DDE_Tnp_1_7 domain-containing protein

Overview
NameDDE_Tnp_1_7 domain-containing protein
Smed IDSMED30005549
Length (bp)2211
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DDE_Tnp_1_7 domain-containing protein (SMED30005549) t-SNE clustered cells

Violin plots show distribution of expression levels for DDE_Tnp_1_7 domain-containing protein (SMED30005549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DDE_Tnp_1_7 domain-containing protein (SMED30005549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DDE_Tnp_1_7 domain-containing protein (SMED30005549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Human
Match: PGBD4 (piggyBac transposable element derived 4 [Source:HGNC Symbol;Acc:HGNC:19401])

HSP 1 Score: 113.235 bits (282), Expect = 1.862e-25
Identity = 73/205 (35.61%), Postives = 108/205 (52.68%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIR-WYKKVIFHLLDVAVWNSFYIFKEKTGSQ-MKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQ------GIRKETSYCCKNCMSKPALCPAPCFETWHTENN 702
            KW D ++V  L+T ++ ++I   NR  ++ ++P  IV+YN+NM  VD ADQM++ Y   RK  + WYKK   HLL + V NS+ +FK+      M +I +R A+I  +    +K  G+  ++ +        +  +G +HFP+ I      Q  T   RCK C  Q       IRKET Y C  C     LC  PCFE +HT+ N
Sbjct:  386 KWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTMSHINFRLALIERMLEKHHK-PGQQHLRGRPCSDDVTPLRLSG-RHFPKSIPATSGKQNPT--GRCKICCSQYDKDGKKIRKETRYFCAEC--DVPLCVVPCFEIYHTKKN 584          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Fly
Match: CG9839 (gene:FBgn0037633 transcript:FBtr0334332)

HSP 1 Score: 53.9138 bits (128), Expect = 4.205e-7
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  268 MSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIF-----KEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEK-----ISPPENYQR--KTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTE 696
            + +Y    K ++   K+   LL++ V+N++ ++       + G    Y E+R  II+SL   +   +  T +Q    + +T E + N  +  PE      +  P   Q+  K   + C+ C+K G+ + + Y C  C  KP LC  PCF  WH +
Sbjct:  461 LIHYQAACKELKANIKLTIFLLNILVYNAYLLYFANGQNARVGHLKSYSEFRVIIIKSLLREEVTNEPVTSIQ----KPETYERSKN--KPVPEPRLKTILHEPMLIQQNGKPAKKNCRYCHKGGMLQFSRYMCNTCPDKPGLCQEPCFLLWHEQ 609          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Fly
Match: CG9839 (gene:FBgn0037633 transcript:FBtr0081934)

HSP 1 Score: 53.9138 bits (128), Expect = 4.205e-7
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  268 MSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIF-----KEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEK-----ISPPENYQR--KTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTE 696
            + +Y    K ++   K+   LL++ V+N++ ++       + G    Y E+R  II+SL   +   +  T +Q    + +T E + N  +  PE      +  P   Q+  K   + C+ C+K G+ + + Y C  C  KP LC  PCF  WH +
Sbjct:  461 LIHYQAACKELKANIKLTIFLLNILVYNAYLLYFANGQNARVGHLKSYSEFRVIIIKSLLREEVTNEPVTSIQ----KPETYERSKN--KPVPEPRLKTILHEPMLIQQNGKPAKKNCRYCHKGGMLQFSRYMCNTCPDKPGLCQEPCFLLWHEQ 609          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162611 (zgc:162611 [Source:ZFIN;Acc:ZDB-GENE-070410-87])

HSP 1 Score: 80.4925 bits (197), Expect = 1.897e-15
Identity = 57/204 (27.94%), Postives = 95/204 (46.57%), Query Frame = 1
Query:  112 KWKDKRDV-LCLTT--AYHPSMINTANRRQQEKRK-----PIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAP---CFETWH 690
            KW D+ +V +C T   AY    +    RRQ  ++      P  +  Y+Q++  VD  DQ++ YY     +++WYKKV    LD+A  N+F + KE+ G ++ + ++ + +I  L  +  +   ++ +Q                +H P   +  E++   T  Q C QC KQ IR+ T + C+ C     LC      CF  WH
Sbjct:  237 KWMDRPEVSICSTIHQAYTGEHVERKVRRQGSRKTKSIPCPAPVSAYSQHIVEVDPFDQLLQYYIMHYNSLKWYKKVFLQFLDIAAANAFILHKEQ-GGKLTHKKFMDQLIEELCSVSEEVPEQSSIQ---------------VEHLPVSGALLESHTATTGRQACSQCKKQDIRQLTPWKCQAC--HVFLCVEVDRNCFLDWH 422          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 80.4925 bits (197), Expect = 2.854e-15
Identity = 63/213 (29.58%), Postives = 96/213 (45.07%), Query Frame = 1
Query:  112 KWKDKRDVLCLTT---AYHPSMI--NTANRRQ----QEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIF----KEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAP---CFETWHTENN 702
            +WKDKRDVL  +T   AY+   I  N   +      +E   P  +++YN++M GVD +D ++ YY+   KT +WY+   +H +D+AV N+F +     K K    M    +RE ++  L GI   R G      + A I + +       H P+ I     + R+    +CK C       +T   C  C     LC  P   C+  WH   N
Sbjct:  426 EWKDKRDVLMCSTFHKAYNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKHMGGVDVSDALIGYYTVLHKTKKWYRSFFYHFVDIAVVNAFILHQQMAKSKNQKAMTQKVFRETLVAELAGI---RAGYPPA--REAAIASTD------NHLPKYIKGDSTFGRR----KCKLC-----THKTPITCVTCQVH--LCFVPKRDCYTKWHESGN 616          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 74.3294 bits (181), Expect = 2.667e-13
Identity = 60/211 (28.44%), Postives = 94/211 (44.55%), Query Frame = 1
Query:  112 KWKDKRDVLCLTT---AYHPSMI--NTANRRQ----QEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIF----KEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAP---CFETWHTE 696
            +WKDKRDVL  +T   AY+   I  N   +      +E   P  +++YN+   G D ++ ++ YY+  R+T +WY+   +H +D+A+ N+F +     K K    M    +RE +I  LTGI     G       +A + T  +      H P  IS      R+    +CK C     + +T   C  C    ALC      C+  WH +
Sbjct:  426 EWKDKRDVLMCSTFHKAYNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKYKGGEDVSNALIGYYTVFRQTKKWYRSFFYHFVDIAIVNAFILHQQMAKSKNQKAMTQKAFRETLITELTGI-----GSASTSTPKAPVPTTGL------HLPRYISGDSTVGRR----KCKLC-----QLKTPMICATC--DVALCLVSNRNCYVKWHEQ 614          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-19f4.2 (si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-262])

