  +  E ++W+REK  L+ ST+  G D     AL +K   +  D+ A    +  L+ +A+           A + Q A  +D +G
Sbjct:  160 DQPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDSAIEADRMVERYESLASELLEWIGRTITALNSRDFPNSLVGVQ--QQLHAFSSYRTV---EKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVAEINRAWERLEK--AEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERY-------HEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLR-LLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGY--RIDSLQEQAAAL-PASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWG 945          

HSP 7 Score: 136.732 bits (343), Expect = 3.132e-32
Identity = 171/771 (22.18%), Postives = 326/771 (42.28%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILE-KIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIEN----HHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTS-EDFGRDLASVQALKRKHEALDRDLIALEE--KVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQ-------NMDLQLFYRDTEQAEAWIAKQEAFLENN-DVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSK---VQKHQNFLAEIAANESRIDDVKNRGQNLL-DSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNR 2340
            +  RR+ VL  +   +E    RR +LE     Q    +     +W+ E K++  S E  K L  ++   QKH  +E ++AAQ++ + A++       E          E+   R  QL A + +L  +   +   L+       FL   +E+  W ++ E  + SE+ G DL  V  L  +   F  +L  +  +  +     +   +E   + ++   +  +++     L+  A +R ++L  +  + +   D+    +W  + S+ + +  D G D  S QAL RKH    RD++   E  +++ L + A  L     +    ++++   L  A+  L   + ER  +L  + +L+   S+    L WL +    + A ++ + +  +E +  R    + E++              +L+   H   +DI  K + L+         W+E R L E         + LQ F  +  + +AWI ++   +E+   +G+ L  V AL RK    E+ LAA E K   L   A RL ++    A  V  +  D       L    + R+ SL ++   Q F +D D+ +AW+ +  K  + E+   P+ L      + +H+    EI+        ++  G+ +  D +  +   +++R++ L   W +L S    +   L        F R+    +  L+  E  L+  +    L S     KKH  L   + ++ +++ S L    + V E +F+AD I++K + +S R
Sbjct:  400 VVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKH----RDVVEEIEGYRIDSLQEQAAALPASLAEPAG-VRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNAR-------WSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDV--PSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEANDEKVGSVLDTGRKLVGEGNFNADKIQEKMDSISER 1156          
BLAST of Spectrin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000145.1 (pep scaffold:Pmarinus_7.0:GL484725:6607:11847:-1 gene:ENSPMAG00000000128.1 transcript:ENSPMAT00000000145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.844 bits (403), Expect = 5.489e-44
Identity = 89/257 (34.63%), Postives = 143/257 (55.64%), Query Frame = 1
Query: 6568 QEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLF 7338
            QE  H++ + H              GTLE+QL   +   + + + K ++ ++E +  +++E LI DN+HT ++   +   W+QL     R  + +E QI  R+  G+S+E + EF   F HFDKD SG L   EFK+CL +LG D+   ++G+   EF  I+++VDPN  G+VT Q F+ +M +RET +  +  +V  +F  L  + K +IT +EL   L  +QAE+C+  M PY    G  +P A DY +F+  L+
Sbjct:    1 QEIGHISIEMH--------------GTLEDQLNQLRKYEQNIVNYKPNIDKLESEHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDTKGISQEQMHEFRGSFNHFDKDHSGLLAAEEFKACLISLGYDVGNDQQGEA--EFARIMNIVDPNNSGYVTFQSFIDYM-TRETTDTDTADQVIASFKILAGD-KTFITAEELRRELPPEQAEYCIARMAPYRGADG--VPGALDYMSFSTALY 237          
BLAST of Spectrin alpha chain vs. Ensembl Yeast
Match: CMD1 (Calmodulin; Ca2+ binding protein that regulates Ca2+ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca2+ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin; binds to the Hog1p MAPK in response to hyperosmotic stress; potentiates membrane tubulation and constriction mediated by the Rvs161p-Rvs167p complex; human CALM1 or CALM2 functionally complement repression induced inviability [Source:SGD;Acc:S000000313])

HSP 1 Score: 52.373 bits (124), Expect = 6.256e-8
Identity = 35/117 (29.91%), Postives = 59/117 (50.43%), Query Frame = 1
Query: 6880 SGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLT 7230
            S ++EE + EF   F  FDKD +G +   E  + +R+LG+  +       + E   +++ +D + +  +   EF+A M SR+ ++  S QE+ EAF    K     I+  EL   LT
Sbjct:    3 SNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPS-------EAEVNDLMNEIDVDGNHQIEFSEFLALM-SRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLT 111          
BLAST of Spectrin alpha chain vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 54.6842 bits (130), Expect = 1.250e-7
Identity = 29/84 (34.52%), Postives = 43/84 (51.19%), Query Frame = 1
Query: 2872 RSTIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLL--NSNHKDWWKVEINDRQGHVPAAYVKKV 3117
            +S I S  T   +     AP S S      +ALY +  +   ++  RKGDV+T+L  + +  DWW   +N R+G  PA YV+ V
Sbjct:  376 KSRISSASTPQTSQGRFTAPTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV 459          
BLAST of Spectrin alpha chain vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 53.1434 bits (126), Expect = 4.154e-7
Identity = 23/53 (43.40%), Postives = 30/53 (56.60%), Query Frame = 1
Query: 2959 VMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKV 3117
            V ALYD     P E+S RKGDV+T+L   ++DWWK  +    G  P  YV  +
Sbjct:  222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTPI 274          
BLAST of Spectrin alpha chain vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 51.6026 bits (122), Expect = 1.377e-6
Identity = 23/81 (28.40%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 2875 STIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLL--NSNHKDWWKVEINDRQGHVPAAYVK 3111
            S +D L  +     +     + +    T +ALY++  + P +++ +KGDV+T+L  + +  DWW    N ++G  PA YV+
Sbjct:  386 SNVDDLSHKMSKTGLGNESTATNSATPTAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466          
BLAST of Spectrin alpha chain vs. Ensembl Nematostella
Match: EDO49575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP6])

HSP 1 Score: 587.03 bits (1512), Expect = 1.690e-169
Identity = 342/937 (36.50%), Postives = 554/937 (59.12%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRT 2898
            I+ R   V +R    K   ++RR+KL+++ K   F +D  E ESWI+EK+QT +DE+FKD  NL+SK QKHQA E E+ A    ++++   G  +I   H+A+  ++ R++ L+  WE+LL     K R L+   D+ QF + VD       +KET V S ++G+D EH   LQ+K  EF +DL     +   I   A+ L+ +       +  ++  + +   RL++ A +R+QKL EA EI  F R+     S +NEK+   TS + GRDL +V+AL RKH+ ++R+L  +E K+ +L  +A  L    P     +Q K+  ++  W  L     +R   L+ +  L  FL DYRDL+SW+ D+   +++ ELA +V   EA++  H E K ++++R +S+ +    G  L+   H  ++ I   ++ L  E   L QLW  R+++ +Q+ DLQ+F  D E+AE WI  ++   ++ +  +SLD+VE+L++ H +FEKSL+  EE  + L++ A + ++  HY A  +  K  ++L +   L++ A  R   L +S     F RDA E+++W+ EKL+ A++ +Y+E TNLQ K+QKHQ F AE++A++S +D +   GQ+L+ ++ +  E ++ R+++L  LW+ L   S  K + L +A  +Q F RNV +++ W+ EVE+ LAS+D GKD+ SV NL K+H  L+ DI+ ++DR+   L+QA +FV  +HF  D I  +  +V+ R+ +L EP  +R+++L D+  LHQF  D   E DWI +KEPIA S + GR+L+GVQ+L+KK + +++EI  HE  +  +   G++++   HYA RDI  K   +  +W +L+  A  R + L  SL   QY     E ++W+ EK  LV ST++G+DE S E LL+KHDAL  +++A  S I  LR+
Sbjct: 1776 IRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQTATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRS 2712          

HSP 2 Score: 477.633 bits (1228), Expect = 1.867e-135
Identity = 329/1039 (31.67%), Postives = 565/1039 (54.38%), Query Frame = 1
Query: 3445 ANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK----TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRL-KEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERY---KKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEA--LEETWKNLQRIIQERDAELIR 6531
            A KL   G   +V +I+     L +++ +L++  + + + L +   +  ++R C +    I EK A   + +VG+DL +V+ L RKHD +ER+L  +  +++ L+ +A  LV++ P+ A  +   Q +I E W +L    +  K+ L  +  LQ FL DYRDLMSW+N +   +SS ELA +V  AEA+L  H                      EE   +++AR  ++     FG  L++ GH + + IK+ +  +     +L + W +RK  L Q  +LQ++L D E+AE+W  I+   ++ + ++ +     V+SL+K H +F ++++  E+ +++L+  A Q ++ +HY  + I+ K  E+L +W +LK+   +   +LG+ + L  F+RDA E+E W+NEKLQ   + SY++  TN+Q K QKHQ FEAE++A+   L +I  +GQ L +    C   +  VE R+  LAD W  L + S +K+++L+EA ++  +   + +++ W+ EVE++L+S DYGKD  SV++L+ +HQ L  DI  +EDR+ +L ++A EF+ +     D I +R   + ER+E++ + A  R + L  +  LH F      E  WI++K+ +  SEDYGR+L+GV++L KK + LE+EI++HE ++Q++ + G +L+     A  D I  K + L   W EL+  +  R  KL+ S    ++ D V E +AW+ EK  L+SSTDYG    + + LL+KHDA + ++  +E K  D+ +   +L D  +     +E+  + L E+   LR  A  R   L D+S    F+ + D + +W+ +KE  V SDD GRDL  V+ L+ K E F   L S   E I  +T     L++  H  S+ I+ R + + +RWD L+  +  R + L + ++ +   + V+E++    +K  A     EN   D         L  ++AL   H  F+  L+A  E  + L   D +  S  V  + +    ME   +++ WK LQ++   + + L++
Sbjct: 1973 AEKLIGQGHAGSV-RIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLH----------------------EERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENW--IKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYRE-ATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSC---QETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERD-IGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVS-SGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGV-AENGAPD---------LRHVQALQRKHQGFQRDLQALGEK-VDLVLRDADDLSAKVPAHKHE-LIMEKQEVQKAWKKLQQLASSKQSHLLQ 2968          

HSP 3 Score: 471.085 bits (1211), Expect = 2.334e-133
Identity = 515/2260 (22.79%), Postives = 1026/2260 (45.40%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEE-LDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD---AC-------------------------------KMQEA----------PVSDS--YGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSD-IDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDL----------VALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKTVDSL---IKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTL-DESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQE----NAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEF---WLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHEL--MNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYG-RDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDR------WDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALC----EAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYT---WFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWL 6609
            +  R E V+NR    K    +R+K L  ++  Q F RDADE   WI EK Q   DE+FKD  NLQ   ++H+A E EI A  + ++ ++K G D+I   H+ ++ ++ +L  L+  W  L+    EK   L+      Q  R ++++  W  E E  +  E+ G+DL  V+ L KK      D+E       ++  KA  L+ +     +++ +  ++++     L  L  KR+  L +A  + +F  D +  ++WV E     +S D G  L SVQ L+++H A + +L   + +++ +     +L +    + D ++++ E L + W  L   + +R ++L  S+   ++LS+  +  SW+ D   + A+ +  KD A  E L+ RH   + ++ +   +      E   L+  +H  SE I +    L+++   L  L   R     ++  L  + R+ E+  A++++Q     + D G   + ++ +  +  DF++S+A+  E  + +DN+A  LV  GH     + +++D       +LE++ +LR+  L  +     F+RD +E+ + I EK    + E+  ++  + Q   +KH+ F  E+   E +I+++      L  +   ++    E+ E+ +  LW +L   +  K + L  A    +    V D+  W  E    +ASDD    ++    + ++ +   A++ + ++     L+  ++ +++ HF  + I  K   + +   +L    D RK +L++AY LH F +DA   + +   +E +     +G  +  V+ L+KKH+  +  ++  E ++  +   G+++I+  H     I  ++  + +    LK + DKR++ L +S +  Q+  D  E+ESW+ EK        F KD  + E+ L+KH A  +++ A+   IDS+R + +   +C                               K+QEA           ++DS    KET++   DY       V +++               K++  D+   V AA V+ ++ +    I       + +  +Q  L  ++  L     +RR +L ++ + +   R   D+   + EK  V  +  +    L AV++  +K D+   E    E K++EL+ +A +L RS Q      ++     + +++E+L ++  ++   LE    +Q +  +  +   W+ +   R+++ ++  ++   + +   H+  +  +          VA G  +      +A++++ + ++   +V    E+ ++W       +  K+ L  S DLQ FLAD     +WI     +  S E  + +   E+LL+ H +    ++              EE+           ++ E   K+ L+  HY    I+ K   I D  E L +   +R  +L +   L  +LRD ++ E WM   E   +  +   +   +L   ++KH+ F   ++  + ++ A+ +    L+ +    Q+ ++ + +++   W  L +       RL +    Q F R+  E++ WI E+++N L  E Y     ++    ++HQ+ + ++A   +R+  +      LK+ G+ +  E    + + +R   +A++++ LV  + ++  +LQ++      +  L D +    W+ + E    S DYG++   V SL+ K + L ++I++HE  ++ L E  ++ +  G      I  + +M+ E +E+++  A+ R   L  +   H +Y  + + +AW+ EK  LVSS DYGRD      L +KH  L+ E+ A+E  I+ +     EL    +++ +  ++I+   + LE  +  L+ ++  R  +L +SS    FL   +E  AW+ EK+ ++SS D G  L  V+ L++K + F  D+    ++   +    Q L+DD + +++ IEQR E + E+ D L++    R   L+       F    D + +WI +K   +   + G  DL  VQ L  KH+ F   L++   E ++++      L +++   +    H+++ +M++      W KLQ+ +  ++ HLL+         E    F        SW E     + +    ++  +++ L     E  +   +   + EE   + S+ D+ + S    GNP           + +TW  L   ++ R  +L      Q   ++  Q F   AD+   WL
Sbjct:  928 VASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQTATDESF-KDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQR---------------KMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRD-LPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRS-QPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIKQNVDD---LVLENTELQQLW-------QSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTY------------EEN----------IRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMN--EKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWI-EEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSEL------LKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDS---LALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQ---DELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALG-EKVDLV------LRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQ--------SEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEE---FQSRADQLLGS----GNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQL------QHNKEI--QRFKREADQLEAWL 3092          

