Coronin-1B

Overview
NameCoronin-1B
Smed IDSMED30005546
Length (bp)1707
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coronin-1B (SMED30005546) t-SNE clustered cells

Violin plots show distribution of expression levels for Coronin-1B (SMED30005546) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coronin-1B (SMED30005546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coronin-1B (SMED30005546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v4_448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v4_448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v4_448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v4_448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v4_448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005546SMESG000026646.1 Contig38151uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005546SMESG000026646.1 Contig38151newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005546SMESG000026646.1 Contig44403uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005546SMESG000026646.1 Contig44403newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v6_448_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v6_448_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v6_448_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v6_448_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005546SMESG000037126.1 SMESG000026646.1 dd_Smed_v4_448_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coronin-1B vs. Ensembl Human
Match: CORO1C (coronin 1C [Source:HGNC Symbol;Acc:HGNC:2254])

HSP 1 Score: 480.33 bits (1235), Expect = 2.528e-165
Identity = 227/409 (55.50%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS+FC+VNP+++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L   ++LTEP+  L GH +RVG+V WHPTA N+LLS+G DN +++WN+ T E L+ +     DMI + ++N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR +KLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N  PIL+S+K G+   K R  K VK  I
Sbjct:    4 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLT--LSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNI 409          
BLAST of Coronin-1B vs. Ensembl Human
Match: CORO1C (coronin 1C [Source:HGNC Symbol;Acc:HGNC:2254])

HSP 1 Score: 480.33 bits (1235), Expect = 2.528e-165
Identity = 227/409 (55.50%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS+FC+VNP+++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L   ++LTEP+  L GH +RVG+V WHPTA N+LLS+G DN +++WN+ T E L+ +     DMI + ++N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR +KLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N  PIL+S+K G+   K R  K VK  I
Sbjct:    4 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLT--LSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNI 409          
BLAST of Coronin-1B vs. Ensembl Human
Match: CORO1C (coronin 1C [Source:HGNC Symbol;Acc:HGNC:2254])

HSP 1 Score: 479.559 bits (1233), Expect = 5.703e-165
Identity = 227/409 (55.50%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS+FC+VNP+++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L   ++LTEP+  L GH +RVG+V WHPTA N+LLS+G DN +++WN+ T E L+ +     DMI + ++N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR +KLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N  PIL+S+K G+   K R  K VK  I
Sbjct:   10 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLT--LSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNI 415          
BLAST of Coronin-1B vs. Ensembl Human
Match: CORO1C (coronin 1C [Source:HGNC Symbol;Acc:HGNC:2254])

HSP 1 Score: 479.559 bits (1233), Expect = 2.282e-164
Identity = 227/409 (55.50%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS+FC+VNP+++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L   ++LTEP+  L GH +RVG+V WHPTA N+LLS+G DN +++WN+ T E L+ +     DMI + ++N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR +KLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N  PIL+S+K G+   K R  K VK  I
Sbjct:   57 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLT--LSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNI 462          
BLAST of Coronin-1B vs. Ensembl Human
Match: CORO6 (coronin 6 [Source:HGNC Symbol;Acc:HGNC:21356])

HSP 1 Score: 472.626 bits (1215), Expect = 1.999e-162
Identity = 215/394 (54.57%), Postives = 296/394 (75.13%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF 1198
            + R+SKF+H+FG+A K D+ Y+ IR++K +WDS+FC+VNPK+LAII EA GGGAF+V+P+ K GR + + P V GH A VLDI +CPHND+VIASAS+D T+ VW IP D+   + N+TEPI  L GH +RVG++ WHPTA N+LLS+G DN++++WN+ T EVL+ +    PD+I S  +N +GS L T+CKDK  RI+DPR G++  E  + HEGA+P + V+  D ++ +TGFSRMSERQ ALWD  NF   +  +++DTSNGV+ P+YD D +++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++V++ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDT G  PA+ A+EW  G + +P+L+S++DG+
Sbjct:    5 VVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFIVLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIP-DYTPMR-NITEPIITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHSVCWNSNGSLLATTCKDKTLRIIDPRKGQVVAEQARPHEGARPLRAVFTADGKLLSTGFSRMSERQLALWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGY 395          
BLAST of Coronin-1B vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 415.231 bits (1066), Expect = 4.536e-140
Identity = 191/383 (49.87%), Postives = 267/383 (69.71%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS-FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKP 1171
            + R+SKF+H+F K +K + C   IR+T+ +WDS FC VNPK++A I   AGG  F+VIP+ K+GR + D PFV  HKA  L++ + P ND+VIAS SED T KVW IP+  L    NL+EP   L GHQ+RV  + WHP A N+LL++G +N++ +WN+ T E L+EIS  PD I S  FN+DGS+ VT+CKDK  RI+D  TGE+  EG  HEG KPQ+ +++KD  + +TGF++ SER +AL    + S+ ++ E++DTSNGV+FP+YD D  L+YL GKGD  IRY+E + +   VHYIN   +++PQR +G+  KRG++  +NEI R YKL  K + +++ F VPRKS+L+Q DLYPDT   +PA++AEE+ EG N  P
Sbjct:    4 IVRQSKFRHVFCKPVKHESCMSDIRVTEITWDSLFCDVNPKFIAFINRGAGG-PFMVIPVNKIGRVDKDYPFVDAHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNR--NLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNVGTGEALLEISGHPDQIWSINFNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGVKPQRAIFVKDGLILSTGFTKRSERLYALRAPEDLSTPIVEEELDTSNGVVFPFYDEDSGLVYLVGKGDCAIRYYEVNNDAPYVHYINTYTTNEPQRAVGFQSKRGMSSEENEINRIYKLTTKGVVDILQFFVPRKSDLFQHDLYPDTRSTIPALTAEEFMEGKNAAP 383          
BLAST of Coronin-1B vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 416.772 bits (1070), Expect = 5.411e-140
Identity = 191/383 (49.87%), Postives = 267/383 (69.71%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS-FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKP 1171
            + R+SKF+H+F K +K + C   IR+T+ +WDS FC VNPK++A I   AGG  F+VIP+ K+GR + D PFV  HKA  L++ + P ND+VIAS SED T KVW IP+  L    NL+EP   L GHQ+RV  + WHP A N+LL++G +N++ +WN+ T E L+EIS  PD I S  FN+DGS+ VT+CKDK  RI+D  TGE+  EG  HEG KPQ+ +++KD  + +TGF++ SER +AL    + S+ ++ E++DTSNGV+FP+YD D  L+YL GKGD  IRY+E + +   VHYIN   +++PQR +G+  KRG++  +NEI R YKL  K + +++ F VPRKS+L+Q DLYPDT   +PA++AEE+ EG N  P
Sbjct:    4 IVRQSKFRHVFCKPVKHESCMSDIRVTEITWDSLFCDVNPKFIAFINRGAGG-PFMVIPVNKIGRVDKDYPFVDAHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNR--NLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNVGTGEALLEISGHPDQIWSINFNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGVKPQRAIFVKDGLILSTGFTKRSERLYALRAPEDLSTPIVEEELDTSNGVVFPFYDEDSGLVYLVGKGDCAIRYYEVNNDAPYVHYINTYTTNEPQRAVGFQSKRGMSSEENEINRIYKLTTKGVVDILQFFVPRKSDLFQHDLYPDTRSTIPALTAEEFMEGKNAAP 383          
BLAST of Coronin-1B vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 417.927 bits (1073), Expect = 1.388e-139
Identity = 191/383 (49.87%), Postives = 267/383 (69.71%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS-FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKP 1171
            + R+SKF+H+F K +K + C   IR+T+ +WDS FC VNPK++A I   AGG  F+VIP+ K+GR + D PFV  HKA  L++ + P ND+VIAS SED T KVW IP+  L    NL+EP   L GHQ+RV  + WHP A N+LL++G +N++ +WN+ T E L+EIS  PD I S  FN+DGS+ VT+CKDK  RI+D  TGE+  EG  HEG KPQ+ +++KD  + +TGF++ SER +AL    + S+ ++ E++DTSNGV+FP+YD D  L+YL GKGD  IRY+E + +   VHYIN   +++PQR +G+  KRG++  +NEI R YKL  K + +++ F VPRKS+L+Q DLYPDT   +PA++AEE+ EG N  P
Sbjct:    4 IVRQSKFRHVFCKPVKHESCMSDIRVTEITWDSLFCDVNPKFIAFINRGAGG-PFMVIPVNKIGRVDKDYPFVDAHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNR--NLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNVGTGEALLEISGHPDQIWSINFNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGVKPQRAIFVKDGLILSTGFTKRSERLYALRAPEDLSTPIVEEELDTSNGVVFPFYDEDSGLVYLVGKGDCAIRYYEVNNDAPYVHYINTYTTNEPQRAVGFQSKRGMSSEENEINRIYKLTTKGVVDILQFFVPRKSDLFQHDLYPDTRSTIPALTAEEFMEGKNAAP 383          
BLAST of Coronin-1B vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 417.927 bits (1073), Expect = 1.388e-139
Identity = 191/383 (49.87%), Postives = 267/383 (69.71%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS-FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKP 1171
            + R+SKF+H+F K +K + C   IR+T+ +WDS FC VNPK++A I   AGG  F+VIP+ K+GR + D PFV  HKA  L++ + P ND+VIAS SED T KVW IP+  L    NL+EP   L GHQ+RV  + WHP A N+LL++G +N++ +WN+ T E L+EIS  PD I S  FN+DGS+ VT+CKDK  RI+D  TGE+  EG  HEG KPQ+ +++KD  + +TGF++ SER +AL    + S+ ++ E++DTSNGV+FP+YD D  L+YL GKGD  IRY+E + +   VHYIN   +++PQR +G+  KRG++  +NEI R YKL  K + +++ F VPRKS+L+Q DLYPDT   +PA++AEE+ EG N  P
Sbjct:    4 IVRQSKFRHVFCKPVKHESCMSDIRVTEITWDSLFCDVNPKFIAFINRGAGG-PFMVIPVNKIGRVDKDYPFVDAHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNR--NLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNVGTGEALLEISGHPDQIWSINFNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGVKPQRAIFVKDGLILSTGFTKRSERLYALRAPEDLSTPIVEEELDTSNGVVFPFYDEDSGLVYLVGKGDCAIRYYEVNNDAPYVHYINTYTTNEPQRAVGFQSKRGMSSEENEINRIYKLTTKGVVDILQFFVPRKSDLFQHDLYPDTRSTIPALTAEEFMEGKNAAP 383          
BLAST of Coronin-1B vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 417.927 bits (1073), Expect = 1.536e-139
Identity = 191/383 (49.87%), Postives = 267/383 (69.71%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS-FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKP 1171
            + R+SKF+H+F K +K + C   IR+T+ +WDS FC VNPK++A I   AGG  F+VIP+ K+GR + D PFV  HKA  L++ + P ND+VIAS SED T KVW IP+  L    NL+EP   L GHQ+RV  + WHP A N+LL++G +N++ +WN+ T E L+EIS  PD I S  FN+DGS+ VT+CKDK  RI+D  TGE+  EG  HEG KPQ+ +++KD  + +TGF++ SER +AL    + S+ ++ E++DTSNGV+FP+YD D  L+YL GKGD  IRY+E + +   VHYIN   +++PQR +G+  KRG++  +NEI R YKL  K + +++ F VPRKS+L+Q DLYPDT   +PA++AEE+ EG N  P
Sbjct:    4 IVRQSKFRHVFCKPVKHESCMSDIRVTEITWDSLFCDVNPKFIAFINRGAGG-PFMVIPVNKIGRVDKDYPFVDAHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNR--NLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNVGTGEALLEISGHPDQIWSINFNFDGSQFVTTCKDKKIRILDSHTGEVVHEGMGHEGVKPQRAIFVKDGLILSTGFTKRSERLYALRAPEDLSTPIVEEELDTSNGVVFPFYDEDSGLVYLVGKGDCAIRYYEVNNDAPYVHYINTYTTNEPQRAVGFQSKRGMSSEENEINRIYKLTTKGVVDILQFFVPRKSDLFQHDLYPDTRSTIPALTAEEFMEGKNAAP 383          
BLAST of Coronin-1B vs. Ensembl Fly
Match: coro (gene:FBgn0265935 transcript:FBtr0086209)

HSP 1 Score: 510.375 bits (1313), Expect = 1.113e-176
Identity = 236/406 (58.13%), Postives = 308/406 (75.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRK-PVKAA 1237
            + R SKF+H++G+ALKR++CYD IR++KSSWDSTFC+VNPK+LAII E+AGGGAF+V+P  KVGR  AD P V GHK  VLDI +CPHND+VIAS SEDC VKVW IP+  L     LTEP+ +LV HQRRVGLVLWHP+A N+LL++G+DN V++WN+ T E+LV I S PD++ SA FN+DGSKLVT+CKDK  RI DPRT E+++E  CHEG+K  + ++L+   +FTTGF+R SERQ++L      +  ++  ++DTSNGVMFP YDAD N+IYL GKGDSVIRYFE +PE   VHYIN   +++PQRGIG MPKRG +V   E+A+ Y+++N  LC+VI  TVPRKS+L+Q+DLYPDT  +  AI+AEEW +G +  PI  S+K G+ +    +  P K A
Sbjct:    5 VVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSR--TLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKGGYVSSSVNKSLPAKKA 408          
BLAST of Coronin-1B vs. Ensembl Fly
Match: coro (gene:FBgn0265935 transcript:FBtr0086208)