HSP 1 Score: 70.4774 bits (171), Expect = 4.291e-12
Identity = 38/128 (29.69%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRRQQEKR----------KPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKE----KTGSQMKYIEYREAIIRSLTGIDNKRD 453
            KW D R+V   +T +     +T  R   +K            P  +V+YN+ M GVD +DQ++ YYS  +++ RWY+ +++H +D+A  NS+ + KE         M + ++ E + R L G+    D
Sbjct:  408 KWMDTREVSVCSTIHKAFDGDTVTRNVHDKETGSWQIKNIASPRCVVDYNKYMGGVDLSDQLLQYYSVHKRSNRWYRTLLYHFIDIAATNSYILHKEMCLAAQTVAMSHGQFMEELSRELCGVPKGSD 535          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01069162.1 (pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSDARG00000115161.1 transcript:ENSDART00000191202.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069162.1)

HSP 1 Score: 66.2402 bits (160), Expect = 8.584e-11
Identity = 51/210 (24.29%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRRQQEKRK---------PIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIF----KEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQ-HFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAP---CFETWH 690
            +WKD R+VL  +T +     +   R+ ++            P  +++YN+ M GVD +D ++ YY    KT +WY+   +H +D+AV N+F +     + K    +    +RE ++  L G+++                 + I    T  H P+ IS      R+    +C+ C+++     T   C  C  +  LC  P   C+  WH
Sbjct:  500 EWKDTREVLMCSTFHKAYGGDIVERKSKDNDGQWSTVHVPIPGAVLDYNRFMGGVDLSDALICYYKVLHKTRKWYRTFFYHFVDIAVVNAFILHQKLARAKKERPLTQKAFRETLVMELAGLESG---------------ASPIPTPSTICHNPKYISGDSTSGRR----KCRVCHQK-----TPVMCATC--EVPLCFLPKRDCYNDWH 683          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000019041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:47398238:47399566:-1 gene:ENSXETG00000007669.1 transcript:ENSXETT00000019041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 1.133e-23
Identity = 67/197 (34.01%), Postives = 105/197 (53.30%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMI-NTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKT-GSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQR-CKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHT 693
            K+ D + V  LTT +  +MI    +  +  K KP+    Y+++M GVD++DQ+  YY+  RKT  WYKK   +++ +A++NS+ ++K    G ++ Y  Y   ++ SL   D        V+        + +     +HF  +I P     +KTY QR CK C  +G+R++  Y C  C SKPALC  PCFE +HT
Sbjct:  199 KYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVPGPRLSYYNYLLQLLPSLLFGD--------VEEVPDMPGNDNVARMVGKHFIAQIPPTP---KKTYAQRKCKVCRSKGVRRDVRYYCPKCPSKPALCFHPCFEVYHT 384          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000047457.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:68625695:68627807:-1 gene:ENSXETG00000017237.1 transcript:ENSXETT00000047457.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 6.568e-23
Identity = 67/197 (34.01%), Postives = 105/197 (53.30%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMI-NTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKT-GSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQR-CKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHT 693
            K+ D + V  LTT +  +MI    +  +  K KP+    Y+++M GVD++DQ+  YY+  RKT  WYKK   +++ +A++NS+ ++K    G ++ Y  Y   ++ SL   D        V+        + +     +HF  +I P     +KTY QR CK C  +G+R++  Y C  C SKPALC  PCFE +HT
Sbjct:  405 KYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVPGPRLSYYNYLLQLLPSLLFGD--------VEEVPDMPGNDNVARMVGKHFIAQIPPT---PKKTYAQRKCKVCRSKGVRRDVRYYCPKCPSKPALCFHPCFEVYHT 590          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000012820.1 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:100487470])