HSP 4 Score: 446.817 bits (1148), Expect = 6.062e-126
Identity = 275/822 (33.45%), Postives = 450/822 (54.74%), Query Frame = 1
Query:  451 NMFKEKSRLLKLTLD----YVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQA 2904
            N   E S + +L+L     Y  F    +++  W   KE    S E    L+ ++ +++K   F  ++  +  + ++I   AD L+Q+      ++  K+K++ +  E+L+ L  K ++ L E H ++ F    ++  SW+ EK   L  E+ G+D+ +V+A  R+H+ ++RDL A+E+KV +L   A  L  +HP     I+ K+  ++S W+ LK K+ +R   LD +Y    FL+D RDL+SW  ++K    + E  +D+A    L+++H E   EI +R E F      G  L+  + P +  +   +  L  E+  L   W +R     Q +DLQ                           S+D VE L++KHEDF K+L AQEEK + L ++A  ++   H A   V  + + ++ R+ N++ +A  R+ +L  S   Q F RDADE   WI EK + A DE++K+P NLQ  +++H+ F AEI AN+  ID +   G++L+ + H  ++ +K++++ L++ W +LV+ +  K   L QA  Q+Q  R +ED+ IW+ E E+ L  +D G+DL  V  L KKH LLE+DI  H   I     +A + V + HF++D IK     + +RY  L    DKR+  L DA+ LHQF  D + E  W+ E    A S ++G  LI VQ L K+H A + E+  H+ RI  V + GQ +I++ + A   +E++ ++++N+W +L + A +RKQ L DS  +Q+YL++A+EA+SWM +K  L  S ++GKD  S E LL +H AL  D+ A+ +TID L  +A
Sbjct:  543 NRLIETSEMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLLATS-PQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQ--------------------------SSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEA 1337          

HSP 5 Score: 330.872 bits (847), Expect = 1.275e-90
Identity = 395/1751 (22.56%), Postives = 783/1751 (44.72%), Query Frame = 1
Query: 1015 KHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLR-KSSLEDSH-NYQLFDRDADEIKA-WIVE----------------------KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQAD---ACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVLTLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAM--MSDIDPNAPEQIT--VASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVIT-PGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELV-QTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDL---NERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKL 6150
            +HP     I+ K+  ++  W+ LK K+ +R   LD +Y    FL D RDL+SW  ++K    + E  +D+A    L+++H E   EI +R E F      G  L+  + P +  +   +  L  E+  L   W +R     Q +DLQ F RD E  +A  A QE FL   D+G         I+     EKS  A++E  +   N+   L  +  + A        ++   K  ++   KLR  S+L   +   +   R+A  + A ++VE                      K K       KEP+   S++++ +                K RG     + H   +++  R   +   +N L+  S+++  +L +A     F    EDM++W++  E Q  S +    L+++  +++K      +I++   R+    Q AD+ + + H  +  +K K+ E++ R+ KLQ    K +  L + + +  F    ++   WI EK+       +G+D+  V+  +++HQ I+ ++   E ++ ++ ++ + ++       R I+ K  ++ ++W+ LK+KA+KRK LLD++   Q +LADA +  SW  E +    S E  +D  S   L+++H+    +I+      D L        A   Q   V  S                 R   + +G  L L +S  +  W ++ ++       A  +KV ++  M+    +A  Q    VAS+ +++ N+ +N+ +   DR+  L  S      +R+A++   W+ EK  +A  E    P +L+      K  +  +   K+  ++I +      + K  G  +  +K++G    L + +  L   TT K   L+     ++ +R  ++ + W+ E +A L   D G+DL  V+ L +KH  LE D+      +  +  KA ELV Q H N ++ I    E +   +  L    +  +  L ++  L +F+ D    M+W+       SS +L   +   + L +RH     E+ N               H   ID    +       G++L+ + + A ++++E+ + + +  ++L +    RK++L      Q YL +  +A+ WM  +      +D   D  + ++L+ +H+     +      +  L E A +LV+  H+D + I    +++  ++  L   +    +RL + + L  + R+ +E+  +++E+LQ    E Y     ++Q    +   F+  +A+ AE  +++    + L  +G       A++E+ +     W +L ++ + + ++L  A     +N  L ++   + E + +++  D G+D AS   L  KH+V   ++   E +I++L   + R     +  T  S  + + +K +   +E++K+    +   L  A + +    T+ D  +W  E   L++S+D    +     + ++      E+ A E     V + G +++ +   A  +EI  KLE L +    L      RK +L E+     FL   ++ +++   ++ +L   + G+++  V+ LLKKH+  E  +   E+K + +   G++LID+ ++ +  I  R  G+ ++ + L+    +R+  L+++   +QF       ESWI +K  Q  +D+  +D  ++++ L KH+ F++ L +     I+ +     QLI   H  +  ++ R + L  +W++L
Sbjct:  216 RHPRQARQIKAKEGEVIGLWAGLKSKANKRKGLLDEAYGQQGFLVDARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLLATS-PQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQTFIRDAEHVDAVTASQETFLAKEDLG-----FGGWIK-----EKSQIAEDESFKDPKNLQGNLKRHKAFEA--------EITANKDGIDRINKLRFGSTLVVGYVGGRTKSREAGYVPANYVVEIEPKAVKKVTKKTTMVPEKVMVKRKVKKMVTLKEPSGPSSQLKRRE----------------KRRGVQRHFTAHFDRDNVAVRQITITNTYNRLIETSEMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLLATSPQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQG--LDLQSSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKG----LNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFN-SDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTN---------------HQTRIDTVLSS-------GQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHT--DTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARS--VEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAE-EEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEK-LQTATDESFKDPINLESKLQKHQAFESELTAHE-RAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEEL 1895          

HSP 6 Score: 296.59 bits (758), Expect = 3.921e-80
Identity = 215/816 (26.35%), Postives = 414/816 (50.74%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEP--TNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNL-LDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKK 2520
            E I+ +  ++L+++ A K+    R  KL ++K    F RDA ELESW+ EK+Q  ++ ++++ TNLQ K QKHQ  E E++A    L+A+ + G  ++ N     E +++RL  L  LW  L ++   K++ LK  +    F R V E+  W +E E  + SE++G+D+  V  L K+      D+   E++ +E+  +A   +  +   ++ + ++  DV +  E+L   A +R+ +L ++  + +F  DT   + W+ +K     SED+GR+L  VQ+L +K E L+ ++ + E  V  L +  ++L  +   ++  I  K + LL  W  L+  +  RNE+L  S + H++     ++ +W+++  +++++ +  +D    E L+ +H+  + E+D+ +   +  ++   EL          +    + L++    L  +  +R      +  L  F R+ ++  AW+ ++EA + ++D G  L+ VE L++K E F + L +  E+  +L   A  L+++ H  +  + ++ + +  R   L+E+   R   L+ + +   F R  DEI AWI EK+          P   ++Q+  +KHQ F  ++ A   ++D V     +L      +K E I E+ +E+ K W  L   +  K+ +L Q+ G Q F+ +  D+  W+    +Q+A +  G     V  L  ++  L+ +I S  + ++ F  +ADQ +   +  A+ I+ K + V + + +L   L  R  +L    ++ +F R+AD  E W++ +E    S +VG  L  V+ L+KK
Sbjct: 2303 EAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEK-QEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKK 3117          

HSP 7 Score: 283.493 bits (724), Expect = 3.847e-76
Identity = 247/965 (25.60%), Postives = 464/965 (48.08%), Query Frame = 1
Query:  145 EERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRV-LYEQNMDLQL------FYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK-LKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAE-VESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHD----ALMADIEAYRS-TIDSLRTQADACKMQEAPVSDSYGKETVMALYDYQEKNP 2994
            + R+  L+ +   Q F  DA++ E+WI  K +   S E+ + L N++S  + H   E  ++   EN+ +L+ +    ++  HY +E I+++  ++   WE L  +   +S  L  +    QFLR   E+  W  EK        + +     + LQK    F  ++   + +   I      L++     QE++ ++ KD+ D    L +L+  + Q+L EA + Q F R+  +  +W+ E    L SED+G+D+ SV  L ++H++L  D+   E++V++L K A E        KD I D+   +   +  L + + ER  +L  S +LH+FL+D +  + W+ D + +  +++  +++ GV++LM++    +SEI+S +   ++    GE+L+   H    DI  K +       +L++LW E R+    +N  LQ       +Y    + +AW++++ + + + D G    S E L+RKH+  +  L A E K + L +I + L + G    + + K +D+L  R ++L + A+ R   L DS     F R+ADE+ AW+ EK    +SD+  ++  +++  +QK + F  ++ ++  RI  +    Q LLD  H  SE I++R E + + W+ L   +  + + L +A     F R+V+++  W+ E +++   +++   DL  V  LQ+KH   + D+ +  +++D  L+ AD    +       +  ++ EV   + KLQ+    ++  L  +  L  F  D  D   WI           +G     V+ LI ++Q +Q EI      + E  +   +++ + + +  DI  K   +++ W  L      R Q L  + E Q++  +A + E+W+  +E  + S + G   ++ E LLKK D     L+   E + S T  S      +C  ++    +S    TV A+ D     P
Sbjct: 2218 QSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKLQK-HQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQ-------MLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLTNTSFSVHKKSCAPKQV---NSEEARTVKAVTDSVVAKP 3171          

HSP 8 Score: 257.684 bits (657), Expect = 2.291e-68
Identity = 236/954 (24.74%), Postives = 454/954 (47.59%), Query Frame = 1
Query: 3565 LEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDT-LAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDV------LRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLS 6399
            L+    +Q +  + ++A+ WI+ K     + +  + L +V+ L + H   E+ L    E ++ L+S A + +Q     AE I     EI + W  L   A     KL  S  L +FL D ++L SW+N     ++++   ++ T  +  L++H+    E++                H +E+DA + T       G+ L++     +  ++ +L+ +AD    L +   N+ ++L + ++ Q + R+  + + W+   E++L  ED   D ++V++LIK+H+     I   ED++  L + A + V  EH+ +D I D+  +V  R+  L E       RL D   L  F+ D      WI +K      E Y      +Q+  +K +  E+E+ ++   +Q++L +G++L  +G     E  +  +   L + W+ L   ++ ++EKLQ +     Y   + +++ W+ E    +SS DYG+D  S ++LL KH  L  ++ A+E +I+DL     E  ++G  +   + + +  + ERY  ++ +A +R   L  + +L +F R  D+  AW+ EK+ +VSS+D GRDL  V  L +K +    ++ +    I  + +    L+++    + + I+++ E +   W  L++ +S R  +L+ + +   F  +V+E  AWI EK   L   + G   L  VQ L +KH  F+ D++   +K + +      L D ++ +AK    + E + EK +V      L++ A  ++  L  +     F+     + SWI     QV  +  G   + V+TL+ +++   T ++S R   +E   S  +QL+ S +  ++ I+++  ++ D WD+L    + R   L    +  K+++     F ++A    +W    E DL      +SLE ++ L +    F+  L    E F  L+
Sbjct: 2224 LQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNE-KLQIAAEASYREATNLQQKLQKHQTFEAEVS---------------AHKSELDAITQT-------GQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYA--ERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEH-TDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLV------LRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDS-RANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQL----QHNKEIQR----FKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLT 3136          

HSP 9 Score: 254.603 bits (649), Expect = 2.182e-67
Identity = 241/992 (24.29%), Postives = 467/992 (47.08%), Query Frame = 1
Query:   25 IFKMADITLPKEIKIL-------------ETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDEN----FKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWN-------ERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIE-------ELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQA 2904
            +F+   +TL K+I+ L             +T   +++  + VL+ +   K  T  +R+KL DA ++        +L SW +E  +  + ++      D   +  +  +H A   E+ A+ E+   + + G  MIE+ H+A E I  +L+ L +  E+L   +  +   L        FL+   ++  +T  +E  +   E G  ++ VE L KK     K +  QEEK + +      L+     + + + N+   V D  E+LK    KR++KL  +H+I +F++D  ++ SW+ EK    T E F +D  ++++  +KH+A + +L A E  ++ +    ++L +    +   ++ + EAL   W  L + S  +  +L  +    +F  +     S +TD + ++ + +  +D      L  +  E   ++       ++     E+LI   H  S        R+ + +  L + WN       ERR    +  ++  F R+     + I ++ A   + +VG  L +VEALIRKH+D E+ L   E K + L+  A RLV +  + A  V  K+ D++ +   L +    RK  LE +   Q+F  D  ++ +W+ +   + +S E      + ++ +  H+    ++ A     +     G +L++  H  ++ IK+ ++       EL +LW       + ++  L Q++  Q F+ + E  E W+   +    S +  + L++V +L K H   E  +S++++ I S    A QF+  +H+ A+ I+ K  E+ +++  L++    R  KL ++  L QF RDA + E W++EK  IA   +  R+   +Q  ++KHQ  +AE+  H+  +  +   GQ ++         +E ++ D+ ++WS L + +D + Q L ++++ Q +  +  E ++W+ E E  + S ++GKD  S   L+K+H +L  DI  Y   +  L  QA
Sbjct: 1530 VFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHA---EMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQTATDESF-KDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGS-------VRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIKQNVDDLVLENTELQQLW-------QSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASY-REATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQA 2502          