HSP 1 Score: 510.375 bits (1313), Expect = 1.113e-176
Identity = 236/406 (58.13%), Postives = 308/406 (75.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRK-PVKAA 1237
            + R SKF+H++G+ALKR++CYD IR++KSSWDSTFC+VNPK+LAII E+AGGGAF+V+P  KVGR  AD P V GHK  VLDI +CPHND+VIAS SEDC VKVW IP+  L     LTEP+ +LV HQRRVGLVLWHP+A N+LL++G+DN V++WN+ T E+LV I S PD++ SA FN+DGSKLVT+CKDK  RI DPRT E+++E  CHEG+K  + ++L+   +FTTGF+R SERQ++L      +  ++  ++DTSNGVMFP YDAD N+IYL GKGDSVIRYFE +PE   VHYIN   +++PQRGIG MPKRG +V   E+A+ Y+++N  LC+VI  TVPRKS+L+Q+DLYPDT  +  AI+AEEW +G +  PI  S+K G+ +    +  P K A
Sbjct:    5 VVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSR--TLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKGGYVSSSVNKSLPAKKA 408          
BLAST of Coronin-1B vs. Ensembl Fly
Match: coro (gene:FBgn0265935 transcript:FBtr0086207)

HSP 1 Score: 510.375 bits (1313), Expect = 1.113e-176
Identity = 236/406 (58.13%), Postives = 308/406 (75.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRK-PVKAA 1237
            + R SKF+H++G+ALKR++CYD IR++KSSWDSTFC+VNPK+LAII E+AGGGAF+V+P  KVGR  AD P V GHK  VLDI +CPHND+VIAS SEDC VKVW IP+  L     LTEP+ +LV HQRRVGLVLWHP+A N+LL++G+DN V++WN+ T E+LV I S PD++ SA FN+DGSKLVT+CKDK  RI DPRT E+++E  CHEG+K  + ++L+   +FTTGF+R SERQ++L      +  ++  ++DTSNGVMFP YDAD N+IYL GKGDSVIRYFE +PE   VHYIN   +++PQRGIG MPKRG +V   E+A+ Y+++N  LC+VI  TVPRKS+L+Q+DLYPDT  +  AI+AEEW +G +  PI  S+K G+ +    +  P K A
Sbjct:    5 VVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSR--TLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKGGYVSSSVNKSLPAKKA 408          
BLAST of Coronin-1B vs. Ensembl Fly
Match: coro (gene:FBgn0265935 transcript:FBtr0336656)

HSP 1 Score: 508.449 bits (1308), Expect = 7.287e-176
Identity = 233/390 (59.74%), Postives = 302/390 (77.44%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKD 1192
            + R SKF+H++G+ALKR++CYD IR++KSSWDSTFC+VNPK+LAII E+AGGGAF+V+P  KVGR  AD P V GHK  VLDI +CPHND+VIAS SEDC VKVW IP+  L     LTEP+ +LV HQRRVGLVLWHP+A N+LL++G+DN V++WN+ T E+LV I S PD++ SA FN+DGSKLVT+CKDK  RI DPRT E+++E  CHEG+K  + ++L+   +FTTGF+R SERQ++L      +  ++  ++DTSNGVMFP YDAD N+IYL GKGDSVIRYFE +PE   VHYIN   +++PQRGIG MPKRG +V   E+A+ Y+++N  LC+VI  TVPRKS+L+Q+DLYPDT  +  AI+AEEW +G +  PI  S+KD
Sbjct:    5 VVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSR--TLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKD 392          
BLAST of Coronin-1B vs. Ensembl Fly
Match: coro (gene:FBgn0265935 transcript:FBtr0336655)

HSP 1 Score: 508.449 bits (1308), Expect = 7.287e-176
Identity = 233/390 (59.74%), Postives = 302/390 (77.44%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKD 1192
            + R SKF+H++G+ALKR++CYD IR++KSSWDSTFC+VNPK+LAII E+AGGGAF+V+P  KVGR  AD P V GHK  VLDI +CPHND+VIAS SEDC VKVW IP+  L     LTEP+ +LV HQRRVGLVLWHP+A N+LL++G+DN V++WN+ T E+LV I S PD++ SA FN+DGSKLVT+CKDK  RI DPRT E+++E  CHEG+K  + ++L+   +FTTGF+R SERQ++L      +  ++  ++DTSNGVMFP YDAD N+IYL GKGDSVIRYFE +PE   VHYIN   +++PQRGIG MPKRG +V   E+A+ Y+++N  LC+VI  TVPRKS+L+Q+DLYPDT  +  AI+AEEW +G +  PI  S+KD
Sbjct:    5 VVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSR--TLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKD 392          
BLAST of Coronin-1B vs. Ensembl Zebrafish
Match: coro1cb (coronin, actin binding protein, 1Cb [Source:ZFIN;Acc:ZDB-GENE-030131-418])

HSP 1 Score: 490.345 bits (1261), Expect = 1.602e-169
Identity = 231/418 (55.26%), Postives = 303/418 (72.49%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAIKSKLADQKT 1267
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L     L+EP+  L GH +RVG+V WHPTA N+LLS+G DNL+++WN+ T E L+ +    PD+I S  ++ +GS + T+CKDK  R++DPR G+I  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG  P + AEEWFEG N +PIL+S+K G+   K R  K VK  +    A +K 
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLQKTGRIDKAYPTVCGHTGPVLDIDWCPHNDHVIASGSEDCTVMVWQIPENGLTSA--LSEPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNLIIIWNVGTGEALINLEDMHPDVIFSVCWSRNGSLICTACKDKKVRVIDPRKGKITAEKDKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMEEPISVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDPVLEAEEWFEGKNGEPILISLKHGYVPGKNRDLKVVKKNVLDNKATKKV 419          
BLAST of Coronin-1B vs. Ensembl Zebrafish
Match: coro1cb (coronin, actin binding protein, 1Cb [Source:ZFIN;Acc:ZDB-GENE-030131-418])

HSP 1 Score: 490.345 bits (1261), Expect = 1.602e-169
Identity = 231/418 (55.26%), Postives = 303/418 (72.49%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAIKSKLADQKT 1267
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L     L+EP+  L GH +RVG+V WHPTA N+LLS+G DNL+++WN+ T E L+ +    PD+I S  ++ +GS + T+CKDK  R++DPR G+I  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG  P + AEEWFEG N +PIL+S+K G+   K R  K VK  +    A +K 
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLQKTGRIDKAYPTVCGHTGPVLDIDWCPHNDHVIASGSEDCTVMVWQIPENGLTSA--LSEPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNLIIIWNVGTGEALINLEDMHPDVIFSVCWSRNGSLICTACKDKKVRVIDPRKGKITAEKDKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMEEPISVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDPVLEAEEWFEGKNGEPILISLKHGYVPGKNRDLKVVKKNVLDNKATKKV 419          
BLAST of Coronin-1B vs. Ensembl Zebrafish
Match: coro1cb (coronin, actin binding protein, 1Cb [Source:ZFIN;Acc:ZDB-GENE-030131-418])

HSP 1 Score: 490.345 bits (1261), Expect = 1.602e-169
Identity = 231/418 (55.26%), Postives = 303/418 (72.49%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAIKSKLADQKT 1267
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L     L+EP+  L GH +RVG+V WHPTA N+LLS+G DNL+++WN+ T E L+ +    PD+I S  ++ +GS + T+CKDK  R++DPR G+I  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG  P + AEEWFEG N +PIL+S+K G+   K R  K VK  +    A +K 
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLQKTGRIDKAYPTVCGHTGPVLDIDWCPHNDHVIASGSEDCTVMVWQIPENGLTSA--LSEPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNLIIIWNVGTGEALINLEDMHPDVIFSVCWSRNGSLICTACKDKKVRVIDPRKGKITAEKDKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMEEPISVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDPVLEAEEWFEGKNGEPILISLKHGYVPGKNRDLKVVKKNVLDNKATKKV 419          
BLAST of Coronin-1B vs. Ensembl Zebrafish
Match: coro1ca (coronin, actin binding protein, 1Ca [Source:NCBI gene;Acc:317741])

HSP 1 Score: 478.789 bits (1231), Expect = 4.721e-165
Identity = 224/409 (54.77%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++A+I EA+GGGAF+V+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L    +++EP+  L GH +RVG+V WHPTA N+LLS+G DN++++WN+ T E ++ +    PD+I S  +N +GS + T+CKDK  R++DPR  EI  E  K HEGA+P + ++L D +VFTTGFSRMSERQ ALWD  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   + +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG    + AEEWFEG N  P+L+S+K G+   K R  K VK  I
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVALIVEASGGGAFMVLPLHKTGRIDKAYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLV--TSMSEPVVVLEGHSKRVGVVTWHPTARNVLLSAGCDNMIIIWNVGTGESMITLEDHHPDIIYSICWNRNGSLICTACKDKKIRVIDPRKEEIIAEKDKAHEGARPMRAIFLSDGKVFTTGFSRMSERQLALWDPENIDEPVAVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPFVHYLNTFTTKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDAPLEAEEWFEGKNGDPVLISLKHGYIPGKNRDLKVVKKNI 410          
BLAST of Coronin-1B vs. Ensembl Zebrafish
Match: coro1ca (coronin, actin binding protein, 1Ca [Source:NCBI gene;Acc:317741])

HSP 1 Score: 478.789 bits (1231), Expect = 4.721e-165
Identity = 224/409 (54.77%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++A+I EA+GGGAF+V+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L    +++EP+  L GH +RVG+V WHPTA N+LLS+G DN++++WN+ T E ++ +    PD+I S  +N +GS + T+CKDK  R++DPR  EI  E  K HEGA+P + ++L D +VFTTGFSRMSERQ ALWD  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   + +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG    + AEEWFEG N  P+L+S+K G+   K R  K VK  I
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVALIVEASGGGAFMVLPLHKTGRIDKAYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLV--TSMSEPVVVLEGHSKRVGVVTWHPTARNVLLSAGCDNMIIIWNVGTGESMITLEDHHPDIIYSICWNRNGSLICTACKDKKIRVIDPRKEEIIAEKDKAHEGARPMRAIFLSDGKVFTTGFSRMSERQLALWDPENIDEPVAVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPFVHYLNTFTTKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDAPLEAEEWFEGKNGDPVLISLKHGYIPGKNRDLKVVKKNI 410          
BLAST of Coronin-1B vs. Ensembl Xenopus
Match: coro1c (coronin 1C [Source:NCBI gene;Acc:395017])

HSP 1 Score: 475.322 bits (1222), Expect = 2.376e-163
Identity = 230/418 (55.02%), Postives = 301/418 (72.01%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVL--VEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI-KSKLADQK 1264
            + R+SKF+H+FG+ALK D+CYD IR+++ +WDS+FC+VNP ++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND+VIAS SEDCTV VW IPE+ L   I LT+P+  L GH +RVG+V WHPTA N+LLS+G DN + +WN+ T E +  +E    DMI SA +N +GS + T+ KDK  R++DPR  E+ +E  K HEGA+P + ++L D  +FTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG    I AE+WF+G N  P+L+S+K G+  TK R    VK  I  SK A  K
Sbjct:    4 VVRQSKFRHVFGQALKNDQCYDDIRVSRVTWDSSFCAVNPNFVAIIIEASGGGAFLVLPLQKSGRIDKSYPTVCGHTGPVLDIDWCPHNDNVIASGSEDCTVMVWQIPENGLT--IPLTDPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNAIFIWNVGTGEAMFNLEDMHNDMIYSACWNRNGSLICTASKDKKLRVIDPRKMEVVSEKDKAHEGARPMRAIFLADGNIFTTGFSRMSERQLALWNPKNMEEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAPIEAEDWFDGKNADPVLISLKQGYVPTKGRDLNVVKKNILGSKPAAHK 418          
BLAST of Coronin-1B vs. Ensembl Xenopus
Match: coro1c (coronin 1C [Source:NCBI gene;Acc:395017])

HSP 1 Score: 474.937 bits (1221), Expect = 2.427e-163
Identity = 230/418 (55.02%), Postives = 301/418 (72.01%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVL--VEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI-KSKLADQK 1264
            + R+SKF+H+FG+ALK D+CYD IR+++ +WDS+FC+VNP ++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND+VIAS SEDCTV VW IPE+ L   I LT+P+  L GH +RVG+V WHPTA N+LLS+G DN + +WN+ T E +  +E    DMI SA +N +GS + T+ KDK  R++DPR  E+ +E  K HEGA+P + ++L D  +FTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG    I AE+WF+G N  P+L+S+K G+  TK R    VK  I  SK A  K
Sbjct:    4 VVRQSKFRHVFGQALKNDQCYDDIRVSRVTWDSSFCAVNPNFVAIIIEASGGGAFLVLPLQKSGRIDKSYPTVCGHTGPVLDIDWCPHNDNVIASGSEDCTVMVWQIPENGLT--IPLTDPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNAIFIWNVGTGEAMFNLEDMHNDMIYSACWNRNGSLICTASKDKKLRVIDPRKMEVVSEKDKAHEGARPMRAIFLADGNIFTTGFSRMSERQLALWNPKNMEEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAPIEAEDWFDGKNADPVLISLKQGYVPTKGRDLNVVKKNILGSKPAAHK 418          
BLAST of Coronin-1B vs. Ensembl Xenopus
Match: coro1c (coronin 1C [Source:NCBI gene;Acc:395017])

HSP 1 Score: 474.937 bits (1221), Expect = 2.644e-163
Identity = 234/425 (55.06%), Postives = 305/425 (71.76%), Query Frame = 2
Query:    8 LI*KMA-LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVL--VEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI-KSKLADQK 1264
            LI KM  + R+SKF+H+FG+ALK D+CYD IR+++ +WDS+FC+VNP ++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND+VIAS SEDCTV VW IPE+ L   I LT+P+  L GH +RVG+V WHPTA N+LLS+G DN + +WN+ T E +  +E    DMI SA +N +GS + T+ KDK  R++DPR  E+ +E  K HEGA+P + ++L D  +FTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG    I AE+WF+G N  P+L+S+K G+  TK R    VK  I  SK A  K
Sbjct:   22 LIDKMRRVVRQSKFRHVFGQALKNDQCYDDIRVSRVTWDSSFCAVNPNFVAIIIEASGGGAFLVLPLQKSGRIDKSYPTVCGHTGPVLDIDWCPHNDNVIASGSEDCTVMVWQIPENGLT--IPLTDPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNAIFIWNVGTGEAMFNLEDMHNDMIYSACWNRNGSLICTASKDKKLRVIDPRKMEVVSEKDKAHEGARPMRAIFLADGNIFTTGFSRMSERQLALWNPKNMEEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAPIEAEDWFDGKNADPVLISLKQGYVPTKGRDLNVVKKNILGSKPAAHK 443          
BLAST of Coronin-1B vs. Ensembl Xenopus
Match: coro1c (coronin 1C [Source:NCBI gene;Acc:395017])