HSP 1 Score: 98.5969 bits (244), Expect = 9.690e-21
Identity = 66/197 (33.50%), Postives = 103/197 (52.28%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMI-NTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKT-GSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQR-CKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHT 693
            K+ D ++   LTT +  S+I          K KP+    Y++++ GV++ DQ+  YY+  RKT  WYKK  F+++ +A+ NS+ ++K    G ++ +  Y+  ++ SL   D        V+        + +     +HF + I P  N   K Y QR CK C K+GIR++  Y C  C SKPALC  PCFE +HT
Sbjct:  419 KYCDTKNEYILTTIHDESVIVEHKTTNGPPKSKPLCSKEYSRHIDGVNKTDQI-QYYNAARKTKAWYKKAAFYMIQMALNNSYVVYKATVPGPKLSFYNYQVQLLPSLLFGD--------VEEAPDMSDNDNVVRMVGKHFIDNIPPTLN---KKYAQRACKVCRKKGIRRDVRYYCPKCPSKPALCFQPCFEIYHT 603          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000019443.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:30938263:30940062:1 gene:ENSXETG00000007374.1 transcript:ENSXETT00000019443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.590e-18
Identity = 61/187 (32.62%), Postives = 98/187 (52.41%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMI-NTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKT-GSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQR-CKQCYKQGIRKETSYCCKNCMSKPALC 663
            K+ D + V  LTT +  +MI    +  +  K KP+    Y+++M GVD++DQ+  YY+  RKT  WYKK   +++ +A++NS+ ++K    G ++ Y  Y   ++ SL   D        V+        + +     +HF  +I P     +KTY QR CK C  +G+R++  Y C  C SKPALC
Sbjct:  405 KYSDTKVVFMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVPGPRLSYYNYLLQLLPSLLFGD--------VEEVPDMPGNDNVARMVGKHFIAQIPP---TPKKTYAQRKCKVCRSKGVRRDVRYYCPKCPSKPALC 580          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Xenopus
Match: slc39a9 (solute carrier family 39 member 9 [Source:Xenbase;Acc:XB-GENE-943772])

HSP 1 Score: 80.1073 bits (196), Expect = 1.968e-15
Identity = 55/180 (30.56%), Postives = 92/180 (51.11%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMI-NTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKT-GSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQR-CKQCYKQGIRKETSYCCKNC 642
            K+ D + VL LTT +  +MI    +  +  K KP+    Y+++M GVD++DQ+  YY+  RKT  WYKK   +++ +A++NS+ ++K    G ++ Y  Y   ++ +L   D        V+        + +     +HF  +I P  N   K Y QR CK C  +G+R++  Y C  C
Sbjct:  199 KYSDTKVVLMLTTIHDETMIVQHRSGGRPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVPGPRLSYYNYLLQLLPALLFGD--------VEEVPDMPGNDNVARMVGKHFIAQIPPTPN---KRYAQRKCKVCRSKGVRRDVRYYCPKC 367          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96DM1|PGBD4_HUMAN (PiggyBac transposable element-derived protein 4 OS=Homo sapiens OX=9606 GN=PGBD4 PE=2 SV=3)