HSP 10 Score: 241.121 bits (614), Expect = 2.596e-63
Identity = 210/850 (24.71%), Postives = 408/850 (48.00%), Query Frame = 1
Query: 3481 VEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREK-KILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGL 6021
             E I     ++  K+E L+++   +   L +   + ++ R+  E + W+ EK  ++      ++ T++Q+  +KH   E ++ A    +  +      L++  P+  E +    +++ ++W+ L   +++   +L  +I  Q F  +  +L +WI  +   ++S++  KD+     L++RH+ L ++IA              E+  +E+  ++G F   E          H+ ++EI ++   +A+  EQL E    R+ +L   L L  +L D +   DW+  +E     ED       V SL+KK E     IN  E  +QAL E  +QLV   HY +  I  K Q +L  W  L+ N      +L        +     EM+ W++EKL       Y    T+ +   +KH A + EL AN  +++ +      L + G    + + +E+  ++L +++ +L + ++D+  +L +++R   +     ++  W+ E E  +SS D G+D   V+ L+ K +V   D+ +  +RI  L E A   ++    DS+ I +R ++I ER++ +K+    R   L +A+ LH F R++D+  AWI+EK   L  +E+   DL  V+ L++KHQ  + ++ A    +  V +   +L  +   A+  E+  + + ++ AW +LQQL+S +++ L +S   Q FLD   +  +WI      ++    G T A V+ L+ ++   +T++    +   +  +   +L+   N +A+ I  +   +R+  D L  +   R   L+ N    +F  + D +E+W+  +E  + S+D G  L +V+ LL K + F+  L
Sbjct: 2302 AEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEK-LQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARY------------EDRVSELLKQAGEFVAAE----------HFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDT--EFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVP-AHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKML 3125          

HSP 11 Score: 231.106 bits (588), Expect = 2.759e-60
Identity = 216/965 (22.38%), Postives = 440/965 (45.60%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKE-KETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKL-FEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEP-TNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMAL 2970
            ++ +R+++  R+   +    +  + L +    + F    +E+ SWI EK      E   KD+  ++++ ++HQ +E ++AA  + +  L      ++  H   +  I+ +  ++ +LW  L +   ++  LL        FL    +++ W+ E KE+F+++E+  QD+     L          ++  EEK  EI ++ +   Q D                  E  +NL     Q +  +             + SW           D    +  V+ L +KHE   + L A EEKV  L   A  + +    ++D +  + E++++   ++K ++ +R + L  S  L  F+ D  +   W+ + K+ IA DE  KD   ++  ++RH   ++EI +  +        G++LI   H  ++ + +KL+ L++  + L+    E+    +Q    +   R  E    W+ + EA L   D G  L  V+ L +KH+  E  +         + + A  LV  GH+ +  +    ++L  R  +L      R+S LED+     F  D +    W+ E L+ AS  +      ++Q   ++H  F  E+  +++RID V + GQ+L+DS ++ ++ ++ER EEL  LW++LV  +  +++ L  +   Q+++    + + W+ +     AS D GKD  S   L  +H  L+ D+++    ID   ++A + V   HFD++ I   Q ++  ++  L   +  R  +L ++ KLH++ R+ ++   ++ E+   A S + G D   +Q +  +    Q  +  +      V N  + +++  H     I+++ D  +++W  L+++   R++ L  + E  ++  D +E  S ++EK+  +   + G+D  ST+ L +KH       E +   + +L  Q +   ++ A +  +Y  +T  ++
Sbjct:  637 VKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAED-PQDIASASEL----------IQQHEEKFDEIQTRFERFDQLD------------------EYGRNLLATSPQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQSSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKE-KSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKH-------EVFECELVTLEKQIEELTVESARLQATYQGQTARSV 1564          

HSP 12 Score: 226.483 bits (576), Expect = 6.784e-59
Identity = 220/935 (23.53%), Postives = 441/935 (47.17%), Query Frame = 1
Query:   85 DIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNK-LERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAW------IAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADI 2862
            +++ R E +  ++    EA+  + +KL++A+ +Q F ++ D  +S I +K     S +  +D  +     +K +  + ++A  +  + A++     +I   H  S  IQ R + L   W +L +   E+ + L    +   F R   ++     EK    TS E G+DL  VE L +K ++  ++L   E K  E+  +A  L++       ++  K+ D+ +  ERL +L  +R+  L     +Q F  D    +SW+N+    ++S +   ++   +A+   HE     + A  +  N        L  +   S D I+   + L+   + L++    R   L  S  L  FL+D     +W+ + + V  + E  + +  VE+L++ H   +  + + +E+ +S ++  ++ + + H  +E I +K LE LDK   +     +    L E  +  Q F RD ++ E+W      IA + ++ E  ++   L       +KH+ FE  ++A + +   +      L+ N       V  +  DL    S L + +  +   L+++   Q F+R+  E++AWI E     + E+Y K+  ++ + +++HQ+   +IA  E R+ ++  +    + + H   ++I +R  ++ + +  LV  +  +E  L  +    QF+ + +    W+ + E    S+D G++L  V +L KK   LE++I+SH+  + + L+  +Q V   H+    I  K   +   + +L+     R  KL  +   HQ+Y    + + W+ EK  +  ST+ GRD    + L++KH A+Q E+  +E +I ++ +   ++ +A       +EK  D+++  ++ L++ A  R + L DS     +L +A E  +W+ EKE +V S + G+D +  E L++K +    D+
Sbjct: 1880 EVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQ-FLRDAKELESWMNEKLQIAAEASYREATNLQQKL-------QKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDL 2806          

HSP 13 Score: 205.297 bits (521), Expect = 1.782e-52
Identity = 196/840 (23.33%), Postives = 382/840 (45.48%), Query Frame = 1
Query: 3262 YQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQT------EAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVE---HEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYG-KDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANP--DEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICN 5739
            +Q +R+A +L  W+ EK  +A          EA   E   + + + + +  E ++   K + + + ++GQ+         E +E  +  L   +  L +++  K + L++    Q + R   E + WIEE +  L + D GKD+ SV  L ++H +L+ D+    +RV  L  +A E V       + I     ++ E + +L   A + +++L +S+ L +FLAD +  + WI     +  S++  +++ G ++L+++   L                       +EI++     Q   + G++L+  GHYAE +I  K Q + +  E+L      R ++L   L    Y     + + W++ + S +   D   D+ + ++L++KH+     ++  E K++ L+    +L +    E    + I+D+ +E   R+  L++       RL D   L  F+R+ADE+  W+ EK      +       +++   QK + F  +L ++ ER+  +    Q L +      +   +E+R   + ++WD L  ++  + E+L  A     +   + +I  W+ E   +L   + G  D   V +L  KHQ    D+ A  +++  +   AD+           +   K+ + + ++K++QLA ++   L +++ L  F     D  +WI      V+ E  G     V  L  ++Q L+ EI +    ++  + +  +L+      NP  ++I+ K  H+   W  L      R  +L+ + E Q+F    ++ EAW+  ++H L S D GD+L AV+ LLKK D FE  +    +K N + N
Sbjct: 2337 FQFLRDAKELESWMNEKLQIAA---------EASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGL----------------------ESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEE---RYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSE--MIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGS---GNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLTN 3137          

HSP 14 Score: 138.272 bits (347), Expect = 3.694e-32
Identity = 103/400 (25.75%), Postives = 193/400 (48.25%), Query Frame = 1
Query:  118 RYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEK-IQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEK-ETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKN 1311
            RY+  ++   +R ++L D+ +   F R+ADEL +W+ EK     SD+  +DL +++   QK +    ++ +  E +  L ++   ++++ H  SE+I+ R + +   W+ L      +   L    D   F R VDEI  W +EK +    +E    DL HV+ LQ+K   F +DL+   EK   +   AD L  +    +  LI +K++V+ A ++L+ LA  +Q  L ++  +Q F  D    +SW+   S  +  E  G   A V+ L  +++ L  ++ +    V +    AD+L      S + I++K   +   W  L      R +QL  +  + RF  +   L +WL   +  + ++++   +  VE L+++ +E +  + ++ E F S  N
Sbjct: 2738 RYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLTN 3137          

HSP 15 Score: 121.709 bits (304), Expect = 3.731e-27
Identity = 118/472 (25.00%), Postives = 219/472 (46.40%), Query Frame = 1
Query: 3448 NKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWIN-TMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSL----LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNK 4848
            ++L  +G TE   K+E I  +L+++Y  L +V   + + L D   +  + RE DE   W+EEK+A +++ D G+DL  V+ L +K +   RDLV+ GER+  L   A  L+     ++E I Q  E I E W+ L  +      +L  + DL  F     ++ +WI   ++AL  ++  A D+   +AL  +H+            F  D + +GE+    +D      ++ +D   ++    H    E+  + Q +  A ++L +   +++  L Q   LQ +L D      W+    + +    LG    D  V++LI ++++    I+ + + ++  +  ADQL+   +   + I++K   V   W  L  ++     +L   + +Q F R+AD++E W+N +  + L E   D    ++   +K   FE  L    E+  S+  +   + +K     Q N+ E R  K
Sbjct: 2715 SELSDAGDTE-FSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQG-----------FQRDLQALGEK----VDL---VLRDADDLSAKVPAHKH----ELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFAD--VETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLTNTSFSVHKKSCAPKQVNSEEARTVK 3161          

HSP 16 Score: 116.316 bits (290), Expect = 1.448e-25
Identity = 87/308 (28.25%), Postives = 149/308 (48.38%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQT--YSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDM---IENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLT 990
            E I++R E +  R+   KE T  R ++L+ A+    F+R  DE+ +WI EKI     ++    DL ++Q+  +KHQ  + ++ A  E ++ + ++  D+   +  H +  E+I  +  ++   W+KL  +   K   L  +     FL    +++ W +     V  E  G     VE L  +  E   +++ +     E  S+AD LL    P  E + NK   V D  +RL    + R Q+L    EIQ+F R+ D+  +W+N +   L SED G  L +V+ L +K +  ++ L+   EK N LT
Sbjct: 2832 EMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKH--ELIMEK-QEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLT 3136          
BLAST of Spectrin alpha chain vs. Ensembl Nematostella
Match: EDO26730 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DV03])

HSP 1 Score: 515.383 bits (1326), Expect = 2.416e-165
Identity = 255/397 (64.23%), Postives = 310/397 (78.09%), Query Frame = 1
Query: 6169 RKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVR------SALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESK-PYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLF 7338
            R   LL+ QE+YKKVE+L+L FAKKASAFNSWFENAEEDLTDPVRCNS+EEI+AL EAH+ F+ SL  AEED   L +LD++I+SY V  NPYTWFTMEALE+TW+NLQ+II+ER+ +L +E +RQE ND LRQEFA  A+ FH WL   R      + ++EG G LE+QL   K K  E+ D K DL+ IE  GA +EE LILDNR+TEHSTV L+Q WDQLDQLAMRM HNLEQQIQAR  +GVSEE L+EF++MFKHFDKDK+G LDH+EFKSCLR+LG DL  VEEG+ DPEFETILS VDPN DG V++ E+MAFMISRETENV S QEVE AF ALT+  K  ++T+ +LY +LTK+QAE+C+  M PY+ + G+ IP AYDY++F   LF
Sbjct:    2 RTQRLLESQEQYKKVEDLFLLFAKKASAFNSWFENAEEDLTDPVRCNSVEEIRALQEAHAQFRLSLDQAEEDMYSLRKLDRQIKSYKVSINPYTWFTMEALEDTWENLQKIIEEREEDLAKEAQRQEYNDRLRQEFAQHANAFHSWLTETRFVSMGLAIMVEGQGDLEDQLAEIKRKDTEIADCKADLEVIEGLGAQMEEALILDNRYTEHSTVDLAQQWDQLDQLAMRMKHNLEQQIQARKTTGVSEETLKEFTIMFKHFDKDKTGYLDHQEFKSCLRSLGYDLPVVEEGETDPEFETILSRVDPNGDGVVSMGEYMAFMISRETENVGSSQEVENAFKALTEGGKRKFVTESDLYQSLTKEQAEYCIDRMQPYVDDKGREIPGAYDYKSFCKALF 398          
BLAST of Spectrin alpha chain vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 421.394 bits (1082), Expect = 1.121e-118
Identity = 294/963 (30.53%), Postives = 518/963 (53.79%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESW--ILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKE----TFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKS-IPLTSEDFG--RDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKD--TIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSE-DIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSD 2940
            IQ R + + +++    +    R+KK+++  K Q F  + +++ SW  ++E+I    D  + D  + +   +KH A+E  I   +  + A      D + +   +S  +  R + L   +  LL     + + L+  L   +  R    +  W  E+E    T +T ++ G DLE  +V++++F  F ++L+  E +   +     +L+++     + +      +      L++ A +++ KL +A  +Q+F+  T +T +W++EKS + +T ED    +DLA+V  L+R+   + RDL ALE+K   L  DA +L +++    +   +++K   + S+W  +K    +R+E L  S  L RF+ D  D   WL      +A++++   ++  E  ++ H + K EID+ +  F+    +G +       L +  +  +L++L      L+ LW  R+ L  Q ++ QLF RD +Q EA + +Q+ FL   +VG ++++V+ LI+KHE+F K +  Q+EK  ++   A RL  +GHYA   + +K  +L  R++   +K +     L D+   Q F +DA+++  W+ EK + AS+E+Y++ +N+Q KV KH+ F AE+ AN+ R+D +   G++L D       +I E +++LD+ W +L   SK K   L  A  Q++F   V+ M+ W+ E+E+ + + +   DL + T L +KH  LE  I++ ++R+     QA   VD  HFD + +++ +  +  +Y  L+ PL ++  +L+ A +  QF RD DDEE WI+EKEP+  STN G +L  VQ L KKHQ + AEI  H+     +CN+G +++   H    DIE++  +++  W DLK ++D  K  LD SL+A+QY  DA+EAESWM E+E  +   E GKDE S   +LK+H+ L A I  Y  T++ L   A+       P S+
Sbjct:  688 IQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGY-DEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQ-VDGLGDEDKSSPEVVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERENRLDTALTVDK-GMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESE 1647          

