Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30005548
Length (bp)1115
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005548

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30005548SMESG000057127.1 Contig143_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30005548SMESG000057127.1 Contig143_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30005548SMESG000057127.1 Contig143_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 411.379 bits (1056), Expect = 4.142e-142
Identity = 189/350 (54.00%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768])

HSP 1 Score: 412.149 bits (1058), Expect = 4.569e-142
Identity = 192/350 (54.86%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE LT++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1B (tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:18809])

HSP 1 Score: 411.379 bits (1056), Expect = 1.058e-141
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 410.994 bits (1055), Expect = 1.259e-141
Identity = 189/350 (54.00%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3D (tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:24071])

HSP 1 Score: 410.994 bits (1055), Expect = 1.259e-141
Identity = 189/350 (54.00%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-9 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:Q20221])

HSP 1 Score: 409.453 bits (1051), Expect = 2.784e-141
Identity = 189/351 (53.85%), Postives = 265/351 (75.50%), Query Frame = 3
Query:   72 KMREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQ---DFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            + REV+ I+VGQAG+QM NA WEL+C+EHGI+ +G +  +     D  SF+TFF E  +G +VPRAI VDLEPT IDEIRT +Y+ L+HP+ L+   EDAANN+ARGHYTIGK +I+  M+R+R+    C  +QGF+V +S+GGGTGSG +AL+ E LSV++ K +K +  IYPAPQ++T++VEPYNS+LT    +E++D   ++DNEA YDIC + L+++RP Y N+NRLIAQ+ S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+PII + +A HE +T++EIT++ F+PG Q+++CD R GKYM+CC+ YRG + P+ VN A+  +K +  I FVDWCPTG
Sbjct:    5 RSREVISIHVGQAGVQMGNACWELYCLEHGIQPDGMINEEDSLGVDDDSFNTFFSETMAGKHVPRAIMVDLEPTPIDEIRTGTYKTLFHPEQLLTGKEDAANNYARGHYTIGKEIIDVVMDRVRRLVENCRGLQGFLVFHSFGGGTGSGFTALLMERLSVDYGKKSKLEFCIYPAPQVSTSMVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDLARPTYTNLNRLIAQVISSVTASLRFDGALNVDLTEFQTNLVPYPRIHFPLTTYAPIISAEKAYHEQMTVAEITQQCFEPGAQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIASVKTKRSIQFVDWCPTG 355          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: mec-12 (Tubulin alpha-3 chain Detyrosinated tubulin alpha-3 chain [Source:UniProtKB/Swiss-Prot;Acc:P91910])

HSP 1 Score: 407.527 bits (1046), Expect = 1.277e-140
Identity = 191/350 (54.57%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQ---DFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREV+ I++GQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF TFF E  SG +VPRA+ VDLEPTVIDEIRT +YR+L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+R+ A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K AK + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   +SP+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+ C+ +RG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFSTFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688])

HSP 1 Score: 404.06 bits (1037), Expect = 2.849e-139
Identity = 185/348 (53.16%), Postives = 263/348 (75.57%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQ-DFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREV+ I+VGQAG+Q+ NA WEL+C+EHGI+ +G +  D Q D  SF TFF +  +G YVPR+I VDLEPTV+DEIRT +Y+ L+HP+ +I   EDAANN+ARGHYT+GK +I+  ++R+R+ A  C  +QGF V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L++ RP Y N+NR+I+Q+ S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L++++IT   F+P NQ+++CD R GKYM+ C+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDQQADGESFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLSVDRPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISADKAYHEALSVNDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTG 348          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688])

HSP 1 Score: 404.06 bits (1037), Expect = 2.979e-139
Identity = 185/351 (52.71%), Postives = 264/351 (75.21%), Query Frame = 3
Query:   66 LIKMREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQ-DFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            +  MREV+ I+VGQAG+Q+ NA WEL+C+EHGI+ +G +  D Q D  SF TFF +  +G YVPR+I VDLEPTV+DEIRT +Y+ L+HP+ +I   EDAANN+ARGHYT+GK +I+  ++R+R+ A  C  +QGF V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L++ RP Y N+NR+I+Q+ S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L++++IT   F+P NQ+++CD R GKYM+ C+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    3 VFNMREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDQQADGESFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLSVDRPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISADKAYHEALSVNDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTG 353          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 402.134 bits (1032), Expect = 1.645e-138
Identity = 184/348 (52.87%), Postives = 262/348 (75.29%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDA-QDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREV+ I+VGQAG+Q+ NA WEL+C+EHGI+ +G +   +  +  SF TFF +  SG YVPR+I VDLEPTV+DEIRT +Y+ L+HP+ +I   EDAANN+ARGHYT+GK +I+  ++R+R+ A  C  +QGF V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L++ RP Y N+NR+I+Q+ S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L++S+IT   F+P NQ+++CD R GKYM+ C+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTG 348          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 411.379 bits (1056), Expect = 5.180e-142
Identity = 190/350 (54.29%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 407.912 bits (1047), Expect = 1.004e-140
Identity = 188/350 (53.71%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + A+YPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V Y+P+I + +A HE L+++EIT   F+P NQ+++ D R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 407.142 bits (1045), Expect = 2.347e-140
Identity = 188/350 (53.71%), Postives = 260/350 (74.29%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + +++GQAG+Q+ NA WEL+C+EHGI+ +G +  D        SF TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I   +A HE LT++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDDSFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 378.252 bits (970), Expect = 7.705e-129
Identity = 183/361 (50.69%), Postives = 248/361 (68.70%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTS--------------FHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREVV I +GQ GIQ+ NA WEL+ +EHGI  +G LK   +   S                TFF E  +G  VPR+I VDLEPTVID++R    R L+HP+ LI+  EDAANN+ARG Y+IGK VI++   RL+K A  CDS+QGF++ +S GGGTGSG ++L+ E LS ++SK  K   A+YP+P+++TA+VEPYN+LLT    M+++D V ++DNEA YDIC   L + RP Y N+NRLIAQI S+ T S+RF  S++ DL + QTNL+P+PRIHFP V Y+P++ + R+AHE   I+ +T   F+  N +++CD R GK+M+CC+ YRG + P+ VN AV  IK +  I FVDWCPTG
Sbjct:    1 MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDARTFFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSKKCKLDFAVYPSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVDRPAYRNLNRLIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTG 361          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 311.612 bits (797), Expect = 6.935e-103
Identity = 158/347 (45.53%), Postives = 225/347 (64.84%), Query Frame = 3
Query:   81 EVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTSFHTFFQEVPSGNYV-PRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQ-AIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            E++ I++GQAG+Q+ANA WELFC+EHGI  NG+L     D  SF TFF+       V PR + +D EPTVIDEIRT SYRNL+HPD LI   +D+ +NFARG+  +   ++++ M  +R+ A  C +++GF+V  + GGG+GSGL   I E L  +F K     +  +YP+P ++  IVEPYN+LL A   M+  DV  ++DNEA YDIC   LN+  P Y N+NR+IAQ+ S+ T S RFG        +LQTNL+PYPRIH+P +NY+P++    +    ++ +++T + F   NQ++RC+   GKYM+  + YRG I P ++N A+ +IKR     FVDW PTG
Sbjct:    6 EIIQIHIGQAGVQIANACWELFCLEHGILANGRLTQSPMD-DSFLTFFEFTSHQPCVQPRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAIRRVADRCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFLVYPSPSISPVIVEPYNALLAAHFSMDCADVSFIVDNEALYDICANTLNVPAPTYTNLNRIIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTG 351          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l2 (tubulin, alpha 8 like 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1646])