HSP 1 Score: 113.235 bits (282), Expect = 8.943e-25
Identity = 73/205 (35.61%), Postives = 108/205 (52.68%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIR-WYKKVIFHLLDVAVWNSFYIFKEKTGSQ-MKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQ------GIRKETSYCCKNCMSKPALCPAPCFETWHTENN 702
            KW D ++V  L+T ++ ++I   NR  ++ ++P  IV+YN+NM  VD ADQM++ Y   RK  + WYKK   HLL + V NS+ +FK+      M +I +R A+I  +    +K  G+  ++ +        +  +G +HFP+ I      Q  T   RCK C  Q       IRKET Y C  C     LC  PCFE +HT+ N
Sbjct:  386 KWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTMSHINFRLALIERMLEKHHK-PGQQHLRGRPCSDDVTPLRLSG-RHFPKSIPATSGKQNPT--GRCKICCSQYDKDGKKIRKETRYFCAEC--DVPLCVVPCFEIYHTKKN 584          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A1A9V034 (DDE_Tnp_1_7 domain-containing protein OS=Glossina austeni OX=7395 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 8.832e-54
Identity = 95/193 (49.22%), Postives = 127/193 (65.80%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHF-----PEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPA 669
            +SKWKDKRDVLC+TT  HP +I+  N+    K+KPIEI NYN NMSG+DR DQ+++YYS P+K+IRWYKKVIFHLLD++VWNSFYI+K    S + ++++R+ +I  L  +    +      F         +     +HF      EKI    NY+RKTYF +CK CY+Q I K TSY C+NC++KP LCP 
Sbjct:  129 ISKWKDKRDVLCITTHNHPKLIDVHNKYGTSKKKPIEIANYNANMSGIDRCDQIIAYYSSPKKSIRWYKKVIFHLLDISVWNSFYIYKRVNDSNIVFLDFRDNLINMLLKMPQNSNASDF--FLDNDNSQTHVRYTLPRHFQDAYYQEKIPATLNYKRKTYFLKCKYCYRQKITKFTSYQCQNCVNKPPLCPG 319          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A2S2Q116 (PiggyBac transposable element-derived protein 4 OS=Sipha flava OX=143950 GN=PGBD4_11 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.655e-52
Identity = 93/201 (46.27%), Postives = 137/201 (68.16%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEK-TGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 705
            VSKWKDKRDV+C+TT + P++I + NR  +EK KP+EIV YN+ MSGVDR+DQM+SYYSCPRK+ +WYKKV+FHLLDV +WN+F+I+K+  +   +++ ++R+++I+    I  +     L    + +   ++IN     HF E I  P+N++RK YF+ C  C+K+  RK+TS+ CK C  K  LC   CFE +H E  +
Sbjct:   94 VSKWKDKRDVICITTNHKPTIILSKNRYGREKLKPLEIVKYNEYMSGVDRSDQMISYYSCPRKSAKWYKKVLFHLLDVTLWNTFFIYKKHFSPKNLRFKDFRDSLIKHFLQIPLQATCDQLFNKLKPKTNRSDINVPDNAHFQEPIPLPKNFKRKKYFKNCIVCFKKKERKQTSFQCKIC--KVPLCAGKCFEDYHKEKKL 292          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A2H8TEJ6 (PiggyBac transposable element-derived protein 4 (Fragment) OS=Melanaphis sacchari OX=742174 GN=PGBD4_0 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 6.092e-51
Identity = 94/200 (47.00%), Postives = 132/200 (66.00%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEK-TGSQMKYIEYREAIIRSLTGI-DNKRDGRTLVQFKRAQIQTNEINNNGT---QHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWH 690
            VS+W+DKR+VL +TT + P M++  N+  Q+K KP  I  YN NMSG+DR+DQM+SYYS PRKTIRWYKKVIFH LD++VWN++Y++K+  + S  ++I++REAII+ L  + +N   G  L++ K      N +    +    H  EKI  P  ++R  YF RC+QC KQ   K+TS+ CK C  +P LCP  CF  +H
Sbjct:  163 VSRWRDKREVLSITTGHKPEMVSVKNKYGQQKMKPKHIAEYNLNMSGIDRSDQMISYYSSPRKTIRWYKKVIFHFLDISVWNAYYLYKKSLSTSNYRFIDFREAIIQKLIYLPENIIHGNQLIKNKNIHRNMNNLPRPTSPILGHMQEKIPHPPGWKRSGYFLRCRQCTKQKKVKQTSWRCKMCPEQPPLCPGICFSMYH 362          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A1E1WUD1 (DDE_Tnp_1_7 domain-containing protein (Fragment) OS=Pectinophora gossypiella OX=13191 GN=g.7129 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 6.000e-50
Identity = 90/206 (43.69%), Postives = 135/206 (65.53%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQF----------KRAQIQTNEINNNGTQ-HFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWH 690
            VS+WKDKR V  +TT +HP ++   N+  +   KP+E+V+YN +MSG+D++DQMM+YYS P+KTIRWYKK+IFH+LD+ +WN++YI+ +   ++M+ +E+RE+IIRS   ++ + D   L++           K  +  T+     G Q H+PE I  P N++R   F +C++C      KETSY CK C+ KPALCP  CFE +H
Sbjct:  149 VSRWKDKRPVNMITTKHHPRLVVCKNKHGKTMFKPVEVVDYNAHMSGIDKSDQMMAYYSSPKKTIRWYKKIIFHILDMMMWNAYYIYNKHCNNKMQMLEFRESIIRSYIQVEERFDCLKLMKISHRNANRKSRKDEEPITDSPAEPGIQNHWPEMIPVPPNHKRAKVFLKCRECRANKTMKETSYRCKGCLDKPALCPG-CFEAYH 353          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: X1WLJ9 (Beta-hexosaminidase OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.254e-48
Identity = 94/200 (47.00%), Postives = 133/200 (66.50%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEK-TGSQMKYIEYREAIIRSLTGI-DNKRDGRTLVQFKRAQIQTNEINNNGT---QHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWH 690
            VS+W+DKR+VL +TT + P M++  N+  Q+K KP  I  YN NMSG+DR+DQM+SYYS PRKTIRWYKKVIFH LD++VWN++Y++K+  + S  ++I++REAII+ L  + +N   G  L++ K  +   N +    +    H  EKI  P  ++R  YF RC+QC KQ   K+TS+ CK C  +P LCP  CF  +H
Sbjct:  401 VSRWRDKREVLSITTGHKPEMVSVKNKYGQQKMKPKHIAEYNLNMSGIDRSDQMISYYSSPRKTIRWYKKVIFHFLDISVWNAYYLYKKSLSTSNYRFIDFREAIIQKLIYLPENIIHGNQLIKNKNIRRSINNLPRPTSPILGHMQEKIPHPPGWKRSGYFLRCRQCTKQKKVKQTSWRCKVCPEQPPLCPGICFSMYH 600          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000025849.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20558813:20568326:-1 gene:ENSAMXG00000025123.2 transcript:ENSAMXT00000025849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.684e-17
Identity = 66/211 (31.28%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAY--HPSMINTANRRQQEKRK-------PIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENY----QRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 705
            KW D R+V   +T +  H   I  +  +Q +          P  +  YNQ+M GVD +DQ++ YYS   KT+RWY+K+ +H LD+A  NSF + KE   +Q K    + A +  LT   ++  GR L+        T     +   H P  IS  ++     +  T  +RC+ C  QG RK+T + C    S P         T+H++N V
Sbjct:  359 KWMDTREVSVCSTIHPAHSGEIAQSRMKQDDGSWAKVSIPCPTPVKQYNQHMGGVDLSDQLIQYYSAQHKTMRWYRKMFYHFLDIATTNSFILHKELCLAQEKQPLTQRAFLEKLT---SELCGRPLL--------TKSSAKSPADHVPVAISNLQSATPSDKATTGRRRCEHCQSQGRRKDTPWKCSK-FSGP---------TYHSQNIV 548          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000057483.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:107197084])

HSP 1 Score: 77.7962 bits (190), Expect = 2.194e-14
Identity = 60/218 (27.52%), Postives = 96/218 (44.04%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRR---------QQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQ----MKYIEYREAIIRSLTGIDNKR---DGRTLVQFKRAQI-QTNEINNNGTQHFPEKISPPENYQRKTYFQR-CKQCYKQGIRKETSYCCKNCMSKPA--LCPAPCFETWHTENNV 705
            KW+D RDV   +T +      +  RR          Q+   P  +  YN+ M GVD +D ++ YYS  +KT RWY K+  H +D+AV NSF I KE   ++    +    +RE +   L  +   +         +   + + Q  E+   G    P      EN  + T  +R C QC     + +T++ C++C S P   +    CF  WH + + 
Sbjct:  435 KWRDTRDVTVCSTVHKAYSGQSVQRRIRIKNGTWSTQQIPVPEPVKAYNKFMGGVDLSDALIKYYSVTQKTRRWYVKLFLHFVDIAVVNSFIIHKEMALARKQKPLSQKSFREVLCMELADVGQPQVSIPAEVPSETSSSSVPQDKELKPKGCFPVPVSEVSAENRMKATQGRRKCVQC-----KMKTAFMCRSC-STPLCIIVDRMCFTEWHDQKSA 646          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030720.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:111196469])