HSP 2 Score: 419.468 bits (1077), Expect = 4.737e-118
Identity = 380/1416 (26.84%), Postives = 698/1416 (49.29%), Query Frame = 1
Query: 2089 QFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINAD----HYAHRDIEKKIDD----MKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYGKETVMALYD--------------YQEKNPRE------VSMRKGDVLTLLNSNHKDWWKVEINDRQG---HVPAAYVKKVDAM--------------------MSDIDPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKE--LVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTS-DVG--KDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQE--EINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFG--IDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDD--KTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKL 6150
            +F R     E WL E +  +A D+ G DL +V    KKH  +E DI ++++R+++ +  A++   E + D++ I+  +  +   +  L   + +R+++L    +L + +++  +  DW+ E +    S + G+ L+GV++L++KH  ++A+I     R+  V  + +  ++ +       H+  E +I D    ++  +++L   A  R+  L++SL+ Q +  +A E E W+ EK+  V ST++G D ++   LL KH+A+  ++ A  +     +T+A A   +E   +  Y  +T+    D              Y++K  +E            D+++  +   +    +  ND  G   H     VKK  A+                    + D D ++PE   V  +   L+ +Y  LL     RR +L+D++  ++L REA  +  W+ E+E  L     V     LE  Q  +++ + F  E    E +++ + +    L   G   + ++I+  I +L  ++  L +   +K   L+    +Q+++ +  E K WI EK + L T  DV   KDL +V  L R+ + ++RDL AL ++   L++ A +L   +  E E  +  ++   ++  W ++    +     L  S +LQ+F+ D  D   W+   +  V+S+++   ++ AE  L+ H D+  EI     DF   I+  P   +  +++  +S                       +KE+L  +    + L   W NRK+ L Q L  QL++RD +Q E  +  ++  L  E+V    + V  LIKKHE+F++ +++Q++K+  + +FA +L    HY QD I +K Q +  R  + ++ + A   RL D   LQ FI+DA++M  W+NEK Q   +ESY+D  +NIQ K  KH+AFEAEL AN ERL  I  SG+ L ++      E  ++E + KL  +W  L   SK K  KL++A RQ  +NAG++ ++ W+ E+E  + + +   D  +   L  KH+ L   I+A ++R+K+L+ +A + +++G  D + ++E K ++ E+YE ++     +   L +A +   F R +DDEE WI EK+ L+ S +YG +L  V+ L+KKHQ L  EI  H+   + +  QG EL+        ++I+R+ + LE  W +L++ S   K +L+ S + +++     E E+W+ E++  +   + G   A+   +LK+H+  E  +  + +  N++      L++ N+  ++ I+ R   + +    L+  A  R+  L++     Q   + D +E WIADKE    S D G+DL+  + L+ K   F         E +     + +QLI + H+ +  I      + + W  L
Sbjct:  395 KFDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTARNA-----QTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMER----IVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQVDGLGDEDKSSPE---VVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINS-DEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQS-----------------------LKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQVASEESYRD-LSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPE--IDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYH-PQAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADL 1770          

HSP 3 Score: 371.703 bits (953), Expect = 2.281e-103
Identity = 407/1717 (23.70%), Postives = 781/1717 (45.49%), Query Frame = 1
Query:  190 FKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQ--------EDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKS--CKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENN---DVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK---LKTASD-ENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSED--IKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFV-DEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSL----RTQADACKMQEAPVSDSYGKETVMALYDYQEKNPREVSMRKGDVL---------------------------------TLLNSNHKDWWKVEINDRQGHVPAAYVKKVDAMMSDI------DPNAPEQITVASQQKNLENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLN-------RKKQLDQCLELQLYLRDCEQAEDWMTIRESSL---LGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLV-EHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEF 5115
            F R     E+W+ E  +  + +NF  DL  +++  +KH+A+E +I A  E +NA+     ++   +++ SE IQ    ++  LWE LL + K++   L+  +   +  + +  I+ W  E +  + SE++G+ L  VE L +K +    D+  Q ++   + ++A+  L         +  P++  + + + ++E A   L  LA  R+ +L E+ ++Q F+R+ D+   WV EK   + S D+G DL +   L  KHEA++R++ A   +   + ++ +EL    P + DTIQ++ + + S W  L   +  R +++  +  L +F+++Y D++SW   M+ ++A D+L  D    E L+++H+  +  I       K+  C+ +G   +      S ++V++   LD+    L+Q    RR   +  + L    R+    E WI ++E  L+     D G  L+  + + ++ E F++ L A E + Q ++ +   L+E GH  + ++ +  D L  R  NL + A  +++ L+ +   Q F     E K WI EK   L T  D  N K+   +    ++  N   ++ A E +   ++N  Q L      + E+  +KE+I  +   W ++    K +++ L ++   Q+FV +++D +IWL    +++AS+D    L+      K+H  ++ +I +H+      ++   ++  DE       +K++ +++ + +  L    + RK  L  A     F RDA   E  + +++       VG  +  VQ LIKKH+     +   + +I ++    Q++ N  HYA   I +K  ++    +  + K +   Q L D+L+ QQ++ DA +   W+ EK   V S E  +D  + +  + KH+A  A+++A +  +D +    R  AD     E P +     E +  L D +     EVS  KG  L                                 T L +  + + K +  ++Q +     +K++DA  +D+      DPNA ++  +      LE +YE L +   ++   L  ++Q +Q  R+ +D   W+ EKE + +       +L  VQ  +KK      E    ++  + + ++ ++L      +A E IE    +L++K++ L++ +      L+     ++Y+ +  EA+ W+ E++  +   + GKD  S   + ++H+ LE  +    E V  L   A  LV+++  E+E I   Q +I++++  L   AE+ + KL  ++ L +   +  DL  WI     +  S ++ +D+   E L+E+ R           DF  D   IG E  A  +              +L+ TGH           +IA+ K+ +NE W +       R K L+  LEL  Y  D ++    +  +++ +   LG D++  +V  L + H+ F   +     ++  ++E A +L+  +       I+ K  EV+  W +L   +     +L D   L  F+    +  +W+N+ L++ L        + ++    +HQ+   E+    E    ++  G++L  K      E  + E++N L    D ++ + K + E L        +       E W+   E  L + + G D A V+ LL KH      + A E+R   L ER  +F
Sbjct:  396 FDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQVDG---LGDEDKSSPEVVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQ-VASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLAD-----EKPENKPEIDELLQKL-DQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKII-----LEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPL-LQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQA-EDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFR-----------DFARDTTHIGTERVASTNG----------VCDQLIGTGH-------SDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAMIQEKDNLMTEELGRDLN--SVQQLQRTHQSFEADLAPLGHQVSGIQEEAGRLLGSYAGEKASEIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGREESFFGVIKMGEQLLAKSHYASAE--IREKINMLHRHKDEMLLEWKKRWEHLGLILEVMQFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKHGNFEKVVAAQEERFLAL-ERLTQF 2062          

HSP 4 Score: 264.233 bits (674), Expect = 1.739e-70
Identity = 227/951 (23.87%), Postives = 464/951 (48.79%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDE----NFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASE--IIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFP-EQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQK-HQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEI--IGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQA 2904
            ++I+E  +++  R+   ++   ++R KL+ A + Q F     E ++WI EK      E    N KDL  +    ++   ++ ++ A  +   +L+ +   +   +    E  I++ ++  + + W ++ +  K++   L  + +  +F+  +D+   W +     V SE+    L   E   K+  +   +++  E    ++        Q++   +Q+SL  +   ++   + L  L + R++ L +A   Q F RD  +  + + ++ + L+ E+ G  + +VQ L +KHE   + +   +EK+NQ+ + A  L+N    ++D I +K + L    +  ++K     ++L  +  L +F+ D  D+  WL + K  +A++E  +D++ ++  + +H   ++E+ +  E        G +L         +I   L++LD++ + L ++   +    +     + F    +  + W+ + E  +   +    L +   L +KH+  EK + A++E+ + LD  A  +V+ GH+    V + +  L  +   LE     + + L+ +  +  FDRD D+ + WI EK       NY        K+QK HQ   AEI  ++   + + N+G  L+   H ++EDI+ R +EL++ W+DL   S   +  L  +   +Q+  +  + E W++E E  +  D+ GKD  S T + K+H  LEA I+ + + ++   + A+  V+  H +++ IK +QN++   Y  L++  ++R+ KL++  KL+Q  R+ DD E WI +KE +AGS ++G+DL   + LI+K +    +   IG E R+        ++I   H     I +  D +   W+DL    + R ++L+ +LE  +Y  DA E  + ++EK+ L+ + E G+D +S + L + H +  AD+      +  ++ +A
Sbjct:  900 DEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNE-KHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTE-RVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAMIQEKDNLM-TEELGRDLNSVQQLQRTHQSFEADLAPLGHQVSGIQEEA 1847          

HSP 5 Score: 258.84 bits (660), Expect = 7.129e-69
Identity = 225/936 (24.04%), Postives = 464/936 (49.57%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKD-LTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHH-YASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEK-LKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISS-HQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEI--IGHEPRILEVCNEGQKMINADHYAH---RDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEA 2868
            ++E+   V + +   K+  ++R + L ++ + Q F  D D+ + W+       + E+  + L+  +   ++H+ ++ EI     +   L ++G    ++      + ++ +LDQL + W+ LL +++ + RLL   L++  F+R   +      +++ F++ EE G  +E V+ L KK  EF K ++ Q+EK  ++   A  L  +    Q+ +  K +++ +     +   +   Q+L +A ++Q+F +D +    W+NEK   + SE+  RDL+++Q    KHEA + +L A +E+++Q+++   +L+++ P++K  I +  + L   W  L + S  +  +L  +     F +  + +  W+ +++ VI   E A D+     L ++H + + +I+++ E  K    +  +++   H     +      L+++   L     E+    +Q M    F RD +  E WI ++E  L++ + G++L  V+ L +KH+     +   ++  +R+ N  + LV   H  A D+ ++R +L  +  +L++++   K+ L+ S   + +  DA E ++W+ E+ L    DE  K+  +    +++H+   A IA     ++++      L++SNH +SE IK R  ++DKL+  L   ++ +   L +     Q  R V+D+E+W+A+ E    S D G+DL     L +K      D +    +R+ S     DQ +   H DA  I + ++ ++  +  L E ++ R   L  A +LH++Y DA +    I EK+ +  +  +GRDL  VQ L + HQ+ +A++  +GH+  +  +  E  +++ +  YA     +I+ K D++   W +L  +  +R   L D+ +  ++L    +   WM +    + + E  KD    E L+ +H +   +IE 
Sbjct: 1013 VKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKH-QVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAMIQEKDNLM-TEELGRDLNSVQQLQRTHQSFEADLAPLGHQ--VSGIQEEAGRLLGS--YAGEKASEIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEG 1942          

HSP 6 Score: 256.144 bits (653), Expect = 4.924e-68
Identity = 222/842 (26.37%), Postives = 410/842 (48.69%), Query Frame = 1
Query:   64 KILETPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMI----ENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELS-NKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEK-SLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHN-KSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRIL 2568
            KI E  +++ ERR       +A ++  E   ++L DA + Q F +DA+++  W+ EK Q  S+E+++DL+N+Q K  KH+A E E+ A  E L+ + ++G D+     EN     E++Q +LDQ    W +L  + K K   LK      +F   V  +  W KE ET + ++E   DL     L +K  +  K +  ++E+  E+ ++A  ++     +  ++   K  +E+  E L+    ++  +L +A +  +F RD D   +W+NEK   L S ++G +L  VQ L++KH+ L  ++   ++   ++    DEL    HP ++D I+ +++ L   W  LKK+S     QLD+S    ++  D  +  SW+++ +  +  DE  KD A    +++RH   ++ I    E+          L+  NHP SE I  +  ++DK    L  L  ERR   ++ + L    R+ +  E WIA +E    + D+G  L   E LI K  DF + +     E+    + + ++L+  GH  AA + + +D +    ++L E  + R   LE +     +  DA E+ A I EK    ++E  ++  ++Q   + HQ+F A++A    ++  ++     LL S    K+ +I+ + +E+ + W +L    + +   L  A    +F+  V+D  +W+ ++   + + +  KD++ V  L  +H     +I   ++     ++  +Q + + H+ +  I++K N +     ++     KR   L    ++ QF RDA   E WI  +E    + N+G DL  V+ L++KH   +  +   E R L
Sbjct: 1225 KITEKAQNLHERR-------NANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQ-KLDQ---KWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAED-IERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAMIQEKDNLMTEELGRDLNSVQQLQRTHQSFEADLAPLGHQVSGIQEEAGRLLGSYAGEKASEIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGREESFFGVIKMGEQLLAKSHYASAEIREKINMLHRHKDEMLLEWKKRWEHLGLILEVMQFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKHGNFEKVVAAQEERFL 2054          

HSP 7 Score: 243.817 bits (621), Expect = 2.850e-64
Identity = 263/1041 (25.26%), Postives = 478/1041 (45.92%), Query Frame = 1
Query: 3472 TEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELV---------QTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYK-DPTTNI---QAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPD---YGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIE--SGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRK---AALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAEL 6525
            +E ++  +G I QL   +E L  +  ++   LE C  +QR  +E     +W++E    L + D GK L  V+ L +KH  +E D+ A  +RVK ++++A   +         Q  P+EA+ I  HQ E+   +N+L   A   + +L  S+ LQ F  +  +   W+   +  V S +   D+  A  LL +H   AVE                     E+ AR+   +     G+ELL+   YA + I+ +L +I    ++L++    RKK++ + L+LQ ++ +      W  + E  +  +D+  D+ + + L+KKH      I     +++A     D L + +    + + D+C  +  R+ +L +   A R +L D  +L    R+A  +E WI+E+ +N LD +   D   ++   Q   Q+ + F+ EL AN  R+Q +   G  L EKG     E  ++E +++L  +W  L + +  K  KL +A R   + A   + + W+ E    L + +     KD A+V  L  +   +  D+ A ED+   L   A +      G  + + ++E+  +++  + ++K   + R   L ++ +L  F   +DD + W+R     V+SED    L       K+H+ +++EI  HEP  Q + + G +   +        +K +L+ L++ W +L  L   RK  L ++  +Q F+   ++ EA + ++   LS  + G T+ AVQ L+KKH+ F   M V ++K N +    Q+L +D ++    I ++ + L E+ +  R+   AAL+R   L D     QF+   + +  W+ +K  QV S++  RDLS++Q  + KHE F+  L++ + E ++ I+     L +        I    Q L  +W +L   SK +     KL++  ++ E     F         W +  E  +    +   L     L + H   +  + A +E    L     ++   G         T   LEE ++ L+  + E+ AEL
Sbjct:  465 SERIQVCKGRIIQL---WELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQ-IRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHE--AVE--------------------REMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQVDGLGDEDKSSPE-VVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDER-ENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDE--IKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQR---LRDALQLQQFIQDAEDMYDWLNEKH-QVASEESYRDLSNIQGKVMKHEAFEAELQANK-ERLDQISESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGS---KLKDAQRQEE-----FNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAEL 1462          

HSP 8 Score: 236.498 bits (602), Expect = 4.722e-62
Identity = 239/940 (25.43%), Postives = 436/940 (46.38%), Query Frame = 1
Query:   76 TPEDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ----TYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEE---FGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKD--VEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPD-SKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADV--NKKRDDLLIRKSN-----LEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTA--SDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKK 2838
            +PE + +R   +  RYSA  +    RR+KL+DA       R+A  +E+WI E+        + +   DL   Q   Q+ +  + E+ A    +  +++ G ++IE  H  S+ I+  +D+L+  W  L +   +K   L   L   QF  +  E   W  EK + + +EE     +DL  V VLQ++ N   +DL   E+K   + + A  L  E   E E  I K+K   V  +   +K+  K+R + L E+ E+Q+F  D D    W+      + SED    L+  +   ++HE +  ++   E    +L +D  + +    D  + +++++ + L S W  L      R   L  + +   F+ D +   + L      ++ +E+   V  V+ L+++H E    +D +DE         + L    H   + I  K + L + R    Q            + LQ F +D E    W+ ++          D L +++  + KHE FE  L A +E   RLD I+    E+G   A +   NK   D L++K +     L E +K + S L+D+   + F+     ++ W+ E L+T   + E   + T      QKH+    +I A + R+ ++  +  +++D+ H     ++E    L++ +  L +    K   L QA    QF R+V+D E W+ E E  L S + G +L  V  LQKKH  L A+I  HQ   +    Q D+ V   H  A+ I++++ E+  ++  L++  D  K +L+ + +  Q+Y DA + E W+ E+E        G+D      ++K+H+ ++A I  +   + E+      ++ ++H     I+ + + +  +++ LK+ A++R+  LD++L+  Q   +  + E W+ +KE + GS + G+D    E L++K
Sbjct:  790 SPE-VVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQVASEESYRD-LSNIQGKVMKHEAFEAELQANKE---RLDQIS----ESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKE-LETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEK 1719          

HSP 9 Score: 218.394 bits (555), Expect = 1.321e-56
Identity = 214/913 (23.44%), Postives = 435/913 (47.65%), Query Frame = 1
Query:  145 EERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLL---QEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRV---LYEQNMDLQL----FYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIA-ANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFD-ADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKH 2841
            E R++ L  A  +Q F RDA + E+ + ++    S E     +  +Q   +KH+     +  Q E +N + +    +  + HYA + I  +   LH          +   + L+  L   QF++  +++  W  EK   V SEE  +DL +++    K   F  +L+  +E+  +I      L     E+ PE + L+ K   ++     L  ++K +  KL +A   ++F         WV E    + +++   DL +   L +KH+ L++ + A +E++ +L   A ++ +      + +Q+ K  L   +  L+    E+  +LD +    +F  D  D  +W+ + + ++ +     ++  V+ L ++H    +EID   +  +   N+G+EL+   HP +EDI    ER  KE   L + W++ +     Y+  +DL L    +Y D  +AE+W+++QE  +  ++ G    S   ++++HE  E ++A   E    L   AN LVE+ H  +  +  +++ +    + L++ A+ R+  L+++      +R+ D+++ WI +K + A  ++  ++  + +  ++K ++F  +       R+         L+ + H+ +  I E  + +++ W DL+   + + K L  A    ++  + +++   + E ++ L +++ G+DLNSV  LQ+ H   EAD++    ++    ++A + +     + A  I+ K++EV   +  L   + +R  KL+DA  L++F     D+  W+++      +    +D+ GV+ L+ +HQ+   EI G E     V   G++++   HYA  +I +KI+ +     ++  +  KR + L   LE  Q+  DA  AE+W+  +E  + +   G D    E LL+KH
Sbjct: 1139 ENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQ-VASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQK---LDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDI----ERRRKE---LEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAMIQEKDN-LMTEELGRDLNSVQQLQRTHQSFEADLAPLGHQVSGIQEEAGRLLGSYAGEKASEIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGREESFFGVIKMGEQLLAKSHYASAEIREKINMLHRHKDEMLLEWKKRWEHLGLILEVMQFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKH 2039          

HSP 10 Score: 208.764 bits (530), Expect = 1.257e-53
Identity = 247/1110 (22.25%), Postives = 509/1110 (45.86%), Query Frame = 1
Query: 3622 WIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYA-ENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMT----IRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWIN--EKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSP---DYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREK-KILVSSEDYG--RDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEI-KRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAAL-------RRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWD----KLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALM---------------EGIGTLEEQLEATKAKSKEVKDRKIDLKQIE--EKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQ 6825
            W+ E    +   + G DL +V+   +KH+A+E D++A  ERV  + + A EL + + +++E I   +  I ++W  L    +  +++L   + LQ+   +  +++ W++ +   + S++  K + G E LL++H  +  +IA +                  ++A++  F + ED   E  KT H   E +I++    +  A  +L +    R+ +L++ L+LQ + R+ ++ E W+T      +S+  G D++   +  L+ KHE   R +  +  + +A+    ++L+E   Y  D I+++   + ++W  L +N    + ++ +   LQ FI + +++  W +  E++    D  Y + +  +  K  KH A E  +   A  +++       L ++ +   +   V +R N L +++  L+ ++  + +KLQ+A      N     +E W+ E E+ L +    D G D      +  + +    ++ A+E R++ +NE     IE G  +SD I+E    +N R+  ++  A  +   L KA +L  FY    + + WI EK  +L++ ED    +DL  V  L+++   ++ ++ A E    S+E    +L +E +    +EI K K+  + ++WVE++     R   L ES E Q+F+  +++ + W+    + ++S D  ++L+  +  LK+H+  + ++  HE     +  +G K   D +      + + + L+E+LD L+            RK  L        F+      E+ +  ++  +  ++ G  + +VQ L+ KHE F   ++  + E I  +     +L    H   D I  + QNL +R +    KL+   +R +D  L+LQ+  +  E++Y            W  N +  +        L  I+     H  F+  L+A +E    +S+  +++        P     ++ L++ W  L  + + + ++L ++ +RQE       EF        +W++ + + ++               +    LE+Q+ A K + KE+  +  D+      +  AV E ++IL+ ++ E     L++   +LDQ
Sbjct:  406 WLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKT------------VNAQAEAFLHVED---EEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMI--LLTKHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVK--KHHAVEEGIQGYASEVKAFHCQVDGLGDEDKSSPE---VVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDES------DLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMD-VQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRD-ALQLQQFIQDAEDMY-----------DWL-NEKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKL-KDAQRQE-------EFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKY-ECLEAPLAEKGAELDQ 1464          

HSP 11 Score: 180.259 bits (456), Expect = 5.639e-45
Identity = 148/544 (27.21%), Postives = 261/544 (47.98%), Query Frame = 1
Query: 4954 EFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMN----ESQLAN-PDE--IKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQL--IESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNS---LEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQE 6549
            E WL E +  ++  ++G D A+V++   KH+ + TDI A+E+R+  +   A+E       DS+ I+  K  I + +E +  L + R V L K  +L   ++ + +   W+ E KI + SEDYG+ L+GV +L +KH  +E +I A    +++V  Q    ++    E +  + PDE  I+     LE A+ EL QL++ R+ +LEES + Q F    +EEE W+ EK + + STDYG  L     LL KH+A E +M     +   +   G++L++   +    I+ R + +R K D L   A  RK  +++N    QF+ + + + SW    E  V +DD G D  S + L+ KH   + G++ +  E    + + H Q+  +      S  +  R   L +R+  L +++  R+  L      +K   E Y+          +W +  E  L   +  +    LEE + + +    F+  L A E     +++L   +   G   +     T++ L   W NL+    ++ A+L +  + Q+
Sbjct:  404 ETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASE----VKAFHCQVDGLGDEDKSSPEVVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIV--------ETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQ 935          

HSP 12 Score: 148.288 bits (373), Expect = 3.031e-35
Identity = 153/651 (23.50%), Postives = 299/651 (45.93%), Query Frame = 1
Query: 3511 LQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDV--DDKTVDSLIKKHEDFNR-AINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQT-LQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENA-VEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQ 5448
            L++KYE LE     K  +L+      ++ R+ D+ + WI EK+  L +++ G +L  VQ+L +KH  L  ++    +  + + ++  ELV  +  +AE I + ++E+ E W+ L  +++ YK +L  S+  +++  D  +  SW++     +  DE  KD   A  +L+RH  L   IA    D+      +GE  +                   L+++ H    +IK +   I      L +    R+ +LD+ L+L    R+ +  E W+  +E     +D+  D    + LI+K  DF R   ++  +++ +     DQL+   H D   I +    +   W  L E +I  R+++ +    L  +  DA E+   I EK  N + E       ++Q   + HQ+FEA+LA    ++  I     RL   G   G++ + ++ + +++   W  L  + + +++KL +A+    +   ++D   W+ ++   + + +  KD + V+ L+ +HQ    +I   E+    + +  ++ +      S  IRE+  M++   +++    + R   LG   ++  F R     EAWI  ++  + +E+ G DL  V  L +KH   E  + A E    ++E+     + E+Q
Sbjct: 1444 LEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIA----DYAETVNELGETANG------------------LVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADLLE-LIETRTKMLEAALELHKYYHDAKEVLAMIQEK-DNLMTEELGRDLNSVQQLQRTHQSFEADLAPLGHQVSGIQEEAGRLL--GSYAGEKASEIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGREESFFGVIKMGEQLLAKSHYASAEIREKINMLHRHKDEMLLEWKKRWEHLGLILEVMQFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKHGNFEKVVAAQEERFLALERLTQFELREAQ 2068          

HSP 13 Score: 117.087 bits (292), Expect = 8.185e-26
Identity = 143/639 (22.38%), Postives = 281/639 (43.97%), Query Frame = 1
Query:  994 DADELSNKHPDSKDTIQDKKEALLSAWSHL--KKKSVE--------------RNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEEL------ITMNH------PLSEDIVN------KLERLDKERVILI--QLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVE-KLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLL-------DSNHNKSE-DIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKE 2775
            DA++++   PD K  +       ++A+ H   K K+VE               NE+L + Y   +  SD   LL W+      +   E A  + GV+  M   N+++++   +   F    N   +L      I  NH      P    +++      +LE+ + ER + +  +L  + R+     M    F R     E W+ + +  +  ++ G+ L +VEA  +KHE  E  + A EE+   +  +A  L    ++ +  +   +  ++     L    K R+  LE     Q   ++   I  W+ E K+   S++  K    ++  +QKH    A+IAA   R+  V  + +  L        + H   E  I++   EL+  +N+L+  +  +   L ++   Q F RN ++ E+W+ E +  + S D G DLN+   L  KH  +E ++++   +  +  +  ++ ++   +  D I+ + + + +++ KL +    RK K+ +  KL QF  + +D   W    E I  + ++G D    + L+KKH A++  I G+   +     +   + + D  +  ++  + + +   +S L  +A  R+Q L D+L   +   +A   E+W+ E+E
Sbjct:  221 DAEDVNVDFPDEKSIL-----TYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYE--KLASD---LLEWIEIKIIQLGEREFANTLLGVQQQMLEFNQYRTQ--EKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMIDINRAWERLEKSEHERELALREELMRQERL----EMLAAKFDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQVDGLGDEDK-SSPEVVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERE 842          