HSP 1 Score: 473.396 bits (1217), Expect = 3.476e-163
Identity = 230/418 (55.02%), Postives = 301/418 (72.01%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVL--VEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI-KSKLADQK 1264
            + R+SKF+H+FG+ALK D+CYD IR+++ +WDS+FC+VNP ++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND+VIAS SEDCTV VW IPE+ L   I LT+P+  L GH +RVG+V WHPTA N+LLS+G DN + +WN+ T E +  +E    DMI SA +N +GS + T+ KDK  R++DPR  E+ +E  K HEGA+P + ++L D  +FTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG    I AE+WF+G N  P+L+S+K G+  TK R    VK  I  SK A  K
Sbjct:    3 VVRQSKFRHVFGQALKNDQCYDDIRVSRVTWDSSFCAVNPNFVAIIIEASGGGAFLVLPLQKSGRIDKSYPTVCGHTGPVLDIDWCPHNDNVIASGSEDCTVMVWQIPENGLT--IPLTDPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNAIFIWNVGTGEAMFNLEDMHNDMIYSACWNRNGSLICTASKDKKLRVIDPRKMEVVSEKDKAHEGARPMRAIFLADGNIFTTGFSRMSERQLALWNPKNMEEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAPIEAEDWFDGKNADPVLISLKQGYVPTKGRDLNVVKKNILGSKPAAHK 417          
BLAST of Coronin-1B vs. Ensembl Xenopus
Match: coro1c (coronin 1C [Source:NCBI gene;Acc:395017])

HSP 1 Score: 473.011 bits (1216), Expect = 6.877e-163
Identity = 230/418 (55.02%), Postives = 301/418 (72.01%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVL--VEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI-KSKLADQK 1264
            + R+SKF+H+FG+ALK D+CYD IR+++ +WDS+FC+VNP ++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND+VIAS SEDCTV VW IPE+ L   I LT+P+  L GH +RVG+V WHPTA N+LLS+G DN + +WN+ T E +  +E    DMI SA +N +GS + T+ KDK  R++DPR  E+ +E  K HEGA+P + ++L D  +FTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG    I AE+WF+G N  P+L+S+K G+  TK R    VK  I  SK A  K
Sbjct:    4 VVRQSKFRHVFGQALKNDQCYDDIRVSRVTWDSSFCAVNPNFVAIIIEASGGGAFLVLPLQKSGRIDKSYPTVCGHTGPVLDIDWCPHNDNVIASGSEDCTVMVWQIPENGLT--IPLTDPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNAIFIWNVGTGEAMFNLEDMHNDMIYSACWNRNGSLICTASKDKKLRVIDPRKMEVVSEKDKAHEGARPMRAIFLADGNIFTTGFSRMSERQLALWNPKNMEEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAPIEAEDWFDGKNADPVLISLKQGYVPTKGRDLNVVKKNILGSKPAAHK 418          
BLAST of Coronin-1B vs. Ensembl Mouse
Match: Coro1c (coronin, actin binding protein 1C [Source:MGI Symbol;Acc:MGI:1345964])

HSP 1 Score: 478.404 bits (1230), Expect = 9.166e-165
Identity = 226/409 (55.26%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS+FC+VNP+++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L   ++LTEP+  L GH +RVG+V WHPTA N+LLS+G DN +++WN+ T E L+ +     DMI + +++ +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR +KLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N  PIL+S+K G+   K R  K VK  I
Sbjct:    4 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLT--LSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWSRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNI 409          
BLAST of Coronin-1B vs. Ensembl Mouse
Match: Coro6 (coronin 6 [Source:MGI Symbol;Acc:MGI:2183448])

HSP 1 Score: 467.618 bits (1202), Expect = 1.085e-160
Identity = 213/394 (54.06%), Postives = 293/394 (74.37%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF 1198
            + R+SKF+H+FG+A K D+ Y+ IR++K +WDS FC+VNPK+LAII EA GGGAF+V+P+ K GR + + P V GH   VLDI +CPHND+VIASAS+D TV VW IP D+   + N+TEP+  L GH +RVG++ WHPTA N+LLS+G DN++++WN+ T EVL+ +    PD+I S  +N +GS L T+CKDK  RI+DPR  ++  E  + HEGA+P + V+  D ++ +TGFSRMSERQ ALWD  NF   +  +++DTSNGV+ P+YD D +++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++V++ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDT G  PA+ A+EW  G + +P+L+S+K+G+
Sbjct:    5 VVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSAFCAVNPKFLAIIVEAGGGGAFIVLPLAKTGRVDKNYPLVTGHTGPVLDIDWCPHNDNVIASASDDTTVMVWQIP-DYTPVR-NITEPVITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDIHPDVIHSVCWNSNGSLLATTCKDKTLRIIDPRKSQVVAERARPHEGARPLRAVFTADGKLLSTGFSRMSERQLALWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITEEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLKEGY 395          
BLAST of Coronin-1B vs. Ensembl Mouse
Match: Coro1b (coronin, actin binding protein 1B [Source:MGI Symbol;Acc:MGI:1345963])

HSP 1 Score: 468.003 bits (1203), Expect = 1.596e-160
Identity = 230/515 (44.66%), Postives = 331/515 (64.27%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAIKSKLADQKTXXXXXXXXXXXXXXXXXXXXXXQPRASFKRASEESNGEVXXXXXXXXXXXXXXXXXVLDRRMLEEMRQEIHHLNKMVLDLQDRVEQLEDERSEHCNG 1558
            + R+SKF+H+FG+ +K D+CY+ IR+++ +WDSTFC+VNPK+LA+I EA+GGGAF+V+P+ K GR +   P V GH   VLDI +CPHND+VIAS SEDCTV VW IPE+ L     LTEP+  L GH +RVG++ WHPTA N+LLS+G DN+V++WN+ T E L  +    PD+I + ++N++GS   ++CKDK  RI+DPR G +  E  K HEGA+P + ++L D +VFTTGFSRMSERQ ALWD  N    +  +++D+SNG + P+YD D +++Y+ GKGDS IRYFE + E   +H++N   S +PQRG+G MPKRG+ V++ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AE+W  G +  PIL+S+++ +  +K+R    +K + ++ L+D +                          AS+ R+   +   V    +                  LEE+ QE+  L  +V +  +R+ +LE++     NG
Sbjct:    6 VVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFMVLPLNKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSP--LTEPVVVLEGHTKRVGIITWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITDEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERK-CEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEDWVSGQDANPILISLREAYVPSKQRD---LKVSRRNVLSDSRP-------------------------ASYSRSGASTATAVTDVPSGNLAGAGEAGK-------LEEVMQELRALRMLVKEQGERISRLEEQLGRMENG 482          
BLAST of Coronin-1B vs. Ensembl Mouse
Match: Coro1b (coronin, actin binding protein 1B [Source:MGI Symbol;Acc:MGI:1345963])

HSP 1 Score: 468.003 bits (1203), Expect = 1.596e-160
Identity = 230/515 (44.66%), Postives = 331/515 (64.27%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAIKSKLADQKTXXXXXXXXXXXXXXXXXXXXXXQPRASFKRASEESNGEVXXXXXXXXXXXXXXXXXVLDRRMLEEMRQEIHHLNKMVLDLQDRVEQLEDERSEHCNG 1558
            + R+SKF+H+FG+ +K D+CY+ IR+++ +WDSTFC+VNPK+LA+I EA+GGGAF+V+P+ K GR +   P V GH   VLDI +CPHND+VIAS SEDCTV VW IPE+ L     LTEP+  L GH +RVG++ WHPTA N+LLS+G DN+V++WN+ T E L  +    PD+I + ++N++GS   ++CKDK  RI+DPR G +  E  K HEGA+P + ++L D +VFTTGFSRMSERQ ALWD  N    +  +++D+SNG + P+YD D +++Y+ GKGDS IRYFE + E   +H++N   S +PQRG+G MPKRG+ V++ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AE+W  G +  PIL+S+++ +  +K+R    +K + ++ L+D +                          AS+ R+   +   V    +                  LEE+ QE+  L  +V +  +R+ +LE++     NG
Sbjct:    6 VVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFMVLPLNKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSP--LTEPVVVLEGHTKRVGIITWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITDEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERK-CEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEDWVSGQDANPILISLREAYVPSKQRD---LKVSRRNVLSDSRP-------------------------ASYSRSGASTATAVTDVPSGNLAGAGEAGK-------LEEVMQELRALRMLVKEQGERISRLEEQLGRMENG 482          
BLAST of Coronin-1B vs. Ensembl Mouse
Match: Coro6 (coronin 6 [Source:MGI Symbol;Acc:MGI:2183448])

HSP 1 Score: 460.299 bits (1183), Expect = 1.022e-157
Identity = 209/394 (53.05%), Postives = 290/394 (73.60%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF 1198
            + R+SKF+H+FG+A K D+ Y+ IR++K +WDS FC+VNPK+LAII EA GGGAF+V+P+ K GR + + P V GH   VLDI +CPHND+VIASAS+D TV VW IP D+   + N+TEP+  L GH +RVG++ WHPTA N+LLS+G DN++++WN+ T EVL+ +    PD+I S  +N +GS L T+CKDK  RI+DPR  ++  E    HEG +P + V+ +   +FTTGF+RMS+R+  LWD  NF   +  +++DTSNGV+ P+YD D +++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++V++ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDT G  PA+ A+EW  G + +P+L+S+K+G+
Sbjct:    5 VVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSAFCAVNPKFLAIIVEAGGGGAFIVLPLAKTGRVDKNYPLVTGHTGPVLDIDWCPHNDNVIASASDDTTVMVWQIP-DYTPVR-NITEPVITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDIHPDVIHSVCWNSNGSLLATTCKDKTLRIIDPRKSQVVAERFAAHEGMRPMRAVFTRLGHIFTTGFTRMSQRELGLWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITEEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLKEGY 395          
BLAST of Coronin-1B vs. UniProt/SwissProt
Match: sp|Q9ULV4|COR1C_HUMAN (Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1)

HSP 1 Score: 480.33 bits (1235), Expect = 1.214e-164
Identity = 227/409 (55.50%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS+FC+VNP+++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L   ++LTEP+  L GH +RVG+V WHPTA N+LLS+G DN +++WN+ T E L+ +     DMI + ++N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR +KLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N  PIL+S+K G+   K R  K VK  I
Sbjct:    4 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLT--LSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNI 409          
BLAST of Coronin-1B vs. UniProt/SwissProt
Match: sp|B0R0D7|COR1C_DANRE (Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 3.564e-164
Identity = 224/409 (54.77%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++A+I EA+GGGAF+V+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L    +++EP+  L GH +RVG+V WHPTA N+LLS+G DN++++WN+ T E ++ +    PD+I S  +N +GS + T+CKDK  R++DPR  EI  E  K HEGA+P + ++L D +VFTTGFSRMSERQ ALWD  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   + +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG    + AEEWFEG N  P+L+S+K G+   K R  K VK  I
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVALIVEASGGGAFMVLPLHKTGRIDKAYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLV--TSMSEPVVVLEGHSKRVGVVTWHPTARNVLLSAGCDNMIIIWNVGTGESMITLEDHHPDIIYSICWNRNGSLICTACKDKKIRVIDPRKEEIIAEKDKAHEGARPMRAIFLSDGKVFTTGFSRMSERQLALWDPENIDEPVAVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPFVHYLNTFTTKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDAPLEAEEWFEGKNGDPVLISLKHGYIPGKNRDLKVVKKNI 410          
BLAST of Coronin-1B vs. UniProt/SwissProt
Match: sp|Q9WUM4|COR1C_MOUSE (Coronin-1C OS=Mus musculus OX=10090 GN=Coro1c PE=1 SV=2)

HSP 1 Score: 478.404 bits (1230), Expect = 6.412e-164
Identity = 226/409 (55.26%), Postives = 298/409 (72.86%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS+FC+VNP+++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L   ++LTEP+  L GH +RVG+V WHPTA N+LLS+G DN +++WN+ T E L+ +     DMI + +++ +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D ++IYL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR +KLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N  PIL+S+K G+   K R  K VK  I
Sbjct:    4 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLT--LSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWSRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNI 409          
BLAST of Coronin-1B vs. UniProt/SwissProt
Match: sp|Q6QEF8|CORO6_HUMAN (Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2)