HSP 1 Score: 416.001 bits (1068), Expect = 1.117e-143
Identity = 194/350 (55.43%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKL---KYDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+QM N  WEL+C+EHGI+ +G++   K       SF TFF E  +G YVPRAI VDLEPTVIDE+RT +YR L+HP+ LI+  EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV+F K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN+A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMPSHKPVGGHDDSFTTFFSETGAGKYVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNSCFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l (tubulin, alpha 8 like [Source:ZFIN;Acc:ZDB-GENE-030131-9167])

HSP 1 Score: 415.231 bits (1066), Expect = 1.728e-143
Identity = 193/350 (55.14%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G +  D    +   SF+TFF E  SG +VPRA+ VDLEP VIDE+R+ +YR L+HP+ LI+  EDAANN+ARGHYT+GK +I+  +ER+RK    C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V YSPII + +A HE L++SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+ +IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGNMPSDKTIGKSDDSFNTFFSETGSGKHVPRAVFVDLEPAVIDEVRSGTYRQLFHPEQLISGKEDAANNYARGHYTVGKEIIDMVLERVRKLTDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba4l (tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-030131-5588])

HSP 1 Score: 411.764 bits (1057), Expect = 4.075e-142
Identity = 189/349 (54.15%), Postives = 263/349 (75.36%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDF--TSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I++GQAGIQM N+ WEL+C+EHG + +G +   ++    +SF TFF E  +G YVPRA+ +DLEPTV+DEIR   YR L+HP+ LI+  EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + ++YPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA +DIC + L+I RP Y N+NRLIAQI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V YSPII + +A HE L++ EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+ +IK R  I FVDWCPTG
Sbjct:    1 MRECISIHIGQAGIQMGNSCWELYCLEHGFQPDGTIVDSSRSLADSSFGTFFSETGAGKYVPRAVFIDLEPTVVDEIRNGHYRQLYHPEQLISGKEDAANNYARGHYTIGKEIVDSVLDRMRKMADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIFDICKRNLDIERPSYTNLNRLIAQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVPEITNACFEPANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIANIKTRRSIQFVDWCPTG 349          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba2 (tubulin, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1970])

HSP 1 Score: 411.379 bits (1056), Expect = 5.718e-142
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +Y  L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L++SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN+A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYSQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIDRPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKACHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch211-114n24.6 (si:ch211-114n24.6 [Source:ZFIN;Acc:ZDB-GENE-120214-26])

HSP 1 Score: 411.379 bits (1056), Expect = 6.038e-142
Identity = 191/350 (54.57%), Postives = 262/350 (74.86%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+QM NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1c (tubulin alpha 1c [Source:NCBI gene;Acc:394675])

HSP 1 Score: 412.535 bits (1059), Expect = 3.442e-142
Identity = 192/350 (54.86%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE LT+++IT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 411.379 bits (1056), Expect = 9.594e-142
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 411.379 bits (1056), Expect = 9.594e-142
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 411.379 bits (1056), Expect = 9.594e-142
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 411.379 bits (1056), Expect = 9.594e-142
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1c (tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:1095409])

HSP 1 Score: 411.764 bits (1057), Expect = 4.031e-142
Identity = 192/350 (54.86%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE LT++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 411.379 bits (1056), Expect = 7.266e-142
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3a (tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:1095406])

HSP 1 Score: 410.994 bits (1055), Expect = 8.647e-142
Identity = 189/350 (54.00%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3b (tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:1095408])

HSP 1 Score: 410.994 bits (1055), Expect = 8.647e-142
Identity = 189/350 (54.00%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869])

HSP 1 Score: 410.609 bits (1054), Expect = 1.592e-141
Identity = 191/350 (54.57%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q8WQ47|TBA_LEPDS (Tubulin alpha chain OS=Lepidoglyphus destructor OX=36936 PE=1 SV=2)