HSP 14 Score: 77.411 bits (189), Expect = 8.426e-14
Identity = 95/365 (26.03%), Postives = 171/365 (46.85%), Query Frame = 1
Query: 5245 DFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLE-NEIHAHEPVIQSVEKQGHEL----------MNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEE--------EAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEG----LREKLDVL-RKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTGLESFRIEGI----EVITSLHNQLIESNHAQSDA-IKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKV--EELYLT 6231
            D+ +   D   WI  K I +   ++   L+GV     + Q LE N+    E   + VEK   E+           N  +   P E  R +  +  AW  L++    R+  L E    Q+ L+ +  +        E W+ E Q L++  ++G+ LAAV+   KKH+A ETD+  +E++ N I    ++L  +N H+++ I Q C+G    L E L VL ++  +R + C++    F + +   D    W+ + +  + S+DYG+ L  V+ LL KH     D   ++ R++ +    E    + ++  ++ H   +A I+     L   +++L + +  R+  L   LKLQ  Y+    EE+++T
Sbjct:  275 DYEKLASDLLEWIEIKIIQLGEREFANTLLGV-----QQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPE-GRGMIDINRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERI-QVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIID----WMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVT 628          
BLAST of Spectrin alpha chain vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 268.085 bits (684), Expect = 2.455e-74
Identity = 164/505 (32.48%), Postives = 277/505 (54.85%), Query Frame = 1
Query: 5884 QFMWKTDVVESWIADKETQVKSDDYG-RDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEA---------------LEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQ----GVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLF 7338
            +F  K ++ ESW   K+  +  DDY    L+ +  L+ KHE F++ L + + + ++ I ++  +L    +++ D +  R QN+ D W  L   +  R   L   Q+R + +++L L FAKKA+ FN+W E+A EDL D    +++EEI+ L +AH  FK ++ AA+ ++  +  +  +I+S     NPYT  + EA               + E W  +  ++ +RD  L  E  +Q+ N+ LR EFA+ A+    W+Q     +R+      G+LE+ L+  +     +   K +++++E     +++ LI +N HT+++   +   W+QL     R  + +E QI  R+  G++EE ++EF   F  FDKD++G+L+  EFK CL +LG ++   ++G  D EFE +L +VDPN  G VT Q F+ FM +RET +  + ++V E+F  L  + KP+IT +EL   L  DQAE+C+  M PY  E    +P A DY +F+  L+
Sbjct:  394 KFRHKCNIHESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQ-DRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELTMHRLQKLEDAQQRLQSLDQLRLEFAKKAAPFNNWLESAREDLMDMFSVHTVEEIQELLDAHEAFKENMPAAQAEYNSIMDIAVQIESLSGQENPYTSLSKEASPITDMLFTFVFVCDINEGWNQVVDLVPKRDILLRDERSKQDRNERLRVEFANKANVVGPWIQQQGEKLRTIGFHMEGSLEKNLQVLQDLETFITSYKPNIEELEVINQEVQQALIFENPHTKYTMEAMRVGWEQLLTAIARNINEVENQILTRDSKGITEEQMKEFRASFNFFDKDQTGKLEPNEFKQCLVSLGYNIKEGDKG--DREFERLLGIVDPNGTGKVTFQAFVDFM-TRETADSDTAEQVMESFRILAGD-KPFITAEELRRELPPDQAEYCIARMAPY--EGKDAVPGALDYMSFSTALY 891          

HSP 2 Score: 72.7886 bits (177), Expect = 1.750e-12
Identity = 120/493 (24.34%), Postives = 202/493 (40.97%), Query Frame = 1
Query: 5194 QLAENRAVTLGKA--------KKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQG------HELMNESQLAN-----PDEIKRKLEHLETAWVELQQ---------LSSIRKT-KLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGD-TLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQ--------FMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIE---------GIEVITSLHNQLIESNHAQSDAIKHRYQ-----NLMDRWDKLQRESKRRKDHLLKLQERYK--KVEELYLTFAKKASAFNSWFENAEEDL-TDPVRC-NSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRII 6504
            Q A+  A  +GK         + + D+ R   D   WI +    ++S D    L   +++++K   L N     +P    VE++G      + L  + +L+N     P E K  +  +  AW  L+          L  +R+  +L+  +E  KF       E+W   K  +LS  DY D TLA +  L+KKH+AFE+D+  H+D+ + I    Q+L          +  RC+ + +    L +  + R   LED    LQ        F  K     +W+      +        +  +Q LL  HE F   + + + E          IE ++   N     +   S      +      ++ + W+++     +R D LL+  ER K  + E L + FA KA+    W +   E L T       SLE+   + +    F  S K   E+   L  +++E+Q   +  NP+T +TMEA+   W+ L   I
Sbjct:  249 QQADTAAKRIGKVLNINRDNERMMEDYERLASDLLDWINKTMPWLTSRDTDGTL---KDMQRKLDELRNYRKGEKP--PKVEEKGQLETNFNTLQTKLRLSNRPAYLPSEGK-MINDINDAWGGLEMAEKDFEDWLLMEMRRMERLDHLAE--KFRHKCNIHESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELTMHRLQKLEDAQQRLQSLDQLRLEFAKKAAPFNNWLESAREDLMDMFSVHTVEEIQELLDAHEAFKENMPAAQAEYNSIMDIAVQIESLSGQENPYTSLSKEASPITDMLFTFVFVCDINEGWNQVVDLVPKR-DILLR-DERSKQDRNERLRVEFANKANVVGPWIQQQGEKLRTIGFHMEGSLEKNLQVLQDLETFITSYKPNIEE---LEVINQEVQQALIFENPHTKYTMEAMRVGWEQLLTAI 728          

HSP 3 Score: 52.7582 bits (125), Expect = 2.240e-6
Identity = 80/334 (23.95%), Postives = 136/334 (40.72%), Query Frame = 1
Query: 3898 DLQKFLADY----RDLMSWIN-TMNALVSSDELAKDVTGAEALLERHRDLAVEIAN-RTGDFGIDQEPIGEEHHAEIDARSGTFQN---FEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWL----NRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDKT---VDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQT-LQA-------FIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENA 4827
            D ++ + DY     DL+ WIN TM  L S     +D  G    ++R  D   E+ N R G     ++P   E   +++    T Q      +    L   G    N+I +    +  A++   E+WL     R ++LD   E   +   C   E W   +++ L  +D  D T   +++L+KKHE F   +   +D++  +   A +L   E+   D +  +CQ +   W  L E  +    +L D Q  LQ+       F + A     W+    ++ +D         IQ     H+AF+  + A      SI+    +++      GQEN 
Sbjct:  267 DNERMMEDYERLASDLLDWINKTMPWLTS-----RDTDGTLKDMQRKLD---ELRNYRKG-----EKPPKVEEKGQLETNFNTLQTKLRLSNRPAYLPSEGKMI-NDINDAWGGLEMAEKDF-EDWLLMEMRRMERLDHLAEK--FRHKCNIHESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELTMHRLQKLEDAQQRLQSLDQLRLEFAKKAAPFNNWLESAREDLMDMFSVHTVEEIQELLDAHEAFKENMPAAQAEYNSIMDIAVQIE---SLSGQENP 580          
BLAST of Spectrin alpha chain vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 186.037 bits (471), Expect = 5.956e-48
Identity = 114/380 (30.00%), Postives = 217/380 (57.11%), Query Frame = 1
Query: 1777 FDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIW---LAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQA 2904
            F R AD  ++W+ + ++   DE   ++   +++ +++H+    ++ A E R   V N  Q L+D ++ K++ I++R + +   W+ LV   + +   L   +G  Q V    DM+     + ++E+ L S+D G+ L  V N+  KH+L+E+ I S  +R  +   QA  FV  +H + + IK++Q  ++  +  L +   +R+ +L D+ +L+ F+ D ++E+ +I E + +A S  VGRDL  +  L ++H+A++AEI G       +  +GQ +I+  H+  ++I+ KI  ++  W  LK  A  R++ L D+ ++ QY +DA++AESWM+EK  +V S ++G+DE S  +LL++H  +  +I+A+   I  L+ Q+
Sbjct:  394 FQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTL---TGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQS 770          

HSP 2 Score: 159.073 bits (401), Expect = 2.854e-39
Identity = 107/359 (29.81%), Postives = 192/359 (53.48%), Query Frame = 1
Query: 4954 EFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESF 6030
            E WL ++   +     G+D+A+V++ L +H+ + TD+ A E+R + +   A E I+     +D IR+R+ +I  +++K+ +  E R  TL    +L   +R +D   A + + +  + SEDYGR L+ V+N+  KH  +E++I +      ++  Q    +  ++    + IK++   L  A+  L QL   R+ +LE+S E   F + VEEE+ +I E   L +S + G  LA++  L ++H+A E ++      C  I  +GQ LID  +  AK I+ + + L+     L++ A  R+  L+D +  LQ+    +  ESW+ +K   V S+DYGRD  S  +LL +H   +  +++F
Sbjct:  402 ESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFV-AAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAF 759          

HSP 3 Score: 147.132 bits (370), Expect = 1.554e-35
Identity = 98/363 (27.00%), Postives = 188/363 (51.79%), Query Frame = 1
Query: 1459 FYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEI 2544
            F R  +  E+W+      +++  +G    +VEA +++HE     + A+EE+ Q + N+A  L++  +Y A  + K+ D ++++   L +K + R+++L          RD D   A +++       E+Y +   ++Q+ + KH    ++I +   R   +  + Q+ + + H ++E IK+R   L + +  LV   K +   L  +     F  +VE+ +I++ E +   AS + G+DL S+T LQ++H  LEA+I+      +  + +    +D+ HF A  IK K  ++   ++KL+E    R+ +L DA +  Q+Y DA+D E W+ EK  +  S + GRD     +L+++H  I+ EI
Sbjct:  394 FQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEI 756          

HSP 4 Score: 122.094 bits (305), Expect = 9.940e-28
Identity = 100/407 (24.57%), Postives = 201/407 (49.39%), Query Frame = 1
Query:  784 RQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSW---LTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDI 1992
            RQQ L +  E  KF R  D   SW+++    +  E  G+D A+V+A  ++HEA+  D+ A EE+   +   A EL ++     D I+ +++ ++  W  L KK   R   L       + +  +RD+ S    + D++A + +++  + +  V+ ++++H+  +S+I S+ E   +   + +  +   HP +E I  +   L +    L+QL  ERR   E +++L  F+ D E+ + +I + +    + +VG  L S+  L ++HE  E  +  +    + +      L++ GH+ A ++  K   L      L+E A  R+  L+D+     +  DA++ ++W+ EK+     E+Y ++  +  S +Q+H +   EI A    I  +K + + + ++  N S+ +
Sbjct:  383 RQQMLEKMAE--KFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLT---GFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQSKLMGEAIKNTSQQV 784          

HSP 5 Score: 114.775 bits (286), Expect = 1.830e-25
Identity = 88/376 (23.40%), Postives = 180/376 (47.87%), Query Frame = 1
Query: 4318 EDWMTIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNES 5445
            +D + + +  LLG+D    TV++ +K+HE  +  +  +E++ Q +   A +L++ ++Y  D I+ +   ++ +W  L + + A R+ L     L    RD D     + +       E Y     ++Q    KH   E+++ +  ER  +I    Q          +   +++R   L   +  LV   K++  +L+++     +   +++ + ++ E +   +S + G+D AS+  L  +H+ L  +I+      + +  +    I+ G   +  I+ + K +   + K+K+LA  R   L  A +   +Y   +D E+W++EK  +V SEDYGRD     +L ++H  +E+EI A    I  +++Q  +LM E+
Sbjct:  406 DDMVQVIDDELLGQDA--ATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHP--ETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQS-KLMGEA 776          

HSP 6 Score: 114.005 bits (284), Expect = 3.452e-25
Identity = 90/366 (24.59%), Postives = 183/366 (50.00%), Query Frame = 1
Query:  190 FKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQL-DVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDS 1281
            F+R AD  ESW+ + +Q   DE   +D   +++  ++H+A+  ++ A+ E    +     ++I+  +Y +++I+ R D +   W+KL+   + +   L      V   R +D       + E  + SE++G+ L  V+ +  K +     ++ Q E+   I ++A   +    PE E +  +++ +  A + L  L K+R+ +L ++ E+  FF D ++   ++ E      S++ GRDLAS+  L+++HEAL+ ++         +      L +K       I+ K + L + W  LK+ +  R E+L D + SL ++ SD  D  SW+ +   V+ +++  +D     +L++RH+  + EI +
Sbjct:  394 FQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSL-QYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKA 758          

HSP 7 Score: 102.834 bits (255), Expect = 9.801e-22
Identity = 69/276 (25.00%), Postives = 135/276 (48.91%), Query Frame = 1
Query: 2086 QQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADAC 2913
            ++F R  +  E WL ++   +  +  G+D  +V    K+H  +  D+ + ++R       A + +DE ++ AD I+K+++ +  ++ KL + L+ R+  L    +L   +RD D     + + E    S + GR L+ VQN++ KH  ++++I     R L +  + Q  + A H     I+++   +   +  L     +R+  L+DSLE   +  D  E + +++E + L  S E G+D  S   L ++H+AL A+I    S  + +  +  A 
Sbjct:  392 EKFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQAL 667          