HSP 1 Score: 473.011 bits (1216), Expect = 7.735e-162
Identity = 215/394 (54.57%), Postives = 296/394 (75.13%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF 1198
            + R+SKF+H+FG+A K D+ Y+ IR++K +WDS+FC+VNPK+LAII EA GGGAF+V+P+ K GR + + P V GH A VLDI +CPHND+VIASAS+D T+ VW IP D+   + N+TEPI  L GH +RVG++ WHPTA N+LLS+G DN++++WN+ T EVL+ +    PD+I S  +N +GS L T+CKDK  RI+DPR G++  E  + HEGA+P + V+  D ++ +TGFSRMSERQ ALWD  NF   +  +++DTSNGV+ P+YD D +++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++V++ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDT G  PA+ A+EW  G + +P+L+S++DG+
Sbjct:    5 VVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFIVLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIP-DYTPMR-NITEPIITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHSVCWNSNGSLLATTCKDKTLRIIDPRKGQVVAEQARPHEGARPLRAVFTADGKLLSTGFSRMSERQLALWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGY 395          
BLAST of Coronin-1B vs. UniProt/SwissProt
Match: sp|Q920M5|CORO6_MOUSE (Coronin-6 OS=Mus musculus OX=10090 GN=Coro6 PE=1 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 7.592e-160
Identity = 213/394 (54.06%), Postives = 293/394 (74.37%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF 1198
            + R+SKF+H+FG+A K D+ Y+ IR++K +WDS FC+VNPK+LAII EA GGGAF+V+P+ K GR + + P V GH   VLDI +CPHND+VIASAS+D TV VW IP D+   + N+TEP+  L GH +RVG++ WHPTA N+LLS+G DN++++WN+ T EVL+ +    PD+I S  +N +GS L T+CKDK  RI+DPR  ++  E  + HEGA+P + V+  D ++ +TGFSRMSERQ ALWD  NF   +  +++DTSNGV+ P+YD D +++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++V++ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDT G  PA+ A+EW  G + +P+L+S+K+G+
Sbjct:    5 VVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSAFCAVNPKFLAIIVEAGGGGAFIVLPLAKTGRVDKNYPLVTGHTGPVLDIDWCPHNDNVIASASDDTTVMVWQIP-DYTPVR-NITEPVITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDIHPDVIHSVCWNSNGSLLATTCKDKTLRIIDPRKSQVVAERARPHEGARPLRAVFTADGKLLSTGFSRMSERQLALWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITEEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLKEGY 395          
BLAST of Coronin-1B vs. TrEMBL
Match: A0A504YSU0 (Coronin OS=Fasciola gigantica OX=46835 GN=FGIG_05472 PE=3 SV=1)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 285/421 (67.70%), Postives = 344/421 (81.71%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPV----------KAAIKSKLAD 1258
              RRSKFKH+FGK LK+++CY+ IRITKSSWD  FC+VNPKY+AIITEAAGGGAFLV+P+++VGR E D P VAGHKA+VLD+Q+CPHNDD+IASASED TVKVW IPE  L+ K NLT PIA+LV HQRRVGLV+WHPTAE++LLS+GADN+V +WN+ TEE LVEI FPDM++SA+FNY+GSKLVT+CKD+ TR+++PR+GEI  EG CH+G KPQ+ VY+K DRVFTTGFS MSERQF LW D NF+  L  +++DTSNGVMFP+YD D +LIYL GKGDS IRYFE + E+  V YIN L SSDPQRG+GWMPKRG++VNQNEIAR YKLH K LCEVIPFTVPRKSEL+QDDLYPDT GD PA++AEEW  G N  P+L+S+K+ +  K RT+  V          +AA KS + D
Sbjct:    2 FMRRSKFKHVFGKPLKKEQCYEDIRITKSSWDGHFCAVNPKYVAIITEAAGGGAFLVLPVDRVGRVERDAPLVAGHKASVLDVQWCPHNDDLIASASEDTTVKVWQIPEGGLEPKTNLTVPIADLVAHQRRVGLVVWHPTAEHVLLSAGADNMVYIWNVATEEPLVEIMFPDMVLSASFNYNGSKLVTTCKDRHTRVLNPRSGEIIVEGICHQGTKPQEAVYVKGDRVFTTGFSPMSERQFGLWKDDNFNEPLHIQELDTSNGVMFPFYDPDTSLIYLCGKGDSTIRYFEITEEEPYVFYINMLTSSDPQRGMGWMPKRGLDVNQNEIARFYKLHTKGLCEVIPFTVPRKSELFQDDLYPDTIGDTPALTAEEWMAGKNADPVLISLKEVYVPKARTKNRVTKLLSGAQANRAAQKSPMGD 422          
BLAST of Coronin-1B vs. TrEMBL
Match: A0A4E0RC47 (Coronin OS=Fasciola hepatica OX=6192 GN=D915_002929 PE=3 SV=1)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 285/421 (67.70%), Postives = 344/421 (81.71%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPV----------KAAIKSKLAD 1258
              RRSKFKH+FGK LK+++CY+ IRITKSSWD  FC+VNPKY+AIITEAAGGGAFLV+P+++VGR E D P VAGHKA+VLD+Q+CPHNDD+IASASED TVKVW IPE  L+ K NLT PIA+LV HQRRVGLV+WHPTAE++LLS+GADN+V +WN+ TEE LVEI FPDM++SA+FNY+GSKLVT+CKD+ TR+++PR+GEI  EG CH+G KPQ+ VY+K DRVFTTGFS MSERQF LW D NF+  L  +++DTSNGVMFP+YD D +LIYL GKGDS IRYFE + E+  V YIN L SSDPQRG+GWMPKRG++VNQNEIAR YKLH K LCEVIPFTVPRKSEL+QDDLYPDT GD PA++AEEW  G N  P+L+S+K+ +  K RT+  V          +AA KS + D
Sbjct:    7 FMRRSKFKHVFGKPLKKEQCYEDIRITKSSWDGHFCAVNPKYVAIITEAAGGGAFLVLPVDRVGRVERDAPLVAGHKASVLDVQWCPHNDDLIASASEDTTVKVWQIPEGGLEPKTNLTVPIADLVAHQRRVGLVVWHPTAEHVLLSAGADNMVYIWNVATEEPLVEIMFPDMVLSASFNYNGSKLVTTCKDRHTRVLNPRSGEIIVEGICHQGTKPQEAVYVKGDRVFTTGFSPMSERQFGLWKDDNFNEPLHIQELDTSNGVMFPFYDPDTSLIYLCGKGDSTIRYFEITEEEPYVFYINMLTSSDPQRGMGWMPKRGLDVNQNEIARFYKLHTKGLCEVIPFTVPRKSELFQDDLYPDTIGDTPALTAEEWMAGKNADPVLISLKEVYVPKTRTKNRVTKLLSGAQANRAAQKSPMGD 427          
BLAST of Coronin-1B vs. TrEMBL
Match: A0A419PDZ0 (Coronin (Fragment) OS=Clonorchis sinensis OX=79923 GN=CORO6 PE=3 SV=1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 288/420 (68.57%), Postives = 345/420 (82.14%), Query Frame = 2
Query:   20 MALF-RRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPVKAAIKSKLA---DQKT 1267
            M +F RRSKFKH+FGK  ++D CY+ IRITKSSWDS FC+VNPKYLAIITEAAGGGAFLV+PIEKVGR E D P VAGHKAAVLDIQ+CPH+DD+IASASED TVKVW IPE  L+  +NLT P+A+LV HQRRVGLV WHPTAE+ LLS+GADN++ +WN+ TEE LVEI  PDM++S +FNY+GS+LVT+CKD+ TR+++PRTGE+  EG CH+G+KPQQ VYLKDDR+FTTGFS MSERQ+ALW  T+F+  L  +++DTSNGVMFP+YD D NLIYL GKGDS IRYFE + E+  VH+IN L SSDPQRG+GWMPKRG++VNQ EIAR YKLH K LCEVIPFTVPRKSEL+QDDLYPDT GD P ++ +EW  G +  PIL+S+KDG+  K R+ KP    IKS +A   DQ T
Sbjct:    1 MTMFMRRSKFKHVFGKPARKDACYEDIRITKSSWDSRFCAVNPKYLAIITEAAGGGAFLVLPIEKVGRVERDAPLVAGHKAAVLDIQWCPHSDDLIASASEDTTVKVWHIPEGGLEPGVNLTVPVADLVAHQRRVGLVSWHPTAEHCLLSAGADNMLFIWNVATEEPLVEIMLPDMVLSVSFNYNGSRLVTTCKDRHTRVLNPRTGEVLLEGICHQGSKPQQAVYLKDDRIFTTGFSPMSERQYALWKGTDFTEPLHIQELDTSNGVMFPFYDPDTNLIYLCGKGDSTIRYFEITDEEPYVHFINMLTSSDPQRGMGWMPKRGLDVNQCEIARFYKLHAKGLCEVIPFTVPRKSELFQDDLYPDTIGDTPPLTVDEWMAGKDADPILISLKDGYVPKTRS-KPKSRLIKSHIAGESDQPT 419          
BLAST of Coronin-1B vs. TrEMBL
Match: H2KP26 (Coronin OS=Clonorchis sinensis OX=79923 GN=CLF_101250 PE=3 SV=1)

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 286/417 (68.59%), Postives = 342/417 (82.01%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPVKAAIKSKLA---DQKT 1267
              RRSKFKH+FGK  ++D CY+ IRITKSSWDS FC+VNPKYLAIITEAAGGGAFLV+PIEKVGR E D P VAGHKAAVLDIQ+CPH+DD+IASASED TVKVW IPE  L+  +NLT P+A+LV HQRRVGLV WHPTAE+ LLS+GADN++ +WN+ TEE LVEI  PDM++S +FNY+GS+LVT+CKD+ TR+++PRTGE+  EG CH+G+KPQQ VYLKDDR+FTTGFS MSERQ+ALW  T+F+  L  +++DTSNGVMFP+YD D NLIYL GKGDS IRYFE + E+  VH+IN L SSDPQRG+GWMPKRG++VNQ EIAR YKLH K LCEVIPFTVPRKSEL+QDDLYPDT GD P ++ +EW  G +  PIL+S+KDG+  K R+ KP    IKS +A   DQ T
Sbjct:    2 FMRRSKFKHVFGKPARKDACYEDIRITKSSWDSRFCAVNPKYLAIITEAAGGGAFLVLPIEKVGRVERDAPLVAGHKAAVLDIQWCPHSDDLIASASEDTTVKVWHIPEGGLEPGVNLTVPVADLVAHQRRVGLVSWHPTAEHCLLSAGADNMLFIWNVATEEPLVEIMLPDMVLSVSFNYNGSRLVTTCKDRHTRVLNPRTGEVLLEGICHQGSKPQQAVYLKDDRIFTTGFSPMSERQYALWKGTDFTEPLHIQELDTSNGVMFPFYDPDTNLIYLCGKGDSTIRYFEITDEEPYVHFINMLTSSDPQRGMGWMPKRGLDVNQCEIARFYKLHAKGLCEVIPFTVPRKSELFQDDLYPDTIGDTPPLTVDEWMAGKDADPILISLKDGYVPKTRS-KPKSRLIKSHIAGESDQPT 417          
BLAST of Coronin-1B vs. TrEMBL
Match: A0A4S2M9U5 (Coronin OS=Opisthorchis felineus OX=147828 GN=CRM22_002914 PE=3 SV=1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 284/417 (68.11%), Postives = 342/417 (82.01%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPVKAAIKSKLA---DQKT 1267
              RRSKFKH+FGK  ++D CY+ IRITKSSWD+ FC+VNPKYLAIITEAAGGGAFLV+PIEKVGR E D P VAGHKAAVLDIQ+CPH+DD+IASASED TVKVW IPE  L+  +NLT P+A+LV HQRRVGLV WHPTAE+ LLS+GADN++ +WN+ TEE LVEI  PDM++S +FNY+GS+LVT+CKD+ TR+++PRTGE+  EG CH+G+KPQQ VYLKDDR+FTTGFS MSERQ+ALW  T+F+  L  +++DTSNGVMFP+YD D NL+YL GKGDS IRYFE + E+  VH+IN L SSDPQRG+GWMPKRG++VNQ EIAR YKLH K LCEVIPFTVPRKSEL+QDDLYPDT GD P ++ +EW  G +  PIL+S+KDG+  K R+ KP    IKS +A   DQ T
Sbjct:    2 FMRRSKFKHVFGKPARKDACYEDIRITKSSWDARFCAVNPKYLAIITEAAGGGAFLVLPIEKVGRVERDAPLVAGHKAAVLDIQWCPHSDDLIASASEDTTVKVWHIPEGGLEPGVNLTVPVADLVAHQRRVGLVAWHPTAEHCLLSAGADNMLFIWNVATEEPLVEIMLPDMVLSVSFNYNGSRLVTTCKDRHTRVLNPRTGEVLLEGICHQGSKPQQAVYLKDDRIFTTGFSPMSERQYALWKGTDFTEPLHIQELDTSNGVMFPFYDPDTNLMYLCGKGDSTIRYFEITDEEPYVHFINMLTSSDPQRGMGWMPKRGLDVNQCEIARFYKLHTKGLCEVIPFTVPRKSELFQDDLYPDTIGDTPPLTVDEWMAGKDADPILISLKDGYVPKTRS-KPKSRLIKSHIAGESDQPT 417          
BLAST of Coronin-1B vs. Ensembl Cavefish
Match: coro1ca (coronin 1C [Source:NCBI gene;Acc:103023124])

HSP 1 Score: 478.404 bits (1230), Expect = 7.930e-165
Identity = 226/409 (55.26%), Postives = 299/409 (73.11%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCT+ VW IPE+ L    +++EP+  L GH +RVG++ WHPTA N+LLS+G DN+V++WN+ T E ++ +    PD+I SA +N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   + +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N +PIL+S+K G+   K R  K VK  I
Sbjct:   10 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLYKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTIMVWQIPENGLV--TSMSEPVVVLEGHSKRVGIISWHPTARNVLLSAGCDNVVIIWNVGTGEAMITLEDMHPDVIYSACWNRNGSLICTAAKDKKIRVIDPRKEEIIAEKDKAHEGARPMRAIFLSDGNVFTTGFSRMSERQLALWNPQNMEEPISVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPFVHYLNTFTTKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDCALEAEEWFEGKNGEPILISLKHGYIPGKNRDLKVVKKNI 415          
BLAST of Coronin-1B vs. Ensembl Cavefish
Match: coro1ca (coronin 1C [Source:NCBI gene;Acc:103023124])