HSP 1 Score: 417.542 bits (1072), Expect = 2.114e-143
Identity = 193/350 (55.14%), Postives = 265/350 (75.71%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFT---SFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+Q+ NA WEL+C+EHGI+ +G++  D    T   SF+TFF E  SG +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + A+YPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V Y+P+I S +A HE LT+SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGTGDDSFNTFFSETGSGKHVPRAVYVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISSEKAYHEQLTVSEITNTCFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q91060|TBA_NOTVI (Tubulin alpha chain OS=Notophthalmus viridescens OX=8316 PE=2 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.222e-142
Identity = 192/350 (54.86%), Postives = 266/350 (76.00%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+QM NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRAI VDLEP+VIDE+RT +YR L+HP+ LI+  EDAANN+ARGHYTIGK +I++ ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDQVLDRMRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P41383|TBA2_PATVU (Tubulin alpha-2/alpha-4 chain OS=Patella vulgata OX=6465 GN=TUB2 PE=2 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 9.598e-142
Identity = 191/350 (54.57%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + +++GQAG+QM NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYT+GK +I+  ++R+RK A  C  +QGF++ +S+GGGTGSG S+L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE LT++EIT   F+P NQ+++CD R GKYMSCC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHIGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMSCCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P18258|TBA1_PARLI (Tubulin alpha-1 chain OS=Paracentrotus lividus OX=7656 PE=2 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.036e-141
Identity = 192/350 (54.86%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+QM NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYT+GK +I+  ++R+RK A  C  +QGF++ +S+GGGTGSG S+L+ E LSV++ K +K + A+YPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE LT+SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDIVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q52PV9|TBA_TYRPU (Tubulin alpha chain OS=Tyrophagus putrescentiae OX=59818 PE=1 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.636e-141
Identity = 190/350 (54.29%), Postives = 265/350 (75.71%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFT---SFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+Q+ NA WEL+C+EHGI+ +G++  D    T   SF+TFF E  SG +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK +  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + A+YPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ +L + QTNL+PYPRIHFP V YSP+I + +A HE LT++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGTGDDSFNTFFSETGSGKHVPRAVYVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLSDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVELTEFQTNLVPYPRIHFPLVTYSPVISAEKAYHEQLTVAEITNTCFEPQNQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAGIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A7M6D9 (Tubulin alpha chain OS=Dugesia ryukyuensis OX=79738 PE=2 SV=1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 278/350 (79.43%), Postives = 326/350 (93.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTS---FHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREV+ INVGQAGIQMANA+WELFCIEHGIE +GKL+ D++ F     FHTFFQEVPSGN+VPRAIN+DLEPTVIDEIRTA+YR+LWHPDYLINCCEDAANNFARGH+T+GK+VIE+F+++LRKC  AC SVQGFIVLNSYGGGTGSGLSALIFE+L +E+S++AKFQQ IYPAPQLATAIVEPYN+LL+ASK +E+TDVVMLIDNEAT++IC ++L+ISRP YNN+NRL+AQIFSAMTVSIRFG+SL++DL+QLQTNL+PYPRIHFP VNY+PI+D HRA HE L+I+EITRELF+  NQLI+CDLRLGKYMSCCIQYRGLITPRQVN+ VY+IKRRT+I+FVDWCPTG
Sbjct:    1 MREVISINVGQAGIQMANAAWELFCIEHGIEADGKLR-DSERFAQNVGFHTFFQEVPSGNFVPRAINIDLEPTVIDEIRTANYRHLWHPDYLINCCEDAANNFARGHFTVGKNVIERFLDQLRKCVHACQSVQGFIVLNSYGGGTGSGLSALIFEHLDIEYSQSAKFQQCIYPAPQLATAIVEPYNALLSASKSIEHTDVVMLIDNEATFEICTRQLSISRPVYNNLNRLLAQIFSAMTVSIRFGSSLNHDLLQLQTNLVPYPRIHFPAVNYAPILDPHRANHEKLSITEITRELFESSNQLIKCDLRLGKYMSCCIQYRGLITPRQVNLGVYEIKRRTDISFVDWCPTG 349          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: W4ZJ54 (Tubulin alpha chain OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 8.256e-149
Identity = 193/350 (55.14%), Postives = 265/350 (75.71%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+QM N+ WEL+C+EHGI+ +G +  D    ++  +F+TFF E  +G +VPRA+ VDLEP+V+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIG+  I+  M+R+R+ A  C  +QGF++ +S+GGGTGSGL+AL+ E LSV+F K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V Y+P+I S +A HE L++SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQMGNSCWELYCLEHGIQPDGMMPGDTSPGKENDAFNTFFSETGNGKHVPRAVMVDLEPSVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGREHIDNVMDRIRRLADNCSGLQGFLIFHSFGGGTGSGLNALLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYQNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISSEKAFHEQLSVSEITTSCFEPLNQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: Q7Z1L8 (Tubulin alpha chain OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 5.328e-147
Identity = 203/349 (58.17%), Postives = 276/349 (79.08%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTS--FHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            M+E++CIN+GQAGIQMANA WELFC EHGI  +GK++    D  S  F+TFF + PS  YVPR +++DLEPTV+DEIRT +YR L+HPD LIN  EDAA+NFARGH+TIGKS+I+  M +LRK    CD ++GF++++SYGGGTGSG   L+ E + +E++K  K    IYP P+L+T+ VEPYN++LT+   +E  ++ +  DNE+ YDIC K L+I+RP Y+N+NRL+AQI+SA+TVS+R+ +SL+ +L Q+ TNLIPYPRIHF  VNYSPI+ + RAAHE  ++ E+TR +F+PG+QL+R ++++GKYMSCC+QYRG ITPR VN A+++IKRRT+I FVDWCPTG
Sbjct:    1 MKEIICINIGQAGIQMANAIWELFCQEHGITADGKMRSGLTDGDSRAFNTFFFQSPSDQYVPRVLSIDLEPTVVDEIRTGTYRQLFHPDSLINGEEDAASNFARGHFTIGKSIIDVAMAQLRKVVDNCDGLEGFLMISSYGGGTGSGFQTLMLEKIGIEYAKRLKISVVIYPCPKLSTSTVEPYNAVLTSHFTLEQGELSVFFDNESMYDICTKTLDINRPTYSNLNRLLAQIYSAITVSLRYESSLNANLSQIVTNLIPYPRIHFSMVNYSPIVSAQRAAHEQFSVVELTRNVFEPGSQLLRVNMKVGKYMSCCLQYRGDITPRAVNEAIFEIKRRTDIKFVDWCPTG 349          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A158QAW2 (Tubulin alpha chain OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS6620 PE=3 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.007e-143
Identity = 197/351 (56.13%), Postives = 269/351 (76.64%), Query Frame = 3
Query:   72 KMREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQ---DFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            KMREVV ++VGQAG+Q+ NA WEL+C+EHGI+ +G +  D     + +SF+ FF E PSG +VPRA+ VDLEPTV+DE+R+ +YRNL+HP+ LI+  EDAANN+ARGHYTIGK VI+  M+R+R+    C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K AK Q +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA Y+IC K L+I  P Y N+NRLIAQI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+PII S +A HE L++SEIT + F+PG+Q+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    5 KMREVVSVHVGQAGVQIGNACWELYCLEHGIQPDGMMPADESYGIESSSFNAFFSETPSGKHVPRAVFVDLEPTVVDEVRSGTYRNLFHPEQLISGKEDAANNYARGHYTIGKEVIDVCMDRIRRITERCQGLQGFLIFHSFGGGTGSGFASLMMERLSVDYGKKAKLQFSIYPAPQISTAMVEPYNSILTTHTTLEHSDCAFMVDNEAIYEICRKNLDIKSPTYTNLNRLIAQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPIISSEKAHHEQLSVSEITNQCFEPGSQMVKCDPRNGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTG 355          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A131XCY7 (Tubulin alpha chain (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 4.408e-143
Identity = 199/351 (56.70%), Postives = 265/351 (75.50%), Query Frame = 3
Query:   72 KMREVVCINVGQAGIQMANASWELFCIEHGIECNGKL---KYDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            KMRE + I++GQAGIQM NA WEL+C+EHGIE NGK+   K       SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI+  EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV+F K +K Q ++YPAPQ+ATA+VEPYNS+L     +E+TD   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V Y+P+I S +A HE LT++EIT   F+P +QL++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    6 KMRECLSIHIGQAGIQMGNACWELYCLEHGIEPNGKVSSEKVSTMTDDSFNTFFAETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLYHPEQLISGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQCSGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLQFSVYPAPQVATAVVEPYNSILMTHTTLEHTDCSFMVDNEAIYDICRRNLDIDRPTYTNLNRLIGQIVSSITASLRFEGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISSEKAYHEQLTVAEITNSCFEPAHQLVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 356          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba8l2 (tubulin alpha chain-like [Source:NCBI gene;Acc:103042625])