HSP 8 Score: 97.8265 bits (242), Expect = 3.506e-20
Identity = 94/371 (25.34%), Postives = 180/371 (48.52%), Query Frame = 1
Query:  502 QFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKK---RQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADE-LSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERR-VLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAA 1599
            +F R+ D    W  +    +  E  GQD   VE   K+      D++ +EE+   +++ A  L+ ED+ + + +I K++DV   + +   L KK   R+  L    ++   FRD D   + + +    L SED+GR L  VQ +  KH  ++  + +  E+   +   A   ++ KHP++ + I+ ++  L  A+  L +   ER  +L+ S  L+ F  D  +   ++ +   + A+ E+ +D+A +  L +RH   ++EI+ R    +    +G+ LI   H  +++I  K+++L    + L +L   RR  L +    LQ +Y D   AE+W+ ++   + + D G    S  +L+++H   E  + A
Sbjct:  393 KFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKAD-VIRKREDV--IMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPET-EVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQ-YYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKA 758          

HSP 9 Score: 84.3445 bits (207), Expect = 5.004e-16
Identity = 71/301 (23.59%), Postives = 146/301 (48.50%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQL 987
            I++R + ++ ++    +  E RR  L    +     RD D   + +L+       E++ + L ++Q+   KH  +E +I +Q E   A++      +   H  +E+I+ R   L   ++ L+ + KE+   L+ +L+   F   V+E   + KE +    S+E G+DL  +  LQ++      ++  +      I +K   L+ +     + +  K K ++    +LK LA  R+++L +A +  +++ D +   SW+ EK   + SED+GRD  S  +L ++H  ++ ++ A  + + QL
Sbjct:  466 IRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQL 766          

HSP 10 Score: 81.2629 bits (199), Expect = 3.918e-15
Identity = 74/272 (27.21%), Postives = 131/272 (48.16%), Query Frame = 1
Query: 5437 NESQLANPD-----EIKRKLEHLETAWVELQQLSS---IRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHL---LKLQERYKKVEE 6219
            N+   A P+     +I R  + +E+A  E  Q      IR+  LE+ +E  KF    +  E+W+ +   ++     G   A V+  LK+H+A  TD+K  E++   + N  Q+LID++ + A  I +R + +  K D L K    R++ L   +  +      D   + + D E  ++S+DYGR L  VQ +L KH   ++ ++S + E    I +     + + H +++ IK R + L   +  L +  K R+  L   L+L   ++ VEE
Sbjct:  344 NQRPFAPPEGKLVKDINRAWQVMESAEHERAQALRNELIRQQMLEKMAE--KFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQS-QHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEE 612          

HSP 11 Score: 78.9518 bits (193), Expect = 1.937e-14
Identity = 90/416 (21.63%), Postives = 188/416 (45.19%), Query Frame = 1
Query: 3586 QRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWM----TIRESSLLGEDVDDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGD-VQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQ 4818
            +++ R+ D  + W+++    ++   +G+D  +V+   ++H+A+  D+ A  ER +++ + A EL+     +A+ I + ++ I   W+KL  K E  +  L     L     D     + +  + A + S++  + +   + +L++H  +  +I ++             E    I+ ++ +F          +   H     IK++ + +  A + L +    R+ +L+  LEL  +  D E+ + ++     +  S  +G D+   ++  L ++HE     IN +    + +      L++  H+    IK K +++ A W  LKE     R RL D  Q+LQ +  DA++ E W+ EK+     E Y     +  +  Q+H   E E+ A A+ +        +LKE+ + MG+
Sbjct:  392 EKFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQ------------HERTLAINTQAQSF----------VAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDL--ASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQ-YYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDI-------AQLKEQSKLMGE 775          

HSP 12 Score: 69.3218 bits (168), Expect = 1.946e-11
Identity = 52/179 (29.05%), Postives = 93/179 (51.96%), Query Frame = 1
Query:   82 EDIQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQ-TYSDENFKDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEH-VEVLQK 612
            E I++R+  +   + A  +  +ERR +LED+ +   F  D +E + +I E  +   S E  +DL +L    Q+H+ALE EI  +  +   +   G  +I+  H+ ++ I+ ++ QL A W KL  +   +   LK     +Q+    ++   W KEK   V SE++G+D +  V +LQ+
Sbjct:  570 EVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQR 748          

HSP 13 Score: 57.7658 bits (138), Expect = 6.237e-8
Identity = 43/175 (24.57%), Postives = 80/175 (45.71%), Query Frame = 1
Query: 2407 QFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAP 2931
            +F R AD  E W+ +   +     +G+D   V+  +K+H+AI  ++   E R   V N  Q++I+ D+Y    I K+ D +   W  L  K + R+  L    +      D   A + M + E  + S ++G+     + +L KH  + + I++      ++ TQA +    + P
Sbjct:  393 KFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHP 567          

HSP 14 Score: 56.6102 bits (135), Expect = 1.597e-7
Identity = 46/192 (23.96%), Postives = 96/192 (50.00%), Query Frame = 1
Query: 3469 QTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEI 4044
            +TE +++ + ++TQ    ++ L ++   +   LED   +  +  + +E   +I+E D    + +VG+DL S+ RL ++H+ALE ++       + + +K   L+      A+ I    +++   W KL   A   + +L ++    ++ +D  D  SW+     +V S++  +D   A +LL+RH  +  EI
Sbjct:  568 ETEVIKQRQRLLTQ---AFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEI 756          
BLAST of Spectrin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000016060.2 (pep primary_assembly:ASM223467v1:12:24666584:24674051:-1 gene:ENSORLG00000012823.2 transcript:ENSORLT00000016060.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 421.009 bits (1081), Expect = 2.027e-130
Identity = 238/530 (44.91%), Postives = 325/530 (61.32%), Query Frame = 1
Query: 5764 NNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETFDTGLESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESK---RRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEALEETWKNLQRIIQERDAELIRETKRQEENDVLRQEFAHMADKFHQWLQGVRSALMEGIGTLEEQLEATKAKSKEVKDRKIDLKQIEEKGAVLEERLILDNRHTEHSTVGLSQAWDQLDQLAMRMHHNLEQQIQARNVSGVSEEALREFSMMFKHFDKDKSGRLDHREFKSCLRALGMDLAFVEEGQVDPEFETILSVVDPNRDGFVTLQEFMAFMISRETENVQSRQEVEEAFCALTKESKPYITKQELYANLTKDQAEFCLRTMPPYISESGQPIPDAYDYRAFTGHLFQN 7344
            N  +   ++ + + +  +   ++  A  R+  L ++    QF    D  ESWI +K+  V S+DYGRDL+ VQ L  KH+  +  L +     I+ +     +L + N    + I+ R    +D W +L   S    RR +  L+ Q+    VEE      +K +   S      ED  D     +L  ++ L + H  F       E DF        ++ + G           +ALEETW+NLQ+II+ER+ EL +E +RQEEND LRQEFA  A+ FHQWL  + S+ +  +            K +E++  +  LK+IE+ GA +EE LILDN++TEHSTVGL+Q WDQLDQL MRM HNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+KSGRL+H+EFKSCLR+LG DL  VEEG+ DPEFE IL  VDPNRDG V+LQE+MAFMISRETENV+S +E+E AF AL+ E+KPY+TK+ELY NLT++QA++CL  M PY+   G+ +P A+D+  FT  LF N
Sbjct:    4 NAFDTTQVKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHE-PAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGS------EDYGD-----TLAAVQGLLKKHEAF-------ETDFTVHRDRVSDVCANG------EELIKKALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLVKLWSSRVSNV-----------RKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGNVSLQEYMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTREQADYCLSHMKPYLDSKGRELPSAFDFVEFTRSLFVN 497          

HSP 2 Score: 229.18 bits (583), Expect = 3.011e-64
Identity = 111/214 (51.87%), Postives = 154/214 (71.96%), Query Frame = 1
Query: 5116 IESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLI 5757
            + S   D+  +++++  +N R+ K+K +A  R   L ++ +LH F+R +DDEE+WI+EKK+LV SEDYGRDL GV+NL+KKH+RLE E+ AHEP IQSV   G +L +++ +   +EI+++L      W EL  LS  R  +LEES EYQ+F+  VEEEEAWI EK +L+ S DYGDTLAAVQGLLKKH+AFETD  VH D+ +D+C  G++LI
Sbjct:    1 MASNAFDTTQVKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQ-EEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELI 213          

HSP 3 Score: 160.614 bits (405), Expect = 6.811e-41
Identity = 79/207 (38.16%), Postives = 129/207 (62.32%), Query Frame = 1
Query: 2293 FDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADAC 2913
            FD   +K K++ V+ R+ K++     R+ KLN++++LHQF+RD DDEE WI EK+ + GS + GRDL GVQNL KKH+ ++AE+  HEP I  V + G+K+ + +     +I++++    + W +L + +  R + L++SLE QQ++A+  E E+W+ EK  LVGS ++G    + + LLKKH+A   D   +R  +      +D C
Sbjct:    6 FDTTQVKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRV------SDVC 206          

HSP 4 Score: 115.546 bits (288), Expect = 5.704e-26
Identity = 74/230 (32.17%), Postives = 119/230 (51.74%), Query Frame = 1
Query: 4489 YDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINER 5178
            +D   +KDK   V  R+  +K    A R++L +   L  F RD D+ E WI EK      E Y    T +Q   +KH+  EAEL A+   +QS+L +G++L +    +GQE  +++R+ +  D W  L + S  +  +L+E+     + A +++ E W+ E  + + S DYG   A+V  LL KH+   TD   H DR+ D+    +E I+      +T R  +K+I ER
Sbjct:    6 FDTTQVKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDN-TIGQEE-IQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELIKKAL--EETWRNLQKIIKER 231          

HSP 5 Score: 111.694 bits (278), Expect = 1.143e-24
Identity = 72/269 (26.77%), Postives = 144/269 (53.53%), Query Frame = 1
Query: 1960 LDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMI-NADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWM 2763
            + SN   +  +K++ + ++  +  + S +  +   L ++    QF R+++D E W+ E +  + S+D G+DL  V NL+KKH  LEA++ +H+  I S L    +  D+     + I+++  +  + + +L +    R  +L ++ +  QF  + ++EE WI+EK  + GS + G  L  VQ L+KKH+A + +   H  R+ +VC  G+++I  A     R+++K I +      +L+ + ++R+Q  +D L  Q++   A+    W+
Sbjct:    1 MASNAFDTTQVKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELIKKALEETWRNLQKIIKE-----RELELQKEQRRQEENDKLR-QEFAQHANAFHQWL 263          

HSP 6 Score: 104.76 bits (260), Expect = 1.878e-22
Identity = 65/208 (31.25%), Postives = 109/208 (52.40%), Query Frame = 1
Query: 1660 YAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENY-KEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFV 2280
            +    V  KRD +  R + ++  A  R++ L +SH    F RD D+ ++WI EK      E+Y ++ T +Q+  +KH+   AE+ A+E  I  V + G+ L D N    E+I++R+ +    W +L   S  + + L ++   QQFV NVE+ E W+ E  + + S+D G  L +V  L KKH   E D + H+DR+       ++ +
Sbjct:    6 FDTTQVKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELI 213          

HSP 7 Score: 103.219 bits (256), Expect = 5.795e-22
Identity = 65/228 (28.51%), Postives = 122/228 (53.51%), Query Frame = 1
Query:  727 NKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEID-SRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQ 1407
            +K+  V     ++K++A  R+ KL E+H + +FFRD D   SW+ EK + + SED+GRDL  VQ L++KH+ L+ +L A E  +  +     +LS+ +   ++ IQ +    +  W  L   S  R  +L+ S    +F+++  +  +W+ +   ++ +++    +A V+ L+++H   +++    RD     C N GEELI       E+    L+++ KER + +Q
Sbjct:   13 DKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCAN-GEELIK---KALEETWRNLQKIIKERELELQ 236          

HSP 8 Score: 97.4413 bits (241), Expect = 4.729e-20
Identity = 68/238 (28.57%), Postives = 122/238 (51.26%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENF-KDLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKL 798
            ++++R+ V  R++  K     RR KL ++ +   F RD D+ ESWI EK      E++ +DLT +Q+  +KH+ LE E+ A    + ++   G  + +++    E IQ RL Q    W++L ++   + R L+ +L+Y QF+  V+E   W  EK   V SE++G  L  V+ L KK   F  D     ++ +++ +  + L+             KK +E+    L+ + K+R+ +L
Sbjct:   11 VKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELI-------------KKALEETWRNLQKIIKERELEL 235          

HSP 9 Score: 93.5893 bits (231), Expect = 7.386e-19
Identity = 88/323 (27.24%), Postives = 148/323 (45.82%), Query Frame = 1
Query: 4900 KLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQHLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQK-LIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLE 5865
            KL E++R   +   L D E W+ E +  + S DYG+D   V +L  KH+ L  ++ AHE  I+ + +   +  +  T   + I++R     + ++++  L+  R   L ++ +   F   +++EEAWI EK  LV SEDYG  L  V+ L KKH+  E +   H   +  V   G EL+ ++              LE  W  LQ++   R+ +L++    Q+  D + +E A      H      +   ++ V    +KH      M+    K  D+    ++ LI DN    K  E    GL ++ D L +  +R +H LE
Sbjct:   35 KLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELIKKA--------------LEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWLVKLWSSRVSNV----RKHQEIRA-MRSQLKKIEDLGAAMEEALILDN----KYTEHSTVGLAQQWDQLDQLGMRMQHNLE 334          