HSP 1 Score: 478.019 bits (1229), Expect = 8.780e-165
Identity = 226/409 (55.26%), Postives = 299/409 (73.11%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCT+ VW IPE+ L    +++EP+  L GH +RVG++ WHPTA N+LLS+G DN+V++WN+ T E ++ +    PD+I SA +N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   + +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N +PIL+S+K G+   K R  K VK  I
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLYKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTIMVWQIPENGLV--TSMSEPVVVLEGHSKRVGIISWHPTARNVLLSAGCDNVVIIWNVGTGEAMITLEDMHPDVIYSACWNRNGSLICTAAKDKKIRVIDPRKEEIIAEKDKAHEGARPMRAIFLSDGNVFTTGFSRMSERQLALWNPQNMEEPISVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPFVHYLNTFTTKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDCALEAEEWFEGKNGEPILISLKHGYIPGKNRDLKVVKKNI 410          
BLAST of Coronin-1B vs. Ensembl Cavefish
Match: coro1ca (coronin 1C [Source:NCBI gene;Acc:103023124])

HSP 1 Score: 478.019 bits (1229), Expect = 8.780e-165
Identity = 226/409 (55.26%), Postives = 299/409 (73.11%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCT+ VW IPE+ L    +++EP+  L GH +RVG++ WHPTA N+LLS+G DN+V++WN+ T E ++ +    PD+I SA +N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   + +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N +PIL+S+K G+   K R  K VK  I
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLYKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTIMVWQIPENGLV--TSMSEPVVVLEGHSKRVGIISWHPTARNVLLSAGCDNVVIIWNVGTGEAMITLEDMHPDVIYSACWNRNGSLICTAAKDKKIRVIDPRKEEIIAEKDKAHEGARPMRAIFLSDGNVFTTGFSRMSERQLALWNPQNMEEPISVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPFVHYLNTFTTKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDCALEAEEWFEGKNGEPILISLKHGYIPGKNRDLKVVKKNI 410          
BLAST of Coronin-1B vs. Ensembl Cavefish
Match: coro1cb (coronin, actin binding protein, 1Cb [Source:ZFIN;Acc:ZDB-GENE-030131-418])

HSP 1 Score: 467.233 bits (1201), Expect = 7.494e-161
Identity = 222/409 (54.28%), Postives = 297/409 (72.62%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P++K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L     L+EP+  L GH +RVG+V WHPTA N+LLS+G DN++M+WN+ T E L+ +    PD+I S ++N +GS + T+CKDK  R++DPR G+I  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  +    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   S +PQRG+G+MPKRG++VN+ EIAR   L++    + I  TVPRKS+L+QDDLYPDTAG   A+ AE+WF+G N  PIL+S+K G+   K R  K VK  +
Sbjct:    5 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLQKTGRIDKAYPTVCGHTGPVLDIDWCPHNDHVIASGSEDCTVMVWQIPENGLVSA--LSEPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNMIMIWNVGTGEPLITLDDMHPDVIFSVSWNRNGSLICTACKDKKVRVIDPRKGKITAEKDKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKSMDEPISVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARNELLYS----QPIVMTVPRKSDLFQDDLYPDTAGPDCALEAEDWFDGKNGDPILISLKHGYVPGKNRDLKVVKKNV 407          
BLAST of Coronin-1B vs. Ensembl Cavefish
Match: coro1ca (coronin 1C [Source:NCBI gene;Acc:103023124])

HSP 1 Score: 486.878 bits (1252), Expect = 4.703e-157
Identity = 226/409 (55.26%), Postives = 299/409 (73.11%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCT+ VW IPE+ L    +++EP+  L GH +RVG++ WHPTA N+LLS+G DN+V++WN+ T E ++ +    PD+I SA +N +GS + T+ KDK  R++DPR  EI  E  K HEGA+P + ++L D  VFTTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   + +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTAG   A+ AEEWFEG N +PIL+S+K G+   K R  K VK  I
Sbjct:  998 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLYKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTIMVWQIPENGLV--TSMSEPVVVLEGHSKRVGIISWHPTARNVLLSAGCDNVVIIWNVGTGEAMITLEDMHPDVIYSACWNRNGSLICTAAKDKKIRVIDPRKEEIIAEKDKAHEGARPMRAIFLSDGNVFTTGFSRMSERQLALWNPQNMEEPISVHEMDTSNGVLLPFYDPDTNVVYLCGKGDSSIRYFEITDEAPFVHYLNTFTTKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTAGPDCALEAEEWFEGKNGEPILISLKHGYIPGKNRDLKVVKKNI 1403          
BLAST of Coronin-1B vs. Ensembl Sea Lamprey
Match: CORO2A (coronin 2A [Source:HGNC Symbol;Acc:HGNC:2255])

HSP 1 Score: 267.314 bits (682), Expect = 7.050e-86
Identity = 128/282 (45.39%), Postives = 192/282 (68.09%), Query Frame = 2
Query:   29 FRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKD-DRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGK 868
            +R SKF++++GKA  R+ CYD + +T+S  DS FC+VNPK++ ++TE+AGGGAF+V+P+ + GR +   P V GH+  VLDI++ P +D++IAS SED +V+VW IPE  L  + NLT     L GH RRVGL+ WHPTA NIL+S+G D  +++WN+   E +  I    D+++S +FN DGS L T+CKD+  R+++PR+G +  E  C +  K  + V+L D  R+ TTG SR + RQ  LWD  + S  L+ E++D  +G++FP+YD D  +++L GK
Sbjct:    7 YRCSKFRNVYGKAGGRERCYDSVPVTRSVNDSHFCAVNPKFIGVVTESAGGGAFIVLPLAQTGRVDPLCPRVCGHRGNVLDIKWNPFDDNIIASCSEDASVRVWEIPEGGL--RANLTTAARELYGHSRRVGLIEWHPTAVNILISAGYDYKILVWNVEAGEAVQVIDCHRDVVLSLSFNTDGSLLATTCKDRRLRVIEPRSGAVLQETHC-KTHKVNRVVFLGDTKRLLTTGSSRWNNRQIMLWDQEDLSEPLVQEEVDGLSGLLFPFYDPDTRMLFLAGK 285          
BLAST of Coronin-1B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005638.1 (pep scaffold:Pmarinus_7.0:GL478306:8425:25516:1 gene:ENSPMAG00000005112.1 transcript:ENSPMAT00000005638.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.933 bits (424), Expect = 8.395e-49
Identity = 79/143 (55.24%), Postives = 106/143 (74.13%), Query Frame = 2
Query:  770 FSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF 1198
            F   +  +++D+SNGV+ P+YD D N+IYL GKGD  IRYFE +PE   VH++N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTA    AI A+EW  G + +P+LVS++ G+
Sbjct:    4 FEEPITLQELDSSNGVLIPYYDMDTNIIYLCGKGDCTIRYFEVTPEPPYVHFLNLFSSKEPQRGMGFMPKRGLDVNKCEIARFYKLHERR-CEPIIMTVPRKSDLFQDDLYPDTAAAQAAIEADEWLSGKDGEPVLVSLRAGY 145          
BLAST of Coronin-1B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005640.1 (pep scaffold:Pmarinus_7.0:GL478306:8425:20515:1 gene:ENSPMAG00000005112.1 transcript:ENSPMAT00000005640.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.428 bits (350), Expect = 1.202e-38
Identity = 63/112 (56.25%), Postives = 83/112 (74.11%), Query Frame = 2
Query:  770 FSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYP 1105
            F   +  +++D+SNGV+ P+YD D N+IYL GKGD  IRYFE +PE   VH++N   S +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDD  P
Sbjct:    4 FEEPITLQELDSSNGVLIPYYDMDTNIIYLCGKGDCTIRYFEVTPEPPYVHFLNLFSSKEPQRGMGFMPKRGLDVNKCEIARFYKLHERR-CEPIIMTVPRKSDLFQDDGEP 114          
BLAST of Coronin-1B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008920.1 (pep scaffold:Pmarinus_7.0:GL488652:3061:5243:-1 gene:ENSPMAG00000008075.1 transcript:ENSPMAT00000008920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 2.808e-32
Identity = 54/101 (53.47%), Postives = 77/101 (76.24%), Query Frame = 2
Query:   29 FRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTV 331
            +R SKF+H+FG+  K   CYD + IT+S  D+ FC+VNP++LA++TE AGGGAFLV+P+++ G+ +   P V GH+A VLDI++ P ND +IASAS+D TV
Sbjct:    7 YRSSKFRHVFGRPAK--HCYDSVPITRSVHDNHFCAVNPRFLAVVTECAGGGAFLVLPLQQTGKVDPHYPRVCGHQAIVLDIKWSPFNDFIIASASDDATV 105          
BLAST of Coronin-1B vs. Ensembl Sea Lamprey
Match: wsb2 (WD repeat and SOCS box containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-26])

HSP 1 Score: 52.373 bits (124), Expect = 1.564e-7
Identity = 48/188 (25.53%), Postives = 80/188 (42.55%), Query Frame = 2
Query:  239 FVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTG-EIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSED 796
            ++  H A V D+ F P    ++ SAS D T++VW + +D    K+        L GH + V    +   A ++L S GA   V+LW +    +L  +    + +++  F+ DG+ L T+  D    + DP TG  + + G       P          V    FSR      +L DD     + + +D
Sbjct:  174 YLMDHTAIVQDLTFAPDGSLMLVSASRDKTLRVWDLKDDGNMVKV--------LKGHHKWVNASAFSLDA-SMLCSVGAGKSVLLWEMEHFTLLRRLEGHLNDVVACEFSPDGALLATASHDTRCILWDPYTGTAVASFGHLFPAPSPIFAGGANYHWVRAVAFSRDGLHVASLADDGLLRFWHVGDD 352          
BLAST of Coronin-1B vs. Ensembl Yeast
Match: CRN1 (Coronin; cortical actin cytoskeletal component that associates with the Arp2p/Arp3p complex to regulate its activity; plays a role in regulation of actin patch assembly [Source:SGD;Acc:S000004421])

HSP 1 Score: 340.502 bits (872), Expect = 9.469e-110
Identity = 171/420 (40.71%), Postives = 259/420 (61.67%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWL--------QEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKD-DRVFTTGFSRMSERQFALWDDTNFSSYLMSE--DIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCK-PILVSMK---DG----FKTKERTRKPV 1228
              R SK++H+FG+A K++  Y+ +++T ++WDS     N K++A+   A+GGGAF VIPIE+VG+    +P   GH A VLD  F P ND  IAS S+D  + +W IPE++          E I++ +P+  L GH R+VG VL+HP AEN+L SS  D  V LWN+ T + ++ +  PDM+ S +F+YDG+ L T  +DK  R+ + R  +I +EG  H GAK Q+ V+L + DR+ TTGFS++S+RQ  +WD  N     +     +D S+G++ P+YD    ++YL GKGD  IRY+E+  ++  +  ++   S++ QRG    PKR VNV +NE+ + +K       E + F VPR+SE +Q+D+YPD   + PA++AEEWF G + + PILVSM+   DG    F   +R ++P 
Sbjct:    5 FVRASKYRHVFGQAAKKELQYEKLKVTNNAWDSNLLKTNGKFIAVNWNASGGGAFAVIPIEEVGKAPDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDI-KPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWDAFNIEKGDLGGFYTVDQSSGILMPFYDEGNKILYLVGKGDGNIRYYEF--QNDELFELSEFQSTEAQRGFAVAPKRMVNVKENEVLKGFKTVVDQRIEPVSFFVPRRSEEFQEDIYPDAPSNKPALTAEEWFSGKSVEGPILVSMRSIYDGSAPSFHEAKRPQQPT 421          
BLAST of Coronin-1B vs. Ensembl Yeast
Match: YPL247C_mRNA (Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; similar to the petunia WD repeat protein an11; overexpression causes a cell cycle delay or arrest [Source:SGD;Acc:S000006168])

HSP 1 Score: 51.2174 bits (121), Expect = 2.987e-7
Identity = 27/84 (32.14%), Postives = 45/84 (53.57%), Query Frame = 2
Query:  260 AVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTE 511
            A+L ++  P++ +V+A+ + D    +       + +  N   PI NL GH   V  + WHPT  N+LLS G D  V+ W++N+ 
Sbjct:  351 ALLRLEPSPYDPNVLATFAADSNKII-------ILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSS 427          
BLAST of Coronin-1B vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 46.595 bits (109), Expect = 6.734e-6
Identity = 33/129 (25.58%), Postives = 67/129 (51.94%), Query Frame = 2
Query:  251 HKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINT-EEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTG 634
            H   +  I + P +++ + S +ED  +K +    +  +  + L   + +LVGH+RR+  V +HP+ +  + S+  D    LW+ +T +E+L++      + S +F  DGS + +   D  + + D R+G
Sbjct:  217 HVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNE--EGGLRL---LGDLVGHERRISDVKYHPSGK-FIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSG 339          
BLAST of Coronin-1B vs. Ensembl Nematostella
Match: EDO39281 (Coronin [Source:UniProtKB/TrEMBL;Acc:A7SAI2])