HSP 1 Score: 74.7146 bits (182), Expect = 1.523e-13
Identity = 58/208 (27.88%), Postives = 97/208 (46.63%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRRQQEKRK---------PIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYK-QGIRKETSYCCKNCMSKPALCPAP---CFETWHTE 696
            KW DK +V   +T +     +T  R+ + K+          P  ++ YN+ M GV  ++Q++ YY+   KT++WY+K+ F+ LD+A  NS+ + KE       Y  + E +   L G+  K    T+V+    +     +   GT+   ++     +  RKT    C  C K +G + +T + CK C     LC  P   CF  WH +
Sbjct:  374 KWMDKHEVSVCSTIHRAFTGDTVQRKVKSKKLVYTTQSIPCPSPLMEYNKVMGGVGLSNQLIQYYTAQHKTLKWYRKLFFYFLDIAATNSYILHKELNQDSRTYKAFMEELTTQLCGVPQK----TIVK----KASGVHVPVPGTEIVLDRRMRASD-GRKT----CVYCRKYRGTQTKTPWKCKEC--DVYLCLQPDRNCFYAWHPD 566          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000044282.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:111196469])

HSP 1 Score: 74.7146 bits (182), Expect = 1.523e-13
Identity = 58/208 (27.88%), Postives = 97/208 (46.63%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRRQQEKRK---------PIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYK-QGIRKETSYCCKNCMSKPALCPAP---CFETWHTE 696
            KW DK +V   +T +     +T  R+ + K+          P  ++ YN+ M GV  ++Q++ YY+   KT++WY+K+ F+ LD+A  NS+ + KE       Y  + E +   L G+  K    T+V+    +     +   GT+   ++     +  RKT    C  C K +G + +T + CK C     LC  P   CF  WH +
Sbjct:  374 KWMDKHEVSVCSTIHRAFTGDTVQRKVKSKKLVYTTQSIPCPSPLMEYNKVMGGVGLSNQLIQYYTAQHKTLKWYRKLFFYFLDIAATNSYILHKELNQDSRTYKAFMEELTTQLCGVPQK----TIVK----KASGVHVPVPGTEIVLDRRMRASD-GRKT----CVYCRKYRGTQTKTPWKCKEC--DVYLCLQPDRNCFYAWHPD 566          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040471.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000380.1:299910:301487:-1 gene:ENSAMXG00000041266.1 transcript:ENSAMXT00000040471.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.779e-13
Identity = 53/207 (25.60%), Postives = 93/207 (44.93%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRRQQEKRK---------PIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQR-CKQCYK-QGIRKETSYCCKNCMSKPALCPA-PCFETWHTE 696
            KW DK +V   +T +     +T  R+ + K+          P  ++ YN+ M GV  ++Q++ YY+   KT++WY+K+ F+ LD+A  NS+ + KE       Y  + E +   L G+  K+     V                     ++++ P+   + T  +R C  C   +G + +T + CK C     L P   CF  WH++
Sbjct:  339 KWMDKHEVSVCSTIHRAFTGDTVQRKVKSKKLVYTTQSIPCPSPLMEYNKVMGGVGLSNQLIQYYTAQHKTLKWYRKLFFYFLDIAATNSYILHKELHQDSRTYKAFMEELTTQLCGVKQKKGVHVPVTAA------------------DQVTDPK--VKMTNLRRTCVYCRTYRGTKAKTYWMCKECDLYLCLLPERNCFYAWHSD 525          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002004.1 (pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gene:ENSPMAG00000001819.1 transcript:ENSPMAT00000002004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.885e-13
Identity = 52/210 (24.76%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  115 WKDKRDVLCLTTAYHPSMINTANRRQQEKR------------KPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQ--MKYIEYREAIIRSLTGIDNKRDGRTL-VQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCP-APCFETWHTE 696
            W + R V  +T  ++    N   +++  KR            +P  I +Y  +M GV   DQM+ YY   RKT +W KK++ + L +A+ N++ ++K+ +  +  +  + + E +  +L   D +    ++ V  +  Q+         T+H    I P +        +RC+ CY+ G R++T++ C  C  K  LC    CF  +H++
Sbjct:  286 WMNTRLVTLITNIHNADTHNFVRQQKTRKRDGTALLSRIELQRPNAIADYMDHMRGVVHFDQMIQYYHFTRKTHKWTKKIVLYFLQMALHNAYVLYKKYSTDEKKLTLLAFHEVLFNALIHFDPQEWAVSVDVTPQLTQV---------TEHAMTSIMPSQ--------RRCRVCYRNGRRRDTTWECNVC--KIPLCLRGDCFVQYHSQ 476          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007705.1 (pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene:ENSPMAG00000006959.1 transcript:ENSPMAT00000007705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 4.045e-13
Identity = 31/89 (34.83%), Postives = 57/89 (64.04%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKE 372
            +S W+DKR V  L+T   P M+   +   +   KP  +V+YN+ M GVDR+DQ  SYY+  R + +W++ +++ LL++++ N + +++E
Sbjct:  244 LSVWRDKRVVATLSTNQDPRMVRPVD---EGPIKPAPVVHYNRFMGGVDRSDQYRSYYAVGRASKKWWRYIVWFLLNLSIVNGWLLYRE 329          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001816.1 (pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-1 gene:ENSPMAG00000001650.1 transcript:ENSPMAT00000001816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 6.246e-10
Identity = 47/194 (24.23%), Postives = 87/194 (44.85%), Query Frame = 1
Query:  193 QEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQ----MKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQH----------FPEKISPPENYQRKTYFQRCKQCY---------KQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 705
            +  +KP  ++NYN  M  VD A Q+ +++   R+  +W+K + F LL+ AV NS+ +++     Q    M  +E+R  + + L G  + R G  L +  RA+      +++G             +P     P+ +    +  R + C          ++G   +TSY C+ C     LC   CF  +H++  +
Sbjct:  345 EGSQKPHPLLNYNMCMGKVDIASQLQTWFELGREGRKWWKYMFFFLLNTAVVNSYILYRLSNMPQPRNAMSQLEFRLLLAKQLVGRVDVRKGPGLRRVGRARGGGGGGSSSGGGGQNRRCIERVLWPAPSVSPQQHACVKFAGRKRVCVLCSSRNKRTRRGRSVQTSYGCQICNVN--LCQVGCFTGYHSKEQL 536          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Nematostella
Match: EDO34572 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP20])