HSP 1 Score: 416.001 bits (1068), Expect = 8.129e-144
Identity = 194/350 (55.43%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKL---KYDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+QM N  WEL+C+EHGI+ +G++   K       SF TFF E  +G YVPRAI VDLEPTVIDE+RT +YR L+HP+ LI+  EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV+F K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN+A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMPSQKPVGGHDDSFTTFFSETGAGKYVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNSCFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000025205.2 (tubulin alpha-8 chain-like [Source:NCBI gene;Acc:103041851])

HSP 1 Score: 411.379 bits (1056), Expect = 4.897e-142
Identity = 188/349 (53.87%), Postives = 263/349 (75.36%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLK--YDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + +++GQAG+QM N+ WEL+C+EHGI+ +G +     A   +SF TFF +  +G YVPRA+ +DLEP V+DEIR   YR L+HP+ LI+  EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + ++YPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA +D+C + L+I RP YNN+NRLIAQI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V YSPII + +A HE L++SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK R  I FVDWCPTG
Sbjct:    1 MRECISVHIGQAGVQMGNSCWELYCLEHGIQPDGMIAPGSSAMSDSSFGTFFSDTGAGKYVPRAVFIDLEPAVVDEIRNGHYRQLYHPEQLISGKEDAANNYARGHYTIGKEIVDSVLDRMRKMADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIFDLCKRNLDIERPSYNNLNRLIAQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITNSCFEPTNQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIASIKTRRSIQFVDWCPTG 349          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch211-114n24.6 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:103034569])

HSP 1 Score: 411.379 bits (1056), Expect = 5.832e-142
Identity = 191/350 (54.57%), Postives = 262/350 (74.86%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+QM NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000019222.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418])