HSP 1 Score: 388.267 bits (996), Expect = 3.718e-131
Identity = 194/395 (49.11%), Postives = 266/395 (67.34%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYL-KDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKT 1204
              R+SK +H+ G   K D  YD IR+++++W+S FC+VNPK++AI    AGGGAFLV+P+ + GR E D P V GHK AVLD+ + P +D +IA+ SED  V +W IPE  L    N++EP+  L  HQ RVG+V WHP A NILLSS  D  +++WN+ T E    I +   ++ S ++N DGS   T+ KDK  R+VDPR+G+I  E   HEGAKPQQ  +L K + +FTTGFSRMSERQ+A+W+        + E+ID+SNGV F  +D D N++YL GKGD +IRY+E   +    ++I+   +   Q+GIG+MPKRG NV+ NE++R ++L  K  CEV+ FT PRKSEL+QDDLYPDT  D PA++A+EW EG N +P  + +K  FKT
Sbjct:    4 FVRQSKVRHVHGDHAKNDS-YDNIRVSENTWESPFCAVNPKFVAISLHVAGGGAFLVLPVTQKGRVEPDAPKVIGHKGAVLDLAWNPFDDHMIATGSEDARVMIWQIPEHGLHS--NISEPLVTLEYHQNRVGIVRWHPVASNILLSSSHDLKIVIWNLETAEAFQIIENHTAIVYSVSWNRDGSLFTTTSKDKKLRLVDPRSGKIVKEVNGHEGAKPQQACWLTKFNYIFTTGFSRMSERQYAIWNAETLEQIAL-EEIDSSNGVQFIHFDEDTNMVYLCGKGDCLIRYYEIVEDAPYCYWISNYQAKQAQKGIGFMPKRGCNVDINEMSRIFRL-IKGSCEVVSFTCPRKSELFQDDLYPDTLSDEPALTADEWLEGKNAEPNRMGLKQFFKT 393          
BLAST of Coronin-1B vs. Ensembl Nematostella
Match: EDO41467 (Coronin [Source:UniProtKB/TrEMBL;Acc:A7S473])

HSP 1 Score: 363.999 bits (933), Expect = 6.209e-121
Identity = 178/414 (43.00%), Postives = 270/414 (65.22%), Query Frame = 2
Query:   38 SKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEA-DIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTE-EVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKD-DRVFTTGFSRMSERQFALWDDTN-FSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRK-SELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPVKAAIKSKLADQK 1264
            SKFKH+FG   K++ CY+ I I++ +W+S FC+VNPK+LA+  E++ GG FLV+P+ + G+ +  + P V GH   VLD+ + P +D+VIASASEDC++K+W IP+  L E +N  + I +L GH R+VG++ WHP A NI+ S+G D+++++W++  E  VL+    PD I S +FN++GS + T+CKDK  R++DPR G +   G+ H+G K  Q V+L +  R+F+TGFSR  ER+ A+WD  N     L  E +D+S+G +  +YD D +++YL GKGD  IRY+E   E+    ++N   S+ PQRG+G MPKRG+ V++ EI R YKL N  + E I  TVPR+ S  YQ DL+P T  + PA+SAE+W  G+N  P++  +  G      +R+  +++ +     QK
Sbjct:   13 SKFKHVFGNPAKKEGCYEGINISQIAWESNFCAVNPKFLAVALESSCGGPFLVLPLSQTGKIDPFNQPKVNGHTRPVLDLGWNPFDDNVIASASEDCSIKIWYIPDCGLCEDLNREDFIGHLQGHDRKVGIIRWHPCASNIIASAGFDDVIIIWDVEREAAVLILKGHPDTIFSLSFNWNGSLIATTCKDKKIRVIDPREGRLIASGEGHKGPKCSQVVFLGNTSRLFSTGFSRTQEREVAVWDLGNALKRPLNIEQLDSSSGNIMLYYDHDTHMVYLAGKGDGNIRYYEVLEEEPYFMFLNEFRSASPQRGLGVMPKRGLEVHKCEIMRFYKLQNNGVVEPIAMTVPRRHSGTYQFDLFPKTPSNKPAMSAEQWIMGSNKAPLMDELLPGLTVDGMSREAYESSKREDETKQK 426          
BLAST of Coronin-1B vs. Ensembl Nematostella
Match: EDO49756 (Coronin [Source:UniProtKB/TrEMBL;Acc:A7RFP3])

HSP 1 Score: 227.254 bits (578), Expect = 1.006e-64
Identity = 136/386 (35.23%), Postives = 209/386 (54.15%), Query Frame = 2
Query:   20 MALFRRSKFKHIFGKALKRDECYDCIRITKSSWD-STFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKD-DRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLD---SSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKS-ELYQDDLYPDTAGDVPAISAEEWFEG 1156
            M  F+ SKF +   K+ KR+ CY+ I +             +  ++A   +   GG   +IP+  +GR+ A  P +  H   V D+ F P +D ++A+ S DC++K+W IPE  + +  +LT P++    H  RV  VL+HPTAE +L SS   + V +W+++  +V   + S  D + S ++  DGS LVTSCKDK  RI DPR      E     G K  + ++  D   +  TGFS   ERQ A+WD  N    L    +DT+ G + P++DAD +++ + GKGD+ + YFE   +D    Y+ +     + D  +G+G +PK  ++V   E+ R  +L  KN    I + VPRK+ + +  DLYPDT G  PAI+AE WF+G
Sbjct:    1 MNRFKTSKFHNAAAKSPKRENCYNDINVGSLKMSCGNHLKASTSFIAFNVDK--GGCLGIIPLSDIGRR-ATTPLLHVHSDFVTDMDFSPFDDGLLATCSYDCSIKIWQIPESGVAQNHSLT-PLSAFPLHSSRVENVLFHPTAEEVLASS-CSSTVSVWDVSQNKVKFSLDSHKDAVQSLSWKEDGSLLVTSCKDKTIRIFDPRKSSCTVETLGFAGIKDSRVIWRSDKGHIIGTGFSSSRERQVAIWDIHNMKEPLQRIGLDTNTGTLMPFHDADSDMLLIAGKGDTSVLYFEI--KDSGSEYLKQASVHMTEDQHKGMGMVPKLALDVMSCEVVRLLQL-TKNSVVPISYLVPRKNLKDFNADLYPDTLGPEPAITAERWFQG 378          

HSP 2 Score: 185.652 bits (470), Expect = 3.341e-50
Identity = 131/420 (31.19%), Postives = 218/420 (51.90%), Query Frame = 2
Query:   32 RRSKFKHIFGKALKRDECYDCIR-ITKSSW-DSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGR-QEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEI-SFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKT-EGKCHEGAKPQQCVYLKDD--RVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPR-KSELYQDDLYPDTAGD-VPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPVKAAIKSKLADQK 1264
            R SKF+HI G  + +    + IR ++ S++ +     +N +++A    +  GG   V+P  K  R  ++ +P V    + V+D  F P + + +A A E   + +W++P   L E ++  EP+  L GH  +  +V +HP AEN+L S+  D  V LW+IN  + ++ +    + + S A++ DG +L T  +DK  RI DPR       EG   EG++  + ++   D   +   G  +MS R  +++D  N S  L   +I+ +  ++ P+YD D N+I L+GKGD+V+  +E S E   +  +     +DP + I +  KR  +V + E AR  KL   NL E I F VPR K E +QDDL+P+T      A++ EEW  G + +   +S+      +    KP+  A K+  A +K
Sbjct:  473 RSSKFRHIIGVPMHKSTNIENIRNLSMSTFGECDGLQLNKEFVAYPL-SGPGGQIAVLPHNKPCRLPDSGMPVVQC-GSTVMDFVFDPLDVNRMAVACETGVISIWNLPSGGLTEILD--EPVEELKGHYDKPNIVRYHPNAENLLTSAAYDLTVKLWDINAAKSVITLEGHNEQVFSLAWSADGKQLATFSRDKKLRIYDPRAQVTPVLEGPGPEGSRGGRVIWGGPDGNMLLVCGSDKMSHRTVSVYDSGNLSEPLSVSEINIAPSILIPFYDEDANVIMLSGKGDTVLYAYEVSNEHPYLFDLTHYRVTDPFQAIAFFDKRVCDVKKVEFARAIKLTKTNL-EKIMFQVPRIKKEYFQDDLFPETRAKWEAAVACEEWLAGQDGEQSRISL------RPPNMKPLSEAPKAPPASKK 881          
BLAST of Coronin-1B vs. Ensembl Nematostella
Match: EDO29226 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T488])

HSP 1 Score: 59.6918 bits (143), Expect = 2.932e-11
Identity = 32/93 (34.41%), Postives = 54/93 (58.06%), Query Frame = 2
Query:  221 QEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWN 499
            ++A I  + GH   + DI F P+N+  IASAS D T+++W   ++WL  +   T   + L+GH+ RV   ++ P  +  LLS+ AD  + +W+
Sbjct:   10 EDAVIRVLEGHSDVIEDISFSPNNNATIASASRDRTIRLW---KNWLYPE---TTECSTLLGHEARVTCCVYSPLNDGRLLSASADRTIRVWD 96          
BLAST of Coronin-1B vs. Ensembl Nematostella
Match: EDO43295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ49])

HSP 1 Score: 58.5362 bits (140), Expect = 3.681e-9
Identity = 40/124 (32.26%), Postives = 61/124 (49.19%), Query Frame = 2
Query:  275 QFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENIL-------LSSGADNLVMLWNINTEEVLVEISFPDMII-SAAFNYDGSKLVTSCKDKFTRIVD 622
            QF P +  ++A+AS     K+WS+P+          EP++ + GH  RV  +++HP A   L        SSGAD  V+LWN  +E  +  I   D  +   A++  G  L T+C D   R+ D
Sbjct:  232 QFSP-DSKLLATASWSGLCKLWSVPD---------CEPVSTMKGHNERVCSIVFHPQARLSLDETTPSMASSGADGTVLLWNFKSENPIANIEGHDKRVPRLAYHPSGRFLGTTCFDNSWRLWD 345          

HSP 2 Score: 52.7582 bits (125), Expect = 2.793e-7
Identity = 41/143 (28.67%), Postives = 63/143 (44.06%), Query Frame = 2
Query:  233 IPFVAGHKAAVLDIQFCPH-------NDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINT-EEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGE 637
            +  + GH   V  I F P            +AS+  D TV +W+   +          PIAN+ GH +RV  + +HP+    L ++  DN   LW++   +EVL +      +   AF  DGS + T   D    + D RTG+
Sbjct:  260 VSTMKGHNERVCSIVFHPQARLSLDETTPSMASSGADGTVLLWNFKSE---------NPIANIEGHDKRVPRLAYHPSG-RFLGTTCFDNSWRLWDLEQLKEVLHQEGHSREVYDIAFQCDGSMVATCGLDARGMVWDLRTGQ 392          
BLAST of Coronin-1B vs. Ensembl Medaka
Match: coro1cb (coronin-1C [Source:NCBI gene;Acc:101166646])

HSP 1 Score: 478.789 bits (1231), Expect = 7.663e-165
Identity = 221/409 (54.03%), Postives = 301/409 (73.59%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A++ D+CYD IR+++ +WDS+FC+VNPK++AII EA+GGGAFLV+P+ K GR +   P V GH A VLDI +CPHND VIAS SEDCTV VW +PE+ L+  I  +EP+  L GH +RVG+V WHPTA N+LLS+G DN +++WN+ + + ++ +    PD+I S +++ +GS L T+CKDK  R++DPR  +I  E  K HEGA+P + ++L D  +FTTGFSRMSERQ ALW   N    +  +++D+SNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY+N   + +PQRG+G+MPKRG++VN+ EIAR YKLH +  CE I  TVPRKS+L+QDDLYPDTA   PA+ AEEWF G N  PIL+S++DG+  TK R  K VK  +
Sbjct:    5 VVRQSKFRHVFGQAVRNDQCYDDIRVSRVTWDSSFCAVNPKFVAIIIEASGGGAFLVLPLHKTGRIDKAYPTVCGHTAPVLDIDWCPHNDLVIASGSEDCTVMVWQVPENGLENPI--SEPVVVLEGHSKRVGIVSWHPTARNVLLSAGCDNQILIWNVGSGQAMISLEDMHPDVIFSVSWSRNGSLLCTACKDKKVRVIDPRKRKIVAEKDKAHEGARPMRAIFLADGNIFTTGFSRMSERQLALWKSGNMDEPICVQEMDSSNGVLLPFYDPDTNIVYLCGKGDSSIRYFEITDEAPFVHYLNTFSTKEPQRGMGYMPKRGLDVNKCEIARFYKLHERK-CEPIIMTVPRKSDLFQDDLYPDTASPDPALEAEEWFAGKNGGPILISLRDGYVSTKSRDLKVVKTNV 410          
BLAST of Coronin-1B vs. Ensembl Medaka
Match: coro1ca (coronin 1C [Source:NCBI gene;Acc:101165893])

HSP 1 Score: 472.626 bits (1215), Expect = 1.172e-162
Identity = 222/409 (54.28%), Postives = 295/409 (72.13%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L     L+EP+  L GH +RVG++ WHPTA N+LLS+G DN++++WN+ T E ++ +    PD+I +  +N  GS + TSCKDK  R++DPR   I  E  K HEGA+P + ++L D  + TTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D +++YL GKGDS IRYFE + E   VH++N   S +PQRG+G+M KRG++VN+ EIAR YKLH +  CE I  TVPRKSE++QDDLYPDTAG  PA+ AE+WFEG N  PIL+S+K+G+   K R  K VK  I
Sbjct:    4 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLVTP--LSEPVVVLEGHSKRVGVITWHPTARNVLLSAGCDNVIIIWNVGTGEAMITLDDMHPDVIYNVCWNRSGSLICTSCKDKGIRVIDPRKETIIAEKEKAHEGARPMRAIFLADGNILTTGFSRMSERQVALWNMKNMEEPMSVTEMDTSNGVLLPFYDPDTSVVYLCGKGDSSIRYFEITDEAPYVHFLNTFASKEPQRGMGFMSKRGLDVNKCEIARFYKLHERK-CEPIVMTVPRKSEMFQDDLYPDTAGPDPALEAEDWFEGKNGDPILISLKNGYVPVKNREFKVVKKNI 409          
BLAST of Coronin-1B vs. Ensembl Medaka
Match: coro1a (coronin-1A [Source:NCBI gene;Acc:101170433])