HSP 1 Score: 59.3066 bits (142), Expect = 1.262e-10
Identity = 42/152 (27.63%), Postives = 75/152 (49.34%), Query Frame = 1
Query:  238 MSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFK-EKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWH 690
            M GVD ADQ  +    P K+ RWY+ + F L++ A  N+F +++  ++ +++  +++R  +I  L    + R      + KRA    +E+  +G  HFP K++            RC  C ++  RK +++ C     +  LC   CFE +H
Sbjct:    1 MGGVDYADQKRNDDRIPIKSRRWYRYLAFFLMETAAVNAFILYQNSRSHNKISQLDFRLELIEQLIANFSSR------KRKRA---ADEMEASGESHFPVKVT----------INRCVNCAERNERKRSTWGC-----EVTLCVG-CFEPYH 127          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000021107.2 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101163734])

HSP 1 Score: 62.3882 bits (150), Expect = 1.112e-9
Identity = 60/214 (28.04%), Postives = 90/214 (42.06%), Query Frame = 1
Query:  112 KWKDKRDVLCLTTAYHPSMINTANRRQQEKR----------KPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGS----QMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPP---ENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALC---PAPCFETWHT 693
            +W D R+ + L T  HP        R Q+            +P  +  +N+ M GVD + QM++  S  RKT RW   V  HLLD+AV NS+ I KE + +     +   +++E +   L G+      +T                 G  HFP   S     E  QR +  +  KQCY    ++ T + C+ C     LC      CF+ +HT
Sbjct:  410 RWMDTRE-MSLCTTVHPVHGGETIVRWQKTEDGRSQRAPLPRPTAVSEFNKYMGGVDTSGQMLTTNSVHRKTRRWDVTVFQHLLDIAVTNSYIIQKELSSALEQKPLSRQDFQEQLCAELLGVPLAEPPQT----------------TGDGHFPSPTSKGRDIETSQRASKGR--KQCYF--CKRSTPWMCEKC--GIGLCLQLDRNCFKIYHT 600          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-130m23.5 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:105354747])

HSP 1 Score: 62.3882 bits (150), Expect = 1.245e-9
Identity = 49/216 (22.69%), Postives = 94/216 (43.52%), Query Frame = 1
Query:  118 KDKRDVLCLTTAYHPSMINTANRRQQEKR----------------KPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGS---------QMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWH 690
            +D + V CL+T   P ++  +  RQQ  +                +P+ ++ Y +NM GVD  DQ+   Y   R   +W++  ++  +++ + N++ + +E  G          Q     +R  + + L G  + +  R + +  R +   + I      H  E++S     +R    +RC+ C  +G+R E+ + CK C     LC   CF  +H
Sbjct:  478 RDVKMVNCLSTNSAPGIVGISPGRQQHDKEEEGESDSMDGCLGVPRPLPLLLYQENMRGVDLCDQLRECYQVGRPCKKWWRYFLWFYVNLCIVNAYIVMRESRGGAPPAGFNGKQFTQRHFRVRLAQQLIG--DYQGARGMERAARKRHADSPIEYG---HRLERMS-----ERS---RRCRNCTNKGLRHESVFGCKIC--NVHLCRGGCFSEFH 678          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027888.1 (pep primary_assembly:ASM223467v1:17:9217998:9219211:-1 gene:ENSORLG00000025878.1 transcript:ENSORLT00000027888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 7.591e-9
Identity = 27/85 (31.76%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  118 KDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKE 372
            K  ++VL ++T +  + ++T     ++  KP  I++YN    GVD  D++ + YSC RKT RW   + F+++DV+ +N++ ++ E
Sbjct:  195 KRNKNVLVMSTMHTDASLST-----RDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSE 274          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037833.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:101160710])

HSP 1 Score: 59.6918 bits (143), Expect = 8.979e-9
Identity = 27/85 (31.76%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  118 KDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKE 372
            K  ++VL ++T +  + ++T     ++  KP  I++YN    GVD  D++ + YSC RKT RW   + F+++DV+ +N++ ++ E
Sbjct:  392 KRNKNVLVMSTMHTDASLST-----RDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSE 471          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029842.1 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101157644])