HSP 1 Score: 410.994 bits (1055), Expect = 6.498e-142
Identity = 192/350 (54.86%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G +  D        SF+TFF E  SG +VPRA+ VDLEP+VIDE+R+  YR L+HP+ LI+  EDAANN+ARGHYT+GK +I+  +ER+RK    C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V YSPII + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+ +IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDKTIGGGDDSFNTFFSETGSGKHVPRAVFVDLEPSVIDEVRSGIYRQLFHPEQLISGKEDAANNYARGHYTVGKEIIDVVLERVRKLTDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISTEKAYHEQLSVAEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 411.379 bits (1056), Expect = 6.647e-142
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK +  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L++SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRVRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 409.068 bits (1050), Expect = 2.902e-143
Identity = 189/350 (54.00%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 333.954 bits (855), Expect = 1.242e-113
Identity = 168/354 (47.46%), Postives = 240/354 (67.80%), Query Frame = 3
Query:   78 REVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTS-----FHTFFQEVPSGNYVPRAINVDLEPTVIDE---IRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            R+ + I++GQAG+QM NA WEL+C+EHGI+ +G L     D TS     F+TFF E  SG +VPRAI +DLEP+VI E   +RT +         ++   E  ++   RG    G+ +  + + R R  +  C  +QGF++ +S+GGGTGSG ++L+ E LS ++ K +K +  IYPAPQ++TA+VEPYN++LT    +E++D   ++DNEA YDIC KKL+I  P Y N+NRLIAQ+ S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG I P+ VN A+  IK R  + FVDWCPTG
Sbjct:    3 RDCISIHIGQAGVQMGNACWELYCLEHGIKPDGHLATHP-DVTSVVDSSFNTFFSETGSGKHVPRAIFIDLEPSVIGEPCGLRTLTVGGXLRMSMMLAGREVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTG 355          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 227.639 bits (579), Expect = 7.031e-72
Identity = 114/327 (34.86%), Postives = 193/327 (59.02%), Query Frame = 3
Query:  135 WELFCIEHGIECNGKLKYDAQ-DFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQ-AIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCP 1109
            WE+   EHGI+  G    D+       + ++ E   G YVPRAI VDLEP  +D +R+  +  ++ PD  +     A NN+A+GHYT G  +++  ++ +RK A +CD +QGF + +S GGGTGSG+  L+   +  E+     +   A  P+P+++  +VEPYN+ L+  + +ENTD    IDNEA YDICF+ L ++ P Y ++N L++   S +T  +RF   L+ DL +L  N++P+PR+HF    ++P+       +  LT+ E+T+++FD  N +  CD R G+Y++    +RG ++ ++V+  + +++ +    FV+W P
Sbjct:    3 WEVISDEHGIDPTGSYHGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYIIQVLYTVVASGPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIP 329          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 177.948 bits (450), Expect = 5.092e-52
Identity = 109/352 (30.97%), Postives = 186/352 (52.84%), Query Frame = 3
Query:   78 REVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTSFH-TFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPD--YLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYP-APQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPI-IDSHRAAHEGLTISEITRELFDPGNQLIRC--DLRLGK-YMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCP 1109
            RE++ + +GQ G Q+    W+  C EHGI  +G L+  A + T     FF +    +Y+PRA+ +DLEP VI+ I  +SY NL++P+  YL      A NN+A GH + G+ + E+  + + + A   DS++   +         + L           F K      +++P   +++  +V+PYNSLLT  +  +N D V+++DN A   I   +L+I  P ++ IN+L++ I SA T ++R+   ++NDL+ L  +LIP PR+HF    Y+P+  D   A+    T+ ++ R L  P N ++    D +    Y++     +G + P QV+ ++  I+ R   NF+ W P
Sbjct:    3 REIITLQLGQCGNQIGFEFWKQLCAEHGISPDGILEDFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVINSIVNSSYANLYNPENIYLSEHGGGAGNNWASGH-SQGEKIHEEIFDIIDREADGSDSLEKCPLTRRLSATNWNELCKYF-----CRFPKKLIQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGP 348          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005307.1 (pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 gene:ENSPMAG00000004835.1 transcript:ENSPMAT00000005307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 3.602e-44
Identity = 66/123 (53.66%), Postives = 92/123 (74.80%), Query Frame = 3
Query:   78 REVVCINVGQAGIQMANASWELFCIEHGIECNGKL---KYDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRK 437
            RE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++   K       SF+TFF E  +G +VPRA+ VDLEPTV+  +RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +++  ++R+RK
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSEKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVGAVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRK 124          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 385.185 bits (988), Expect = 1.141e-132
Identity = 187/351 (53.28%), Postives = 252/351 (71.79%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLK----YDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREV+ INVGQAG Q+ NA WEL+ +EHGI+ +G L+            F TFF E   G +VPRAI VDLEP VIDE+RT  ++ L+HP+ LIN  EDAANN+ARGHYT+G+ ++++  ER+RK A  CD +QGF+  +S GGGTGSGL +L+ ENLS E+ K +K + A+YPAPQL+T++VEPYN++LT    +E+ D   ++DNEA YDIC + L ISRP ++N+N LIAQ+ S++T S+RF  SL+ DL + QTNL+PYPRIHFP V+Y+PI+   RA HE  ++SEIT   F+PGNQ+++CD   GKYM+ C+ YRG +  R V  AV  +K +  +  VDWCPTG
Sbjct:    1 MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTG 351          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 370.163 bits (949), Expect = 9.203e-127
Identity = 181/351 (51.57%), Postives = 250/351 (71.23%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLK----YDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREV+ INVGQAG Q+ NA WEL+ +EHGI+ +G L+            F TFF E   G +VPRAI VDLEP VIDE+R   Y++L+HP+ LI+  EDAANN+ARGHYT+G+ ++   ++R+RK A  CD +QGF+  +S GGGTGSGL +L+ E LS E+ K +K + A+YPAPQ++T++VEPYN++LT    +E+ D   ++DNEA YD+C + L+I RP + N+N LIAQ+ S++T S+RF  SL+ DL + QTNL+PYPRIHFP V+YSP++   +A HE  ++SEIT   F+PGNQ+++CD R GKYM+ C+ YRG +  R V  AV  +K +  +  VDWCPTG
Sbjct:    1 MREVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTG 351          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 257.299 bits (656), Expect = 1.567e-82
Identity = 128/346 (36.99%), Postives = 210/346 (60.69%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLK-YDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCP 1109
            MRE++ I+ GQ G Q+  A WE  C EHG++ NG    +D       + +F E  SG +VPR+INVDLEP  ID +R ++  NL+ PD  I     A N +A+GHYT G  +++  M+ +R+ A  CDS+QGF + +S GGGTGSG+  L+   +  EF        ++ P+P+ +  +VEPYN+ L+  + +E++D    IDNEA YDIC + L +++P Y ++N L++ + S +T S+R+   L++DL +L  NL+P+PR+HF  V Y+P+      +   LT+ E+T+++FD  N +   D R G+Y++    +RG ++ ++V   ++ ++ +    FV+W P
Sbjct:    1 MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIP 346          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 145.206 bits (365), Expect = 9.234e-40
Identity = 95/355 (26.76%), Postives = 177/355 (49.86%), Query Frame = 3
Query:   81 EVVCINVGQAGIQMANASWELFCIEHGIECNG-----KLKYDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHP--DYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSH---RAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            E++ +  GQ G  +    W     EH I  +G         +  D T    FF+E     + PRAI +D EP+VI ++   ++R  + P   ++ +    A N++A G Y IG    +  + ++ K   + D+ +GF +L+S  GGTGSGL + + E L   + K      +++PA + +  +V+ YN++L   + +E++D  ++ DN +  +I  K          + N+LI+ I S++T SIRF + + + +  + + LIP P +HF + +++P    +     AH+G +  ++  +L DP N L+   +    Y +      G + PRQ++ A+  +++R  I F  W  + 
Sbjct:    4 EIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTK--PFFRENSRNKFTPRAIMMDSEPSVIADVEN-TFRGFFDPRNTWVASDGASAGNSWANG-YDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPA-RSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMTKLQQR--IKFPSWSSSA 351          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT1])

HSP 1 Score: 410.994 bits (1055), Expect = 2.922e-142
Identity = 190/350 (54.29%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYT+GK +++  ++R+RK A  C  +QGF++ +S+GGGTGSG S+L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE LT++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO41766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G2])

HSP 1 Score: 410.223 bits (1053), Expect = 5.149e-142
Identity = 192/350 (54.86%), Postives = 261/350 (74.57%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDF---TSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT SYR L+HP+ LI   EDAANN+ARGHYTIGK  +++ ++RLRK A  C  +QGF + +S+GGGTGSG S+L+ E LSV++ K +K + A+YPAP +A+A+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  SL+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE LT++EIT   F+P NQL++CD R GKYM+CC+ +RG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTQGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGSYRQLFHPEQLITGKEDAANNYARGHYTIGKQQVDQVLDRLRKLADQCSGLQGFFIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAVYPAPHIASAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQLVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT0])