HSP 10 Score: 86.6557 bits (213), Expect = 1.076e-16
Identity = 50/192 (26.04%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1039 IQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKT 1614
            ++DK++A+   ++ +K  +  R  +L+ S+ LH+F  D  D  SW+ + K ++ +++  +D+ GV+ L ++H   ++E+ + + + +S  + G++L   N    E+I  +L +       L  L   R    E++++ Q F  + E+ EAWI ++   + + D GD+L +V+ L++KHE FE       ++ 
Sbjct:   11 VKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRV 202          

HSP 11 Score: 85.1149 bits (209), Expect = 4.051e-16
Identity = 62/205 (30.24%), Postives = 103/205 (50.24%), Query Frame = 1
Query:  502 QFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQL 1116
            QF R +D+   W KEK+  V SE++G+DL  V+ L+KK      +L   E     +      L  ++   QE +  +     D  + L +L+  R ++L E+ E Q+F  + ++  +W+NEK   + SED+G  LA+VQ L +KHEA + D     ++V+ +  + +EL              K+AL   W +L+K   ER  +L
Sbjct:   44 QFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELI-------------KKALEETWRNLQKIIKERELEL 235          

HSP 12 Score: 72.0182 bits (175), Expect = 4.797e-12
Identity = 56/218 (25.69%), Postives = 100/218 (45.87%), Query Frame = 1
Query: 3829 INEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENEIKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDDK--TVDSLIKKHEDFNRAINMQEDKMQALKEFADQLV 4476
            +N  + K+ + A   + KL  S  L +F  D  D  SWI     LV S++  +D+TG + L ++H+ L                       AE+ A     Q+  D GK+L       + EI+++L    D  ++LN+    R ++L++ LE Q ++ + E+ E W+  + + +  ED  D    V  L+KKHE F     +  D++  +    ++L+
Sbjct:   18 VNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRL----------------------EAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELI 213          

HSP 13 Score: 71.2478 bits (173), Expect = 8.138e-12
Identity = 52/187 (27.81%), Postives = 89/187 (47.59%), Query Frame = 1
Query: 4255 RKKQLDQCLELQLYLRDCEQAEDWMTIRESSLL--GEDV--DDKTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRLKEKG 4803
            R+ +L++   L  + RD +  E W  I+E  LL   ED   D   V +L KKH+     +   E  +Q++ +   +L +     Q+ I+ +  + +  W  L +   A   RL +    Q F+ + +E E WINEKL     E Y D    +Q   +KH+AFE +   + +R+  +  +G+ L +K 
Sbjct:   32 RRAKLNESHRLHQFFRDLDDEESW--IKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVSDVCANGEELIKKA 216          

HSP 14 Score: 65.0846 bits (157), Expect = 7.609e-10
Identity = 41/168 (24.40%), Postives = 85/168 (50.60%), Query Frame = 1
Query: 3520 KYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARLNTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERH 4023
            ++ +++ +   +   L + + + ++ R+ D+ + WI+EK   + + D G+DLT VQ L +KH  LE +L A    ++ +     +L   +    E I Q   +  + W +L   +     +L  S++ Q+F+A+  +  +WIN    LV S++    +   + LL++H
Sbjct:   21 RFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVDHWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKH 188          
BLAST of Spectrin alpha chain vs. Ensembl Medaka
Match: SPTBN1 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101159770])

HSP 1 Score: 446.817 bits (1148), Expect = 2.330e-126
Identity = 290/959 (30.24%), Postives = 519/959 (54.12%), Query Frame = 1
Query:   88 IQERREQVLNRYSAFKEATEERRKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFK-DLTNLQSKNQKHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSEEFGQDLEHVEVLQKKFNEFMKDLEYQEEKAAEIYSKADHLLQEDFPEQESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPL--TSEDFGRDLASVQALKRKHEALDRDLIALEEKVNQLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVERNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVIAADELAKDVAGVEALMERHNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIV--NKLERLDKERVILIQLWNERRVLYEQNMDLQLFYRDTEQAEAWIAKQEAFLENNDVGDSLDSVEALIRKHEDFEKSLAAQEEKTQRLDNIANRLVENGHYAAADVNKKRDDLLIRKSNLEEKAKLRKSSLEDSHNYQLFDRDADEIKAWIVEKLKTASDENYKEPTNLQSKVQKHQNFLAEIAANESRIDDVKNRGQNLLDSNHNKSEDIKERIEELDKLWNDLVSASKVKEKNLGQASGQQQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMINADHYAHRDIEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDSYG 2949
            I+ER   +  +++  +  T  R+ +L++A  +  F+ DAD++++W+L+ ++  S  +   D  + Q+  +KH+ +  EI +    + AL       +      SE +++RL  +   ++++  + + + + L+  L   + L        W  EKE ++ S +  + LE +EV+Q +F     ++  Q  + A +   A  L+    P ++ +  ++  +     + ++L  ++++ L  A  +Q +  + ++T SW+ EK+  L  ++++ G DLA V AL+RK   ++RDL+A+E+K+  L K+A+ L+++HP+  + I+ +   +   W  +K     R E L  +  L +FL D  D  SWL+  +  IA++++   +A  E L+ +H   K+EI + +E ++  ++ GE ++T     ++ +    +L+ LD     L ++W  R+ L  Q+   QLF RDT+QAEA++  QE  L + ++  +L++ EA I+K EDF  ++ A EEK   + +   RLV +G+ ++  + +K D +  R     + A      L+D+ + Q F +D  E+  WI EK+ TA D  Y E  NL SK  KHQ F+AE+ +N+  +D +   GQ L+         +KE++  L  +W +L S ++ K K L  A+  + F ++  D++ WL  +E QL SDD GKDL SV  L KK  +LE+ +   Q  +D    Q+ Q + ++  D+D +  ++  V  ++  LQEPL KR+ KL  + ++HQF RD +DE  W+ E+ P+A ST+ G +L  VQ LIKK+Q +Q EI GH+PR  ++    Q ++         I +++ +++++W  +K + +KR   L ++ EAQQY  DA+EAE+WM E+E  + S E  KDE S  A+LKKH  L   +E Y  T+  L + +        P S+  G
Sbjct:  715 IRERIRDIQEQWATLERLTAVRKSRLQEACNHHQFQADADDIDTWMLDVLRIVSSVDVGHDEFSTQALVKKHKDVAEEIDSYRPVIEALHDQSR-TLPPEKANSEEVKSRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEASACELWIDEKEQWLNSMDIPEKLEDLEVVQHRFESLEPEMNSQASRVAVVNQVARQLIHCGHPSEKEIKAQQDKLNTRWSQFRDLVDQKKESLVSALGVQNYHLECNETKSWIKEKNKVLIESTQELGNDLAGVMALQRKLTGMERDLVAIEDKMGDLGKEAERLASEHPEQSEAIKGRLAEITGVWQEMKDGLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHENIKNEIRNYEEDYQKMRDMGE-MVTQGQTDAQHMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEAAEAAIKKQEDFMTTMDANEEKISNVVDTGRRLVADGNVSSERIQEKVDSIDQRHKKNRQAASDLLMRLKDNRDLQKFLQDCQELNLWINEKMLTAQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLDKISKDGQTLMTEKPETEGVVKEKLASLKTMWEELESTTQTKAKCLFDANKAELFTQSCADLDKWLNGLEGQLQSDDFGKDLTSVNILLKKQQMLESQVEVRQKEVDELKGQS-QALRQEGKDSDEVDGQRIIVEKKFQTLQEPLKKRRDKLMASREIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSQHVLREGSPTAELIRQRLAELQSLWEQIKKETEKRHTRLSEAHEAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVAMLKKHQILEQAVEDYADTVHQLSSTSRGLVAAGHPDSERIG 1670          

HSP 2 Score: 403.675 bits (1036), Expect = 6.436e-113
Identity = 387/1534 (25.23%), Postives = 732/1534 (47.72%), Query Frame = 1
Query: 2086 QQFVRNVEDMEIWLAEVESQLASDDCGKDLNSVTNLQKKHNLLEADISSHQDRIDSFLQQADQFVDEQHFDADGIKKKQNEVSNRYVKLQEPLDKRKIKLNDAYKLHQFYRDADDEEDWIHEKEPIAGSTNVGRDLIGVQNLIKKHQAIQAEIIGHEPRILEVCNEGQKMI-NADHYAHRD---IEKKIDDMKNIWSDLKNKADKRKQLLDDSLEAQQYLADASEAESWMREKEPLVGSTEFGKDEDSTEALLKKHDALMADIEAYRSTIDSLRTQADACKMQEAPVSDS-YGKETVM-ALYDYQEKNP---REVSMRKGDVLTLLN-------SNHKDWWKVEI-----NDRQGH---VPAAYVKKVDAMMSDIDPNAP-------EQITVASQQKN----------LENQYENXXXXXXXXXXXXXXSVQAYQLVREANDLHQWVVEKELVAVTEVITPGHLEAVQSEKKKIDEFVNXXXXXXXXXXXXXXXANKLKRSGQTEAVEKIEGIITQLQKKYEQLEEVTTRKVKDLEDCYAVQRYHRECDEAKEWIEEKDARL--NTSDVGKDLTSVQRLFRKHDALERDLVALGERVKLLDSKAAELVQTHPNEAEGIVQHQEEINEMWNKLTTKAEDYKIKLFNSIDLQKFLADYRDLMSWINTMNALVSSDELAKDVTGAEALLERHRDLAVEIANRTGDFGIDQEPIGEEHHAEIDARSGTFQNFEDFGKELLKTGHYAENE--IKEKLQSIADAKEQLNEEWLNRKKQLDQCLELQLYLRDCEQAEDWMTIRESSLLGEDVDD--KTVDSLIKKHEDFNRAINMQEDKMQALKEFADQLVEHEHYDQDGIKDKCQEVLARWGSLKENMIANRSRLGDVQTLQAFIRDADEMEIWINEKLQNTLDESYKDPTTNIQAKHQKHQAFEAELAANAERLQSILGSGQRL-KEKGQCMGQENAVEERVNKLADQWDYLVNKSKDKSEKLQEANRQAVYNAGLKDIEFWLGEVEHSLSSPDYGKDSASVDSLLSKHQVLGTDIHAHEDRIKDLNERADEFIESGTCDSDTIRERKKMINERYEKVKQLAENRAVTLGKAKKLHDFYRTIDDEEAWIREKKILVSSEDYGRDLIGVRNLKKKHQRLENEIHAHEPVIQSVEKQGHELMNESQLANPDEIKRKLEHLETAWVELQQLSSIRKTKLEESSEYQKFLDTVEEEEAWILEKQ-HLLSSTDYGDTLAAVQGLLKKHDAFETDMKVHEDKCNDICNEGQKLIDDNNHNAKAIEQRCEGLREKLDVLRKAALRRKHCLEDNSAFLQFMWKTDVVESWIADKETQVKSDDYGRDLSSVQTLLTKHETF--DTG-LESFRIEGIEVITSLHNQLIESNHAQSDAIKHRYQNLMDRWDKLQRESKRRKDHLLKLQERYKKVEELYLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALCEAHSHFKNSLKAAEEDFMYLSQLDKEIQSYGVGGNPYTWFTMEA-LEETWKNLQRIIQERDAELI 6528
            ++F R     E WL+E +  ++ D+ G DL +V    KKH  +E DI+++++R+ + +  A +   E + D   I  +++ V+  +  L E L  R+ +L     L + +++     DW+ E + +  S + G+ L+GV++L++KH  ++A+I     R+  V +  Q+   + + Y   D   I  ++  ++  + +L   A +R+  L++S    ++  + +E E W+REKE ++ S ++GKD      LL +H A   ++    + +          K  E  V+D+ +G + +   + D QE+     R  ++RK  +    N       ++  D W +++     +   GH      A VKK   +  +ID   P       +  T+  ++ N          +E +Y+ +  L R R+  L+D++  Y+++ EA+    W+ EKE   +  +  P  LE ++  + + +    E   +  ++  +   A +L   G     E I+    +L  ++ Q  ++  +K + L     VQ YH EC+E K WI+EK+  L  +T ++G DL  V  L RK   +ERDLVA+ +++  L  +A  L   HP ++E I     EI  +W ++    ++ +  L  +  LQ+FL D  D  SW++     ++S+++   +  AE LL +H ++  EI N   D+                      Q   D G E++  G        ++++LQ++     +L++ W NR+  L Q    QL+LRD +QAE ++  +E  L   ++    +  ++ IKK EDF   ++  E+K+  + +   +LV   +   + I++K   +  R    ++       RL D + LQ F++D  E+ +WINEK+    D +Y D   N+ +K  KHQAF AEL +N E L  I   GQ L  EK +    E  V+E++  L   W+ L + ++ K++ L +AN+  ++     D++ WL  +E  L S D+GKD  SV+ LL K Q+L + +   +  + +L  ++    + G  DSD +  ++ ++ ++++ +++  + R   L  ++++H F R ++DE  W+ E+  L +S D+G +L  V+ L KK+Q L+ EI  H+P    + ++   ++ E      + I+++L  L++ W ++++ +  R T+L E+ E Q++     E EAW+ E++ +++S     D  +AV  +LKKH   E  ++ + D