HSP 1 Score: 471.47 bits (1212), Expect = 1.904e-162
Identity = 218/419 (52.03%), Postives = 302/419 (72.08%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTE-GKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTR--KPVKAAIKSKLADQKT 1267
            + R SKF+H+FG+A+K D+CYD IRI++ +WDS FCSVNPK++A+I +A+GGGAF+V+P+ K GR +   P V GH   VLDI+FCPHND++IAS SEDC+V +W IPE  L    +LTEP+  L GH +RVG++ WHPTA N+L+S+G DN+V+LWN+   E  V I     D+I  A +N DGS+++TSCKDK  R++DPR G +  E  K HEG++P + V+  D ++ +TGFSRMSERQ ALWD  NFS  L  +++DTS+GV+ P+YD D N++YL GKGDS IRYFE + E   +HY++   S + Q+G+GWMPKRG+ +N+ EIAR YKLH +  CE I  TVPRKS+L+Q+DLYPDT G  P+  A+EWF G +  P+L+S+K+GF T  +++  K  K+ +K+  A   T
Sbjct:    5 VVRTSKFRHVFGQAVKADQCYDDIRISQMTWDSNFCSVNPKFVAMIVDASGGGAFIVLPLNKTGRIDMSYPTVCGHTGPVLDIEFCPHNDNIIASGSEDCSVMIWEIPEGGLT--TSLTEPVVKLDGHSKRVGILSWHPTAHNVLMSAGCDNVVILWNVARGEAAVRIDSVHTDLIYCACWNRDGSQILTSCKDKALRVLDPRKGTVLYEREKPHEGSRPIRAVFTSDGKILSTGFSRMSERQVALWDPKNFSEPLTLQELDTSSGVLLPFYDPDTNVVYLCGKGDSSIRYFEVTDEAPYIHYLSIYSSKESQKGMGWMPKRGLEINKCEIARFYKLHERK-CEPIVMTVPRKSDLFQEDLYPDTLGSEPSAEADEWFAGKDAPPVLISLKEGFATTTKSKEFKVHKSLLKTTTASAGT 420          
BLAST of Coronin-1B vs. Ensembl Medaka
Match: ENSORLT00000003955.2 (coronin 6 [Source:NCBI gene;Acc:101163755])

HSP 1 Score: 458.759 bits (1179), Expect = 4.818e-157
Identity = 213/409 (52.08%), Postives = 297/409 (72.62%), Query Frame = 2
Query:   23 ALFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS-FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKC-HEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            ++ R+SKF+H+FG+A+K D+ YD IR++K +WDS+FC+VNPK+LA+I E++GGGAFLV+P+ K GR + + P V GH   VLDI +CPH+D++IAS SEDCT  VW IP+  L     L++P+  L GH +RVG+V WHPTA NILL++G+DNL+++WN+   E L+ +   PD+I S ++N +GS   T+CKD+  R+ DPR  E+  E    HEG +P + ++++D  +FTTGF+RMS+R+  LWD TNF   +   ++DTSNGV+ P+YD D N++YL GKGDS IRYFE + E   VHY++   S +PQRG+G+MPKRGV+V++ EIAR YKL +K  CE I  TVPRKS+L+QDDLYPDTAG  PA+  EEW +G +  PILVSM++G+   K R  K VK  +
Sbjct:    4 SIVRQSKFRHVFGQAVKADQSYDDIRVSKVTWDSSFCAVNPKFLAVIVESSGGGAFLVLPLSKSGRVDKNYPLVIGHSGPVLDIDWCPHDDNIIASCSEDCTAMVWQIPDHTLTRP--LSDPVVVLEGHSKRVGIVTWHPTARNILLTAGSDNLIIIWNVGAGEPLISMDDHPDLIYSVSWNRNGSLFCTTCKDRRLRVCDPRKREVVAERLAPHEGIRPMRAIFIRDGNIFTTGFTRMSQRELGLWDPTNFEEPIALLELDTSNGVLLPYYDPDANMVYLCGKGDSSIRYFEITEEPPYVHYLSTFSSKEPQRGMGFMPKRGVDVSKCEIARLYKLLDKK-CEPITMTVPRKSDLFQDDLYPDTAGPEPAMEPEEWLDGRDEDPILVSMREGYVPPKSRELKVVKKNV 409          
BLAST of Coronin-1B vs. Ensembl Medaka
Match: coro1ca (coronin 1C [Source:NCBI gene;Acc:101165893])

HSP 1 Score: 479.174 bits (1232), Expect = 2.266e-156
Identity = 222/409 (54.28%), Postives = 295/409 (72.13%), Query Frame = 2
Query:   26 LFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEIS--FPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEG-KCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGF-KTKERTRKPVKAAI 1240
            + R+SKF+H+FG+A+K D+CYD IR+++ +WDS FC+VNPK++AII EA+GGGAFLV+P+ K GR +   P V GH   VLDI +CPHND VIAS SEDCTV VW IPE+ L     L+EP+  L GH +RVG++ WHPTA N+LLS+G DN++++WN+ T E ++ +    PD+I +  +N  GS + TSCKDK  R++DPR   I  E  K HEGA+P + ++L D  + TTGFSRMSERQ ALW+  N    +   ++DTSNGV+ P+YD D +++YL GKGDS IRYFE + E   VH++N   S +PQRG+G+M KRG++VN+ EIAR YKLH +  CE I  TVPRKSE++QDDLYPDTAG  PA+ AE+WFEG N  PIL+S+K+G+   K R  K VK  I
Sbjct:  726 VVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSAFCAVNPKFVAIIVEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLV--TPLSEPVVVLEGHSKRVGVITWHPTARNVLLSAGCDNVIIIWNVGTGEAMITLDDMHPDVIYNVCWNRSGSLICTSCKDKGIRVIDPRKETIIAEKEKAHEGARPMRAIFLADGNILTTGFSRMSERQVALWNMKNMEEPMSVTEMDTSNGVLLPFYDPDTSVVYLCGKGDSSIRYFEITDEAPYVHFLNTFASKEPQRGMGFMSKRGLDVNKCEIARFYKLHERK-CEPIVMTVPRKSEMFQDDLYPDTAGPDPALEAEDWFEGKNGDPILISLKNGYVPVKNREFKVVKKNI 1131          
BLAST of Coronin-1B vs. Planmine SMEST
Match: SMESG000026646.1 (SMESG000026646.1)

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 527/527 (100.00%), Postives = 527/527 (100.00%), Query Frame = 2
Query:   20 MALFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPVKAAIKSKLADQKTXXXXXXXXXXXXXXXXXXXXXXQPRASFKRASEESNGEVXXXXXXXXXXXXXXXXXVLDRRMLEEMRQEIHHLNKMVLDLQDRVEQLEDERSEHCNGADSKIDSTEPDLDA 1600
            MALFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPVKAAIKSKLADQKTPAKVEVKSKEPEPPKVEERAKPQPRASFKRASEESNGEVDRRSNSPNTNNNNNTDNVLDRRMLEEMRQEIHHLNKMVLDLQDRVEQLEDERSEHCNGADSKIDSTEPDLDA
Sbjct:    1 MALFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIVDPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTRKPVKAAIKSKLADQKTPAKVEVKSKEPEPPKVEERAKPQPRASFKRASEESNGEVDRRSNSPNTNNNNNTDNVLDRRMLEEMRQEIHHLNKMVLDLQDRVEQLEDERSEHCNGADSKIDSTEPDLDA 527          
BLAST of Coronin-1B vs. Planmine SMEST
Match: SMESG000000124.1 (SMESG000000124.1)

HSP 1 Score: 270.011 bits (689), Expect = 2.026e-83
Identity = 145/406 (35.71%), Postives = 232/406 (57.14%), Query Frame = 2
Query:   20 MALFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSS----------GADNLVMLWNINTEEVLVEISFPD-MIISAAFNYDGSKLVTSCKDKFTRIVDPR-TGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFE--YSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDG 1195
            M   R SKFK+I+G   K+D+C+D I++     +    +VNPKYLA++   +     ++ P+E+VGR EAD   +    +    I++CP +DD++     +  + +  IP+  + E I+  +           V   +WHPT  N +L+S           AD  ++LW+  T + L++I   +  + S +FNY+GSK+V +     TRI+D R T  I  E   H+ A+ Q  VYLK   +F+TG+S  + R++ALWD+ + S+ +   D+DT++GV++P YDAD N+IY+ GKGDS + +FE  Y P+   + Y+    S+ PQ G+  MPK GVNV  NE+ R +K +    CEVIP   PR+ + + +++YP T   VPA+S E+W  G +  PIL+S++ G
Sbjct:    1 MFAIRHSKFKNIYGDPKKKDQCFDQIKLKVKGAEPPLAAVNPKYLAVLINCSTVDV-MIRPLEEVGRVEADPKGIKAAISLPTCIEWCPRDDDLLFIGQLNGEINLIRIPDGGVSEVISTDDAELKWNCDCGSVLNAVWHPTVGNAVLTSCGSKFAGVGSSADTHLILWDTTTMDKLIDIKLNNCYLTSLSFNYNGSKVVCTDNSHITRIIDLRSTDSITQEAMLHKKARRQNTVYLKHGLIFSTGYSATTTREYALWDENDLSNPIELIDLDTNSGVLYPIYDADINVIYVWGKGDSTMSFFEVVYDPK-PTIQYLCGYQSAKPQNGVIAMPKLGVNVAANELTRLFKFYANGFCEVIPVICPRREQGFSEEVYPPTPSRVPALSIEDWMSGIDVDPILISLETG 404          
BLAST of Coronin-1B vs. Planmine SMEST
Match: SMESG000000068.1 (SMESG000000068.1)

HSP 1 Score: 268.47 bits (685), Expect = 2.253e-79
Identity = 145/406 (35.71%), Postives = 232/406 (57.14%), Query Frame = 2
Query:   20 MALFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITEAAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSS----------GADNLVMLWNINTEEVLVEISFPD-MIISAAFNYDGSKLVTSCKDKFTRIVDPR-TGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTNFSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFE--YSPEDKAVHYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVPRKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDG 1195
            M   R+SKFK++F    K+D+C+D I++     +    +VNPKYLA++   +    F++ P+E+VGR E D   V    +    I++CP +DD++     +  + +  IP+  + E I+  +           V   +WHPT  N +L+S           AD  ++LW+  T + L++I   +  + S +FNY+GSK+V +     TRI+D R T  I  E   H+ A+ Q  VYLK   +F+TG+S  + R++ALWD+ + S+ +   D+DT++GV++P YDAD N+IY+ GKGDS + +FE  Y P+   + Y+    S+ PQ G+  MPK GVNV  NE+ R +K +    CEVIP   PR+ + + +++YP T   VPA+S E+W  G +  PIL+S++ G
Sbjct:    1 MFDIRQSKFKNVFCDPKKKDQCFDQIKLKVKGAEPPLAAVNPKYLAVLINCSTVD-FMIRPLEEVGRVEVDSKGVKVANSLPTCIEWCPRDDDLLFIGQLNGEINLIRIPDGGVSEVISTDDAELKWNCDYGSVLNAVWHPTVGNAILTSCGGKFAGVGSSADTHLILWDTTTMDKLIDIKLNNCYLTSLSFNYNGSKVVCTDNSHITRIIDLRSTDSITQEAMLHKKARRQNTVYLKHGLIFSTGYSATTTREYALWDENDLSNPIELIDLDTNSGVLYPIYDADINVIYVWGKGDSTMSFFEVVYDPK-PTIQYLCGYQSAKPQNGVIAMPKLGVNVAANELTRLFKFYANEFCEVIPVICPRREQGFSEEVYPPTPSRVPALSIEDWMSGIDVDPILISLETG 404          
BLAST of Coronin-1B vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.597e-13
Identity = 49/133 (36.84%), Postives = 69/133 (51.88%), Query Frame = 2
Query:  230 DIPFVAGHKAAVLDIQFCPHNDDV---IASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVL-VEISFPDMIISAAFNYDGSKLVTSCKDKFTRI 616
            D+  +AGH   VLD+ F    D+V   +ASA  D TV++W + +         ++P     GH+  V  V ++P    +LLS+ AD     WN  T +V+ V     D I S AFNYDGSK++T  KD   RI
Sbjct:  102 DLFTLAGHTDEVLDVTF----DNVGKQVASAGADNTVRLWDVKD--------FSKPSFIFKGHEAEVSKVTFNPQG-TVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRI 221          
BLAST of Coronin-1B vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.780e-13
Identity = 49/133 (36.84%), Postives = 69/133 (51.88%), Query Frame = 2
Query:  230 DIPFVAGHKAAVLDIQFCPHNDDV---IASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSSGADNLVMLWNINTEEVL-VEISFPDMIISAAFNYDGSKLVTSCKDKFTRI 616
            D+  +AGH   VLD+ F    D+V   +ASA  D TV++W + +         ++P     GH+  V  V ++P    +LLS+ AD     WN  T +V+ V     D I S AFNYDGSK++T  KD   RI
Sbjct:  176 DLFTLAGHTDEVLDVTF----DNVGKQVASAGADNTVRLWDVKD--------FSKPSFIFKGHEAEVSKVTFNPQG-TVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRI 295          