HSP 1 Score: 410.223 bits (1053), Expect = 6.473e-142
Identity = 189/350 (54.00%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYT+GK +I+  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY3])

HSP 1 Score: 409.838 bits (1052), Expect = 7.455e-142
Identity = 190/350 (54.29%), Postives = 263/350 (75.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYT+GK +I+  ++R+RK A  C  +QGF++ +S+GGGTGSG S+L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S699])

HSP 1 Score: 409.838 bits (1052), Expect = 8.590e-142
Identity = 189/350 (54.00%), Postives = 262/350 (74.86%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+QM NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+  DLEPTV+DE+RT +YR L+HP+ LI   EDAANN+ARGHYT+GK +I+  ++R+RK A  C  +QGF++ +S+GGGTGSG S+L+ E LSV++ K +K + AIYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE LT++EIT   F+P NQ+++CD R GKYM+CC+ +RG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFADLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEMIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITTSCFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000034557.1 (tubulin alpha chain [Source:NCBI gene;Acc:101168810])

HSP 1 Score: 412.535 bits (1059), Expect = 1.846e-142
Identity = 191/350 (54.57%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L++SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020468.2 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:101155224])

HSP 1 Score: 413.69 bits (1062), Expect = 2.929e-142
Identity = 188/350 (53.71%), Postives = 266/350 (76.00%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I++GQAG+QM NA WEL+C+EHGI+ +G++  D   +    SF+TFF E  +G +VPRA+ VDLEP+V+DE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF++ +S+GGGTGSG ++L+ E LSV++ K +K + A+YPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YD+C + L+I RP Y N+NRLI QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP V Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P++VN A+  IK +  I FVDWCPTG
Sbjct:   43 MRECISIHIGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTISGGDDSFNTFFSETGAGKHVPRAVFVDLEPSVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDLCRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKEVNAAIATIKTKRSIQFVDWCPTG 392          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000017746.2 (tubulin alpha-1C chain-like [Source:NCBI gene;Acc:101160296])

HSP 1 Score: 409.838 bits (1052), Expect = 5.438e-142
Identity = 190/350 (54.29%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+Q+ NA WEL+C+EHGI+ +G++  D    +   SF+TFF E  +G + PRAI +DLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L++SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGRGDDSFNTFFSETGAGKHSPRAIFIDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000028969.1 (tubulin alpha-1C chain-like [Source:NCBI gene;Acc:101160296])

HSP 1 Score: 410.609 bits (1054), Expect = 1.101e-141
Identity = 190/350 (54.29%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + ++VGQAG+Q+ NA WEL+C+EHGI+ +G++  D    +   SF+TFF E  +G + PRAI +DLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYNS+LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L++SEIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGRGDDSFNTFFSETGAGKHSPRAIFIDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000033163.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 410.609 bits (1054), Expect = 1.298e-141
Identity = 190/350 (54.29%), Postives = 264/350 (75.43%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYD---AQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MRE + I+VGQAG+Q+ NA WEL+C+EHGI+ +G++  D        SF+TFF E  +G +VPRA+ VDLEPTVIDE+RT +YR L+HP+ LI   EDAANN+ARGHYTIGK +I+  ++R+RK A  C  +QGF+V +S+GGGTGSG ++L+ E LSV++ K +K + +IYPAPQ++TA+VEPYN++LT    +E++D   ++DNEA YDIC + L+I RP Y N+NRLI+QI S++T S+RF  +L+ DL + QTNL+PYPRIHFP   Y+P+I + +A HE L+++EIT   F+P NQ+++CD R GKYM+CC+ YRG + P+ VN A+  IK +  I FVDWCPTG
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 350          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000057127.1 (SMESG000057127.1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 347/347 (100.00%), Postives = 347/347 (100.00%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG
Sbjct:    1 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 347          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000043298.1 (SMESG000043298.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 245/349 (70.20%), Postives = 286/349 (81.95%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDA--QDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            MREV+CINVGQAGIQMANA+WELFCIEHGIE  GKL+     +    FHTFFQEVPSGN+VPRAIN+DLEPTVIDEIRTASYR+LWHPDYLINCCEDAANNFARGH+T+GK++IE+F+++LRKC  +C +VQGFIVLNSYGGGTGSGLSALIFE+L +E+SK+AKFQQ IYPAPQLATAIVEPYN+LL+ASK +E+TDVVMLIDNEAT++IC ++LNI                                    Q N IPYPRIHFP VNY+PI+D HRA HE L+I+EITRELF+  NQLI+CDLRLGKYMSCCIQYRGLITPRQVN+ VY++KRRT+++FVDWCPTG
Sbjct:    1 MREVICINVGQAGIQMANAAWELFCIEHGIEATGKLRETDRFEHNVGFHTFFQEVPSGNFVPRAINIDLEPTVIDEIRTASYRHLWHPDYLINCCEDAANNFARGHFTVGKNIIERFLDQLRKCVHSCHAVQGFIVLNSYGGGTGSGLSALIFEHLDIEYSKSAKFQQCIYPAPQLATAIVEPYNALLSASKSIEHTDVVMLIDNEATFEICSRQLNI------------------------------------QCNDIPYPRIHFPAVNYAPILDPHRANHEKLSITEITRELFESSNQLIKCDLRLGKYMSCCIQYRGLITPRQVNLGVYEVKRRTDVSFVDWCPTG 313          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000009421.1 (SMESG000009421.1)

HSP 1 Score: 424.091 bits (1089), Expect = 2.950e-146
Identity = 195/349 (55.87%), Postives = 269/349 (77.08%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQ--DFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            M E++CIN GQAG+Q++NA+WELFCIEHGI+ NG LK + +  D  +F TFFQEVP G YVPRAI++DLEPTV+DE+RT +YRNLWHPD LI+  EDAANN+ARGH+T+GK +I+  +ER+R+    CD +QGF ++NS+GGGTGSG  AL+ E + VE++K  KFQ  I P+  +ATA+VEPYNSLL+ +   E+ ++  + DNEA Y +    L+ISRP YNN+NR++AQ+FS+++VS+R+ + L+ D  Q+ TNL+PYPRIH+P  NYSPI+   RA HE L+  EITR +FD  +Q++   +  G+YM+CC+QYRG +TP+ VN AV++IKRRT++ FV+WCPTG
Sbjct:    1 MPEIICINTGQAGVQLSNAAWELFCIEHGIQANGLLKENLRNGDSMAFKTFFQEVPGGQYVPRAISIDLEPTVLDEVRTGAYRNLWHPDQLISGSEDAANNYARGHFTLGKLLIDATVERIRRAVDMCDRLQGFFIINSFGGGTGSGFGALLIERIGVEYTKRPKFQVVIVPSNHMATAVVEPYNSLLSLNSSTEHAEICNMTDNEAVYQLLTNTLDISRPTYNNLNRILAQVFSSLSVSLRYESLLNADFDQIITNLVPYPRIHYPVCNYSPIVSVRRAEHEQLSTHEITRSIFDDQSQMVSIKISDGRYMACCLQYRGNVTPKDVNNAVFEIKRRTDVKFVEWCPTG 349          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000071756.1 (SMESG000071756.1)