HSP 1 Score: 56.225 bits (134), Expect = 1.241e-7
Identity = 32/108 (29.63%), Postives = 59/108 (54.63%), Query Frame = 1
Query:  118 KDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGID 441
            K  ++VL L+T +  S +   + R+   +KP  I++YN+   GVD  D++++ YSC R T RW   +  +++D++ +N++ I++E     M +   R  I     G D
Sbjct:  643 KKNKNVLLLSTKH--SRVEICHERRD--KKPEMILDYNKTKGGVDNLDKLLATYSCRRMTKRWPLAMFHNMIDMSAYNAYVIWREMHPDWMPWNRNRRRIFLEQLGKD 746          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000067287.1 (SMESG000067287.1)

HSP 1 Score: 424.476 bits (1090), Expect = 1.475e-144
Identity = 199/200 (99.50%), Postives = 200/200 (100.00%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 705
            VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTG+DNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV
Sbjct:   79 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGMDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 278          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000047155.1 (SMESG000047155.1)

HSP 1 Score: 430.254 bits (1105), Expect = 1.073e-142
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 705
            VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV
Sbjct:  362 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 561          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000062987.1 (SMESG000062987.1)

HSP 1 Score: 226.098 bits (575), Expect = 1.423e-70
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
Query:  388 MKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 705
            MKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV
Sbjct:    1 MKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 106          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000075593.1 (SMESG000075593.1)

HSP 1 Score: 215.312 bits (547), Expect = 1.594e-61
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
Query:  415 IIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 705
            IIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV
Sbjct:  415 IIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRKETSYCCKNCMSKPALCPAPCFETWHTENNV 511          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000025842.1 (SMESG000025842.1)