HSP 2 Score: 51.6026 bits (122), Expect = 6.318e-7
Identity = 38/132 (28.79%), Postives = 65/132 (49.24%), Query Frame = 2
Query:  248 GHKAAVLDIQFCPHNDDVIASASEDCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAEN--ILLSSGADNLVMLWNINTEEVLVEISFPDMIISAA-FNYDGSKLVTSCKDKFTRIVDPRTG 634
            GH A V+ +QF P +  ++ +   D    +W +            + ++NL GH   V + L    A N   L++   D+ V+LW+++    + ++   D  ISAA FN+DG+ + T+  DK  +I D R G
Sbjct:   53 GHTAEVVCVQFNP-SSTLVGTGGMDTLAMLWDVESG---------KCVSNLQGHTAEV-ISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMG 173          
The following BLAST results are available for this feature:
BLAST of Coronin-1B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CORO1C2.528e-16555.50coronin 1C [Source:HGNC Symbol;Acc:HGNC:2254][more]
CORO1C2.528e-16555.50coronin 1C [Source:HGNC Symbol;Acc:HGNC:2254][more]
CORO1C5.703e-16555.50coronin 1C [Source:HGNC Symbol;Acc:HGNC:2254][more]
CORO1C2.282e-16455.50coronin 1C [Source:HGNC Symbol;Acc:HGNC:2254][more]
CORO61.999e-16254.57coronin 6 [Source:HGNC Symbol;Acc:HGNC:21356][more]
back to top
BLAST of Coronin-1B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cor-14.536e-14049.87Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
cor-15.411e-14049.87Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
cor-11.388e-13949.87Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
cor-11.388e-13949.87Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
cor-11.536e-13949.87Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Coronin-1B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coro1.113e-17658.13gene:FBgn0265935 transcript:FBtr0086209[more]
coro1.113e-17658.13gene:FBgn0265935 transcript:FBtr0086208[more]
coro1.113e-17658.13gene:FBgn0265935 transcript:FBtr0086207[more]
coro7.287e-17659.74gene:FBgn0265935 transcript:FBtr0336656[more]
coro7.287e-17659.74gene:FBgn0265935 transcript:FBtr0336655[more]
back to top
BLAST of Coronin-1B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coro1cb1.602e-16955.26coronin, actin binding protein, 1Cb [Source:ZFIN;A... [more]
coro1cb1.602e-16955.26coronin, actin binding protein, 1Cb [Source:ZFIN;A... [more]
coro1cb1.602e-16955.26coronin, actin binding protein, 1Cb [Source:ZFIN;A... [more]
coro1ca4.721e-16554.77coronin, actin binding protein, 1Ca [Source:NCBI g... [more]
coro1ca4.721e-16554.77coronin, actin binding protein, 1Ca [Source:NCBI g... [more]
back to top
BLAST of Coronin-1B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coro1c2.376e-16355.02coronin 1C [Source:NCBI gene;Acc:395017][more]
coro1c2.427e-16355.02coronin 1C [Source:NCBI gene;Acc:395017][more]
coro1c2.644e-16355.06coronin 1C [Source:NCBI gene;Acc:395017][more]
coro1c3.476e-16355.02coronin 1C [Source:NCBI gene;Acc:395017][more]
coro1c6.877e-16355.02coronin 1C [Source:NCBI gene;Acc:395017][more]
back to top
BLAST of Coronin-1B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Coro1c9.166e-16555.26coronin, actin binding protein 1C [Source:MGI Symb... [more]
Coro61.085e-16054.06coronin 6 [Source:MGI Symbol;Acc:MGI:2183448][more]
Coro1b1.596e-16044.66coronin, actin binding protein 1B [Source:MGI Symb... [more]
Coro1b1.596e-16044.66coronin, actin binding protein 1B [Source:MGI Symb... [more]
Coro61.022e-15753.05coronin 6 [Source:MGI Symbol;Acc:MGI:2183448][more]
back to top
BLAST of Coronin-1B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULV4|COR1C_HUMAN1.214e-16455.50Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 ... [more]
sp|B0R0D7|COR1C_DANRE3.564e-16454.77Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=... [more]
sp|Q9WUM4|COR1C_MOUSE6.412e-16455.26Coronin-1C OS=Mus musculus OX=10090 GN=Coro1c PE=1... [more]
sp|Q6QEF8|CORO6_HUMAN7.735e-16254.57Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV... [more]
sp|Q920M5|CORO6_MOUSE7.592e-16054.06Coronin-6 OS=Mus musculus OX=10090 GN=Coro6 PE=1 S... [more]
back to top
BLAST of Coronin-1B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YSU00.000e+067.70Coronin OS=Fasciola gigantica OX=46835 GN=FGIG_054... [more]
A0A4E0RC470.000e+067.70Coronin OS=Fasciola hepatica OX=6192 GN=D915_00292... [more]
A0A419PDZ00.000e+068.57Coronin (Fragment) OS=Clonorchis sinensis OX=79923... [more]
H2KP260.000e+068.59Coronin OS=Clonorchis sinensis OX=79923 GN=CLF_101... [more]
A0A4S2M9U50.000e+068.11Coronin OS=Opisthorchis felineus OX=147828 GN=CRM2... [more]
back to top
BLAST of Coronin-1B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coro1ca7.930e-16555.26coronin 1C [Source:NCBI gene;Acc:103023124][more]
coro1ca8.780e-16555.26coronin 1C [Source:NCBI gene;Acc:103023124][more]
coro1ca8.780e-16555.26coronin 1C [Source:NCBI gene;Acc:103023124][more]
coro1cb7.494e-16154.28coronin, actin binding protein, 1Cb [Source:ZFIN;A... [more]
coro1ca4.703e-15755.26coronin 1C [Source:NCBI gene;Acc:103023124][more]
back to top
BLAST of Coronin-1B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CORO2A7.050e-8645.39coronin 2A [Source:HGNC Symbol;Acc:HGNC:2255][more]
ENSPMAT00000005638.18.395e-4955.24pep scaffold:Pmarinus_7.0:GL478306:8425:25516:1 ge... [more]
ENSPMAT00000005640.11.202e-3856.25pep scaffold:Pmarinus_7.0:GL478306:8425:20515:1 ge... [more]
ENSPMAT00000008920.12.808e-3253.47pep scaffold:Pmarinus_7.0:GL488652:3061:5243:-1 ge... [more]
wsb21.564e-725.53WD repeat and SOCS box containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of Coronin-1B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CRN19.469e-11040.71Coronin; cortical actin cytoskeletal component tha... [more]
YPL247C_mRNA2.987e-732.14Putative protein of unknown function; green fluore... [more]
PRP46.734e-625.58Splicing factor; component of the U4/U6-U5 snRNP c... [more]
back to top
BLAST of Coronin-1B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO392813.718e-13149.11Coronin [Source:UniProtKB/TrEMBL;Acc:A7SAI2][more]
EDO414676.209e-12143.00Coronin [Source:UniProtKB/TrEMBL;Acc:A7S473][more]
EDO497561.006e-6435.23Coronin [Source:UniProtKB/TrEMBL;Acc:A7RFP3][more]
EDO292262.932e-1134.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432953.681e-932.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coronin-1B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coro1cb7.663e-16554.03coronin-1C [Source:NCBI gene;Acc:101166646][more]
coro1ca1.172e-16254.28coronin 1C [Source:NCBI gene;Acc:101165893][more]
coro1a1.904e-16252.03coronin-1A [Source:NCBI gene;Acc:101170433][more]
ENSORLT00000003955.24.818e-15752.08coronin 6 [Source:NCBI gene;Acc:101163755][more]
coro1ca2.266e-15654.28coronin 1C [Source:NCBI gene;Acc:101165893][more]
back to top
BLAST of Coronin-1B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026646.10.000e+0100.00SMESG000026646.1[more]
SMESG000000124.12.026e-8335.71SMESG000000124.1[more]
SMESG000000068.12.253e-7935.71SMESG000000068.1[more]
SMESG000008519.11.597e-1336.84SMESG000008519.1[more]
SMESG000008519.13.780e-1336.84SMESG000008519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005546 ID=SMED30005546|Name=Coronin-1B|organism=Schmidtea mediterranea sexual|type=transcript|length=1707bp
TATAAATCTTATATGAAAAATGGCATTATTTCGTCGTAGTAAATTCAAGC
ATATTTTTGGAAAAGCATTAAAGAGAGATGAATGCTATGATTGTATCAGA
ATTACCAAGAGTTCATGGGATTCTACATTTTGTTCAGTAAATCCGAAATA
TCTCGCTATAATCACAGAAGCCGCTGGTGGTGGAGCTTTTCTCGTTATTC
CAATTGAGAAAGTCGGCCGACAAGAAGCGGATATACCTTTTGTTGCCGGT
CACAAGGCAGCAGTTTTAGATATTCAATTTTGTCCTCACAACGATGATGT
TATTGCAAGTGCTTCTGAAGATTGCACGGTGAAAGTTTGGAGTATTCCGG
AGGATTGGTTGCAAGAAAAAATCAATTTAACTGAACCAATCGCCAATCTT
GTTGGGCATCAACGTCGAGTGGGATTAGTATTATGGCATCCAACTGCTGA
AAATATACTTTTATCATCTGGCGCTGACAACCTTGTCATGTTGTGGAATA
TCAACACAGAGGAAGTTTTGGTTGAAATCAGCTTTCCTGATATGATAATT
TCTGCTGCTTTCAATTATGACGGTTCGAAATTGGTAACTTCGTGTAAAGA
TAAATTCACTCGTATCGTTGATCCGAGAACTGGGGAGATTAAAACGGAAG
GTAAGTGCCACGAAGGTGCCAAACCGCAGCAATGCGTTTATCTGAAAGAT
GATCGAGTGTTTACGACTGGTTTCTCGCGAATGTCTGAACGACAGTTCGC
CTTATGGGATGACACTAACTTCAGCTCATATCTAATGAGTGAGGATATTG
ACACATCTAATGGGGTTATGTTCCCCTGGTATGATGCCGATTGCAATCTG
ATCTATCTCACTGGCAAAGGGGATAGTGTGATCAGATATTTTGAATACAG
TCCAGAAGACAAAGCCGTCCATTACATTAATCGGTTAGACAGCAGCGACC
CCCAAAGAGGCATCGGTTGGATGCCAAAAAGAGGTGTAAATGTTAATCAA
AATGAAATCGCCCGATGCTATAAGCTGCATAACAAAAACCTTTGTGAAGT
GATTCCATTTACAGTGCCAAGGAAATCAGAGTTATATCAGGATGATCTTT
ATCCTGATACTGCTGGTGATGTGCCAGCTATTTCAGCAGAGGAATGGTTT
GAAGGTACCAATTGTAAACCCATTCTCGTCTCGATGAAAGACGGGTTTAA
AACCAAAGAGCGCACCAGGAAACCTGTCAAGGCAGCAATCAAATCAAAAC
TCGCCGATCAAAAAACCCCAGCCAAAGTCGAGGTGAAATCGAAGGAACCA
GAACCACCAAAGGTTGAAGAGCGCGCAAAGCCTCAGCCAAGGGCTTCATT
TAAACGGGCATCCGAGGAGAGCAATGGCGAAGTCGACAGGCGATCAAATT
CACCGAATACCAACAACAACAATAACACTGACAATGTGCTAGATAGGAGA
ATGCTTGAAGAAATGCGGCAAGAGATTCACCATCTCAATAAGATGGTGCT
AGATTTGCAAGATCGAGTAGAGCAGTTGGAGGATGAGCGTAGTGAGCACT
GCAATGGTGCTGATTCAAAGATCGACTCTACTGAACCGGATTTGGATGCC
TGATCGACTTTGTTGTGATGCATAATTTATTACGTGCGTCTTTTGACAAA
CGCAACTCTGCCAGTTGGATGATGATGATAATTTTATAATGACCGCCACT
AATTATA
back to top

protein sequence of SMED30005546-orf-1

>SMED30005546-orf-1 ID=SMED30005546-orf-1|Name=SMED30005546-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=528bp
MALFRRSKFKHIFGKALKRDECYDCIRITKSSWDSTFCSVNPKYLAIITE
AAGGGAFLVIPIEKVGRQEADIPFVAGHKAAVLDIQFCPHNDDVIASASE
DCTVKVWSIPEDWLQEKINLTEPIANLVGHQRRVGLVLWHPTAENILLSS
GADNLVMLWNINTEEVLVEISFPDMIISAAFNYDGSKLVTSCKDKFTRIV
DPRTGEIKTEGKCHEGAKPQQCVYLKDDRVFTTGFSRMSERQFALWDDTN
FSSYLMSEDIDTSNGVMFPWYDADCNLIYLTGKGDSVIRYFEYSPEDKAV
HYINRLDSSDPQRGIGWMPKRGVNVNQNEIARCYKLHNKNLCEVIPFTVP
RKSELYQDDLYPDTAGDVPAISAEEWFEGTNCKPILVSMKDGFKTKERTR
KPVKAAIKSKLADQKTPAKVEVKSKEPEPPKVEERAKPQPRASFKRASEE
SNGEVDRRSNSPNTNNNNNTDNVLDRRMLEEMRQEIHHLNKMVLDLQDRV
EQLEDERSEHCNGADSKIDSTEPDLDA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005515protein binding
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0015629actin cytoskeleton
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015505Coronin
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015048DUF1899
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: biological process
TermDefinition
GO:0030036actin cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 480..507
NoneNo IPR availableSMARTSM01167DUF1900_2coord: 254..390
e-value: 5.8E-76
score: 268.4
NoneNo IPR availablePFAMPF16300WD40_4coord: 343..384
e-value: 3.7E-20
score: 71.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 399..457
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 501..528
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 399..474
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 458..474
NoneNo IPR availablePANTHERPTHR10856:SF0CORONINcoord: 4..506
IPR015048Domain of unknown function DUF1899SMARTSM01166DUF1899_3coord: 4..67
e-value: 1.4E-33
score: 127.5
IPR015048Domain of unknown function DUF1899PFAMPF08953DUF1899coord: 5..68
e-value: 1.7E-30
score: 104.6
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 66..109
e-value: 3.3E-6
score: 36.6
coord: 164..202
e-value: 1.1
score: 16.8
coord: 121..161
e-value: 5.7E-4
score: 29.2
IPR001680WD40 repeatPFAMPF00400WD40coord: 78..109
e-value: 0.0045
score: 17.8
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 128..170
score: 12.48
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 76..110
score: 12.113
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 3..350
e-value: 4.5E-126
score: 422.4
IPR015505CoroninPANTHERPTHR10856CORONINcoord: 4..506
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 148..162
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 76..170
score: 17.561
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 55..306