HSP 1 Score: 421.779 bits (1083), Expect = 2.440e-145
Identity = 199/351 (56.70%), Postives = 267/351 (76.07%), Query Frame = 3
Query:   78 REVVCINVGQAGIQMANASWELFCIEHGIECNG--KLKYDAQDFTS---FHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            +E++CIN+GQAG+QM+NA WELFCIEHG++  G  + K++ +D  S      FF E   G YVPRAINVDLEPTVIDEIR+  YR LWHP+ LI   EDA+NNFARG YT+GK++ ++   +L K    C  + GFI++NS GGGTGSGL++LI + +S+EF+K  K    IYPAPQLAT+IVEPYN++L  S  ++ +D+V L DNEA Y+IC  KL +S P Y ++NR+++Q+FS++TVSIRFG+SLD+DL  LQTNL+PYPRIHFP  NY+P+       H+ LT S+ITRELF+  NQL++CD+ +GKYM+CC+QYRGL+ PR VN+A+ +IK+R +I FV+WCPTG
Sbjct:    3 KEIICINIGQAGVQMSNACWELFCIEHGLDTGGFPRTKHELKDVDSTSDIAAFFHETNIGRYVPRAINVDLEPTVIDEIRSGVYRTLWHPNCLITSNEDASNNFARGRYTVGKTIAKRLFTQLIKMVRDCHQLHGFILMNSLGGGTGSGLTSLILDKISIEFAKHPKVSSVIYPAPQLATSIVEPYNAVLGTSATIDQSDLVFLCDNEAMYEICHDKLKLSLPQYTHLNRVVSQLFSSLTVSIRFGSSLDHDLSHLQTNLVPYPRIHFPFANYAPLFHQDFNDHDTLTTSQITRELFEETNQLVKCDVTVGKYMACCVQYRGLVVPRTVNVALLEIKKRQDIKFVEWCPTG 353          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000005035.1 (SMESG000005035.1)