HSP 1 Score: 107.842 bits (268), Expect = 8.025e-26
Identity = 60/143 (41.96%), Postives = 92/143 (64.34%), Query Frame = 1
Query:  106 VSKWKDKRDVLCLTTAYHPSMINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTLVQFKRAQIQTNEINNNGTQHFPE 534
            V KWKDKRDVL ++  ++  M+ T +R  +E  KP  IV+YN NMSG+D++DQMMSYY+ P+++IRWY KV FH+LD+A+WNS +I+ +    + ++     +II+   G D    G++ V  K  + +T+  N     HFP+
Sbjct:   73 VLKWKDKRDVLMVSIKHNADMVITTSR-GKEIVKPKMIVDYNINMSGIDKSDQMMSYYAYPKRSIRWYMKVFFHMLDIALWNSCWIYNKINPEKSEF-----SIIQ---GAD---LGKSSVTQKSYRAETSSSN---AAHFPD 200          
The following BLAST results are available for this feature:
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PGBD41.862e-2535.61piggyBac transposable element derived 4 [Source:HG... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG98394.205e-726.45gene:FBgn0037633 transcript:FBtr0334332[more]
CG98394.205e-726.45gene:FBgn0037633 transcript:FBtr0081934[more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1626111.897e-1527.94zgc:162611 [Source:ZFIN;Acc:ZDB-GENE-070410-87][more]
pgbd42.854e-1529.58piggyBac transposable element derived 4 [Source:ZF... [more]
pgbd42.667e-1328.44piggyBac transposable element derived 4 [Source:ZF... [more]
si:dkey-19f4.24.291e-1229.69si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
CABZ01069162.18.584e-1124.29pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSD... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000019041.11.133e-2334.01pep primary_assembly:Xenopus_tropicalis_v9.1:7:473... [more]
ENSXETT00000047457.16.568e-2334.01pep primary_assembly:Xenopus_tropicalis_v9.1:4:686... [more]
ENSXETT00000012820.19.690e-2133.50piggyBac transposable element-derived protein 4 [S... [more]
ENSXETT00000019443.11.590e-1832.62pep primary_assembly:Xenopus_tropicalis_v9.1:2:309... [more]
slc39a91.968e-1530.56solute carrier family 39 member 9 [Source:Xenbase;... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q96DM1|PGBD4_HUMAN8.943e-2535.61PiggyBac transposable element-derived protein 4 OS... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1A9V0348.832e-5449.22DDE_Tnp_1_7 domain-containing protein OS=Glossina ... [more]
A0A2S2Q1161.655e-5246.27PiggyBac transposable element-derived protein 4 OS... [more]
A0A2H8TEJ66.092e-5147.00PiggyBac transposable element-derived protein 4 (F... [more]
A0A1E1WUD16.000e-5043.69DDE_Tnp_1_7 domain-containing protein (Fragment) O... [more]
X1WLJ91.254e-4847.00Beta-hexosaminidase OS=Acyrthosiphon pisum OX=7029... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000025849.21.684e-1731.28pep primary_assembly:Astyanax_mexicanus-2.0:6:2055... [more]
ENSAMXT00000057483.12.194e-1427.52piggyBac transposable element-derived protein 4-li... [more]
ENSAMXT00000030720.11.523e-1327.88piggyBac transposable element-derived protein 4-li... [more]
ENSAMXT00000044282.11.523e-1327.88piggyBac transposable element-derived protein 4-li... [more]
ENSAMXT00000040471.11.779e-1325.60pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002004.11.885e-1324.76pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gen... [more]
ENSPMAT00000007705.14.045e-1334.83pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene... [more]
ENSPMAT00000001816.16.246e-1024.23pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO345721.262e-1027.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021107.21.112e-928.04piggyBac transposable element-derived protein 4 [S... [more]
si:ch211-130m23.51.245e-922.69piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000027888.17.591e-931.76pep primary_assembly:ASM223467v1:17:9217998:921921... [more]
ENSORLT00000037833.18.979e-931.76piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000029842.11.241e-729.63piggyBac transposable element-derived protein 4 [S... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067287.11.475e-14499.50SMESG000067287.1[more]
SMESG000047155.11.073e-142100.00SMESG000047155.1[more]
SMESG000062987.11.423e-70100.00SMESG000062987.1[more]
SMESG000075593.11.594e-61100.00SMESG000075593.1[more]
SMESG000025842.18.025e-2641.96SMESG000025842.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005549 ID=SMED30005549|Name=DDE_Tnp_1_7 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2211bp
AAGGGAGTAGTGCGATCGTGTTTTCTATTGAATTTATAGTTCTTATTGAT
ACGTTTAACGATATTTATTATTATTTATATAACTATACGCCAAAATCAGA
CTTATGTGTCCAAATGGAAAGATAAACGGGATGTGCTATGTCTAACAACA
GCTTACCACCCAAGCATGATAAACACAGCTAACCGGCGACAACAGGAAAA
GAGAAAACCAATTGAAATAGTGAATTATAATCAGAATATGTCAGGTGTAG
ACAGAGCAGATCAGATGATGTCCTATTATTCCTGTCCACGGAAGACAATT
AGATGGTATAAAAAGGTAATCTTTCATCTACTGGATGTAGCAGTATGGAA
TTCTTTCTACATCTTTAAAGAAAAGACAGGTTCTCAAATGAAGTATATAG
AGTACAGGGAAGCAATCATACGATCTCTAACTGGTATAGATAATAAACGG
GATGGAAGAACTTTGGTTCAATTTAAACGTGCACAAATCCAAACCAATGA
AATCAACAACAATGGAACACAGCATTTTCCTGAGAAAATTTCACCTCCTG
AAAATTATCAGCGAAAAACATATTTTCAGCGTTGTAAACAATGTTATAAA
CAGGGAATAAGGAAGGAAACATCATATTGCTGCAAGAATTGCATGTCAAA
ACCTGCACTGTGTCCTGCACCATGCTTTGAAACATGGCATACCGAAAATA
ATGTATAATAATTATAAAATTATAATAAATTTTTTTGTCATTTATTTATT
TTTGTTTGATTAAGAACTAACATTTCGTGTAAAACTCCCAAAAATACTTT
GTTGCATACAAAAATTGCTTGTTTGAACCATTAAACCTGTCATTTACGTT
TTTAAATTTTTGCTGTTATAGCCGCCATCGTCCTATCACTTAGTGTATAG
AGTCCGCTGGCGCCATGACGGTTATAGCCGCAACTAAATTAATCAAAATT
AAGTTTATTTAAGCAGAAAGAGTAAAACTATACTTCTAACATTCTAAAAA
TCACAAAAACATATAGTGTCAATTTTCGAACTTCGCTTGTTCCTACTGTC
CGTCAACGTGTTAATATGTTTAGTTTGATATATAAAGTTTTTTTATCATA
AATAGATTTATTATTGAATTCCATTAATATTTAATTAATCAACAAAAAGT
ATAAATATTAATATTTAAGAAGCGGCAATTTCTCTTTTTGTCACTGGCCA
GTCCAACACTAGAGTGAGAATATCTATAATCTACTAATACCTAAAAATGA
ATCAAATGTGATATTTTTATTTATGAATTACTTTATTACCAGTTAATATT
AAACCATTTTTATAATTCAAATCTTTTATTTTCACAATTTATCTTAATTT
TAATCCTTTTTTATGAGCTTATATCACTTCTTTATTTTCCAATCAACGCT
GTACTGTTGCTCTCAAAAATAACTACTACAAAATCCTATATTGTCCCAGT
ACGCCAGGTTATGGTAATATCTATTTTGACAAGCATTTGGTTGTAAAATG
CATTTGAAAATATAATAATATTTACTATAGTAACTCTTTTTTACACCACA
GACGTGTTTTTCTATTATTTATGCTCAATCAATCCTTTGTTTTTATTAAA
CCCAAAAAATTTCACCCGATTTTATATCGATCACACGCCATGTGAGTGGC
AATATCTTACAATTAGAAATCACTACTGTGTAAAAGATTGAAAAAAATTG
TGTTAAATCCATAAAAAGATTGACCCTAGAGCCTGACAAAAAACTAAAAC
GATGAGTCCAAAATGAGTCGATGTAGCATAATACCATCACTTACAGCTAC
GGTAAAATCTCGTAGAGAATTTTCTAATTTTATTTTGATGTATAACAAAA
GCTCTTATCACATTCGCAAAGAAGCACGTCATTCTGCTACAATATAAAAA
AAACAAAAGATACAATAAACATATTCGATAATATATCGATACTTCCATGG
AAGCGGGAGAATATTTTAACTTTAGATAATCTAGTTGTAGTTCAAAACCT
TAGCAGAACTGTCGTTGGCGTTAAACACAAATAAGCTTGCATTTTGAATG
TTAAATTTATTTTTAGTTTATTCAAAAAGTAAATTAACAATTTTCTTTGG
TTAAATTTATTAAAGTGTTTACTGTGTTCAGATTTTCTGCTTTTTAAATA
CCAAATAACAATAATAATAATTTATAAATAAATAAATAACTAAATAAATT
AATTTGGCAAC
back to top

protein sequence of SMED30005549-orf-1

>SMED30005549-orf-1 ID=SMED30005549-orf-1|Name=SMED30005549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=181bp
MINTANRRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKK
VIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTGIDNKRDGRTL
VQFKRAQIQTNEINNNGTQHFPEKISPPENYQRKTYFQRCKQCYKQGIRK
ETSYCCKNCMSKPALCPAPCFETWHTENNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR029526PGBD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 31..53