HSP 1 Score: 421.009 bits (1081), Expect = 7.527e-145
Identity = 196/352 (55.68%), Postives = 268/352 (76.14%), Query Frame = 3
Query:   75 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLK-----YDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG 1115
            M+E++ ++VGQAGIQ++NA WELFCIEHG++C G  K     Y  + F   +  FQE  +  +VPRAI+VDLEPTVIDEIR   YRNLWHPD L++  EDA+NNFARG Y++GK +I +F+E+L K A  C+S+ GF+++NSYGGGTGSG S+LI   L  EFSK  K    I+P+P++ATA+VEPYNS+L+A   +E+ D+ +L DNEA ++ C+ K+NI +P Y+NINRL++QI S++TV++RFG+SLD+DLV  QTNLIPYP++HFP  N+SPI D  RA H+ +T   IT +LF+PGNQ I C++  GKYM+CC+ YRG + PR++N A+ +IK+R+ I FVDWCPTG
Sbjct:    1 MKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINSYGGGTGSGFSSLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCPTG 352          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C4.142e-14254.00tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA1C4.569e-14254.86tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1B1.058e-14154.57tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:1880... [more]
TUBA3C1.259e-14154.00tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA3D1.259e-14154.00tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:2407... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tba-92.784e-14153.85Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
mec-121.277e-14054.57Tubulin alpha-3 chain Detyrosinated tubulin alpha-... [more]
tba-12.849e-13953.16Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-12.979e-13952.71Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-21.645e-13852.87Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub84B5.180e-14254.29gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub84D1.004e-14053.71gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub85E2.347e-14053.71gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub67C7.705e-12950.69gene:FBgn0087040 transcript:FBtr0076393[more]
CG77946.935e-10345.53gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba8l21.117e-14355.43tubulin, alpha 8 like 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba8l1.728e-14355.14tubulin, alpha 8 like [Source:ZFIN;Acc:ZDB-GENE-03... [more]
tuba4l4.075e-14254.15tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-03... [more]
tuba25.718e-14254.57tubulin, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
si:ch211-114n24.66.038e-14254.57si:ch211-114n24.6 [Source:ZFIN;Acc:ZDB-GENE-120214... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba1c3.442e-14254.86tubulin alpha 1c [Source:NCBI gene;Acc:394675][more]
tuba1b9.594e-14254.57tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b9.594e-14254.57tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b9.594e-14254.57tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b9.594e-14254.57tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tuba1c4.031e-14254.86tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1b7.266e-14254.57tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
Tuba3a8.647e-14254.00tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba3b8.647e-14254.00tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1a1.592e-14154.57tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WQ47|TBA_LEPDS2.114e-14355.14Tubulin alpha chain OS=Lepidoglyphus destructor OX... [more]
sp|Q91060|TBA_NOTVI1.222e-14254.86Tubulin alpha chain OS=Notophthalmus viridescens O... [more]
sp|P41383|TBA2_PATVU9.598e-14254.57Tubulin alpha-2/alpha-4 chain OS=Patella vulgata O... [more]
sp|P18258|TBA1_PARLI1.036e-14154.86Tubulin alpha-1 chain OS=Paracentrotus lividus OX=... [more]
sp|Q52PV9|TBA_TYRPU1.636e-14154.29Tubulin alpha chain OS=Tyrophagus putrescentiae OX... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7M6D90.000e+079.43Tubulin alpha chain OS=Dugesia ryukyuensis OX=7973... [more]
W4ZJ548.256e-14955.14Tubulin alpha chain OS=Strongylocentrotus purpurat... [more]
Q7Z1L85.328e-14758.17Tubulin alpha chain OS=Schmidtea polychroa OX=5005... [more]
A0A158QAW22.007e-14356.13Tubulin alpha chain OS=Enterobius vermicularis OX=... [more]
A0A131XCY74.408e-14356.70Tubulin alpha chain (Fragment) OS=Hyalomma excavat... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba8l28.129e-14455.43tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000025205.24.897e-14253.87tubulin alpha-8 chain-like [Source:NCBI gene;Acc:1... [more]
si:ch211-114n24.65.832e-14254.57tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000019222.26.498e-14254.86tubulin alpha-1 chain [Source:NCBI gene;Acc:103031... [more]
tuba1a6.647e-14254.57tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C2.902e-14354.00tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.11.242e-11347.46pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubb27.031e-7234.86tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
tubg15.092e-5230.97tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
ENSPMAT00000005307.13.602e-4453.66pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 ... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB31.141e-13253.28Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB19.203e-12751.57Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB21.567e-8236.99Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB49.234e-4026.76Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448042.922e-14254.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417665.149e-14254.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448036.473e-14254.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380677.455e-14254.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407808.590e-14254.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034557.11.846e-14254.57tubulin alpha chain [Source:NCBI gene;Acc:10116881... [more]
ENSORLT00000020468.22.929e-14253.71tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000017746.25.438e-14254.29tubulin alpha-1C chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000028969.11.101e-14154.29tubulin alpha-1C chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000033163.11.298e-14154.29tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057127.10.000e+0100.00SMESG000057127.1[more]
SMESG000043298.10.000e+070.20SMESG000043298.1[more]
SMESG000009421.12.950e-14655.87SMESG000009421.1[more]
SMESG000071756.12.440e-14556.70SMESG000071756.1[more]
SMESG000005035.17.527e-14555.68SMESG000005035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005548 ID=SMED30005548|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=1115bp
TATTATTCGAATATAAATTATAATTGATTATTAATAACAACTTTACCATA
TTTAGCAGAGGATAATTAATCAAAATGCGCGAAGTTGTCTGCATAAATGT
AGGCCAAGCGGGAATTCAAATGGCCAATGCATCTTGGGAACTTTTTTGCA
TTGAACATGGCATTGAGTGCAATGGGAAATTAAAGTACGATGCTCAAGAT
TTTACAAGTTTCCATACTTTTTTCCAAGAAGTACCTTCGGGAAACTATGT
TCCTCGGGCAATTAACGTGGATCTGGAACCGACTGTAATTGACGAAATTA
GAACTGCTTCCTATCGGAATCTTTGGCATCCGGATTACTTAATAAATTGC
TGTGAGGATGCTGCCAATAATTTTGCAAGAGGCCATTATACAATTGGTAA
AAGTGTGATTGAAAAATTCATGGAAAGACTACGGAAATGTGCCATGGCCT
GTGACTCAGTTCAGGGATTCATAGTATTAAATAGTTACGGTGGTGGAACT
GGCTCAGGTTTATCTGCTTTGATATTTGAGAATTTGTCTGTAGAATTTTC
TAAAACCGCCAAATTTCAACAAGCAATATATCCGGCTCCTCAGTTAGCCA
CAGCAATCGTTGAGCCTTACAATTCCTTGTTGACTGCTTCTAAATGCATG
GAAAATACGGATGTTGTGATGCTTATCGACAATGAGGCTACTTATGATAT
TTGTTTTAAAAAACTCAACATTTCAAGACCTGGCTATAATAATATAAACC
GTCTAATAGCTCAAATATTCAGCGCAATGACCGTTTCTATTCGATTTGGG
GCATCTTTAGACAATGATTTAGTTCAACTACAAACTAATTTAATACCGTA
TCCTCGAATTCATTTCCCAACTGTTAATTATTCTCCTATAATAGATTCTC
ATAGAGCGGCCCATGAAGGTTTGACCATTTCCGAGATAACCAGAGAATTG
TTTGATCCAGGTAATCAACTGATAAGATGTGACTTAAGACTTGGCAAATA
CATGTCCTGTTGCATACAGTACAGAGGATTAATCACCCCCCGTCAGGTTA
ACATTGCGGTTTATGATATCAAAAGGCGGACTGAGATAAACTTTGTTGAT
TGGTGTCCAACTGGA
back to top

protein sequence of SMED30005548-orf-1

>SMED30005548-orf-1 ID=SMED30005548-orf-1|Name=SMED30005548-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=347bp
MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLKYDAQDFTSFHTFF
QEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNF
ARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALI
FENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVML
IDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLV
QLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLI
RCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCPTG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR037103Tubulin/FtsZ_C_sf
IPR000217Tubulin
IPR002452Alpha_tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR017975Tubulin_CS
IPR008280Tub_FtsZ_C
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000217TubulinPRINTSPR01161TUBULINcoord: 50..69
score: 57.59
coord: 92..103
score: 54.52
coord: 175..188
score: 51.98
coord: 105..129
score: 34.53
coord: 150..171
score: 22.94
coord: 131..149
score: 60.12
coord: 10..30
score: 56.45
coord: 189..209
score: 49.44
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 2..347
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 145..157
score: 50.81
coord: 158..169
score: 30.25
coord: 18..33
score: 62.29
coord: 211..223
score: 45.38
coord: 271..286
score: 39.34
coord: 344..347
score: 27.97
coord: 318..339
score: 37.01
coord: 85..98
score: 62.79
coord: 42..55
score: 39.5
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 46..243
e-value: 2.5E-40
score: 150.0
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 3..210
e-value: 6.9E-55
score: 186.3
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..265
e-value: 3.7E-100
score: 336.8
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 1..241
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 266..347
e-value: 5.3E-28
score: 99.2
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 260..347
e-value: 2.1E-27
score: 95.8
NoneNo IPR availablePANTHERPTHR11588:SF274TUBULIN ALPHA CHAINcoord: 2..347
NoneNo IPR availableCDDcd02186alpha_tubulincoord: 2..347
e-value: 0.0
score: 575.256
IPR017975Tubulin, conserved sitePROSITEPS00227TUBULINcoord: 139..145
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 244..347