Transcription initiation factor TFIID subunit 7

Overview
NameTranscription initiation factor TFIID subunit 7
Smed IDSMED30005541
Length (bp)933
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription initiation factor TFIID subunit 7 (SMED30005541) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 7 (SMED30005541) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription initiation factor TFIID subunit 7 (SMED30005541) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 7 (SMED30005541) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005541

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30005541h1SMcG0022628 Contig21145newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005541h1SMcG0022628 Contig21145uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005541h1SMcG0022627 Contig21145newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005541h1SMcG0022627 Contig21145uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Human
Match: TAF7 (TATA-box binding protein associated factor 7 [Source:HGNC Symbol;Acc:HGNC:11541])

HSP 1 Score: 115.161 bits (287), Expect = 5.938e-29
Identity = 71/213 (33.33%), Postives = 120/213 (56.34%), Query Frame = 1
Query:  124 FIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQD-AVAGQSLQEGGHLTRLSSQDKLNQLF 735
            FI+RLPP  A+ ++  +      L+D+  I+   + R   +  +   L  +++DLPC++E LK++D+KTFYK+ DI Q+++ + +    P ++ P+ + + +   K+ +       +N G+T PLKNVR +RFRKT KKK ++  +VE+EVK+L+  D  A    WE++  DE   A    N G D +  G S    GH +     D+L ++F
Sbjct:   16 FILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEA---ENQGLDISSPGMSGHRQGHDSL--EHDELREIF 223          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Human
Match: TAF7L (TATA-box binding protein associated factor 7 like [Source:HGNC Symbol;Acc:HGNC:11548])

HSP 1 Score: 105.531 bits (262), Expect = 3.042e-25
Identity = 75/228 (32.89%), Postives = 119/228 (52.19%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQN-DIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKK----KTM------DWME---VEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANL-GQDAVAGQSLQEGGHLTRLSSQDKLNQLFG 738
             FI+RLP   A  ++N     S  ++DK  I    + R A +  E+  L  +++DLPC++E L++LD+KTFYK+ DI Q+++C+ +       + P  + +   + K+ +       +  G+TPPLKNVR KRFRKT KK    K M      +++E   VE EVK+L+R D  A    WE++  D         ++ G    +G S  + GH +  S  D L ++F 
Sbjct:   15 QFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTS--SEYDMLREMFS 240          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Human
Match: TAF7L (TATA-box binding protein associated factor 7 like [Source:HGNC Symbol;Acc:HGNC:11548])

HSP 1 Score: 102.834 bits (255), Expect = 8.137e-25
Identity = 71/217 (32.72%), Postives = 114/217 (52.53%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQN-DIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKK----KTM------DWME---VEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANL-GQDAVAGQSLQEGGHLTRL 705
             FI+RLP   A  ++N     S  ++DK  I    + R A +  E+  L  +++DLPC++E L++LD+KTFYK+ DI Q+++C+ +       + P  + +   + K+ +       +  G+TPPLKNVR KRFRKT KK    K M      +++E   VE EVK+L+R D  A    WE++  D         ++ G    +G S  + GH + +
Sbjct:   15 QFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSV 231          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Human
Match: TAF7L (TATA-box binding protein associated factor 7 like [Source:HGNC Symbol;Acc:HGNC:11548])

HSP 1 Score: 105.145 bits (261), Expect = 8.559e-25
Identity = 72/228 (31.58%), Postives = 117/228 (51.32%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQN-DIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKK-------------KTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANL-GQDAVAGQSLQEGGHLTRLSSQDKLNQLFG 738
             FI+RLP   A  ++N     S  ++DK  I    + R A +  E+  L  +++DLPC++E L++LD+KTFYK+ DI Q+++C+ +       + P  + +   + K+ +       +  G+TPPLKNVR KRFRKT KK             + ++  +VE EVK+L+R D  A    WE++  D         ++ G    +G S  + GH +  S  D L ++F 
Sbjct:  101 QFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTS--SEYDMLREMFS 326          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Celegans
Match: taf-7.2 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:Q9NEW8])

HSP 1 Score: 97.4413 bits (241), Expect = 1.054e-23
Identity = 63/171 (36.84%), Postives = 106/171 (61.99%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNK-SSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAA 630
            H ++R+P +   +++  I  S+   ++F +  + + R + +   N+LL+G+I+DLP I E+ K+LD K+ YK  D+ QI++C+ +  +S+                KQ Q+  GLTPP+K+ R KRFRKT KKK MD  EVE+E+K+L+R DL A+ V+WE++  +++ A 
Sbjct:   38 HIVLRVPEDCVGRIEKIIQ-SDGKHEEFSLNLNSDARNSTVRIGNQLLNGKILDLPTITEIHKTLDNKSLYKVADVSQILVCTHDSINSIASSSEDAAQKAAAAKAKQWQYPHGLTPPMKSARKKRFRKTKKKKFMDAPEVEKELKRLLRADLEADSVKWEIVEGNKEGAT 207          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Celegans
Match: taf-7.1 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:Q20788])

HSP 1 Score: 86.6557 bits (213), Expect = 1.135e-19
Identity = 62/198 (31.31%), Postives = 105/198 (53.03%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLD--------------------------------KQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDE 618
            H I+R+PP++  +++  ++  E   ++  I F E+ R  +I   N++L  +I+DLP I E+ K+LD  T YK  D+ Q++IC   + ++P  K     LN E ++                                K++ +  G+TPP+KN + +RFRK  +KKTM   E+E E+K+L+R DL A+ V W+++  DE
Sbjct:   26 HLILRVPPDVVNRMEKAVN-GEIDAEELGINFQEDNRTVQIRLGNQILPAKILDLPTINEVHKTLDNSTLYKVTDVSQMIIC---EGAMPIPKAERKKLNPEGIENREPKIEVEGSGVENKTNVQSKTARQLAKEKVKEYHYPHGITPPMKNAKKRRFRKKKEKKTMAVEEIEIELKRLLRSDLEAQSVRWKVVDDDE 219          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Fly
Match: Taf7 (gene:FBgn0024909 transcript:FBtr0114520)

HSP 1 Score: 122.094 bits (305), Expect = 2.815e-31
Identity = 64/164 (39.02%), Postives = 105/164 (64.02%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIK--FPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELL 606
             FIMR+P  +A  +   I+    ++D+  IQ D + R  E+  ++++L+ +++DLP +VE  K++D K+FYKS DI QI+IC + +    E +        +   +DK++ F  G+TPP KNVR +RFRKTLKKK ++  E+E+EVK L+R D  A +V++E++
Sbjct:   26 QFIMRVPKELADTVHEAINAG-TIKDRLTIQLDPDLRYGEVRIDDQILYTKLVDLPTVVESYKTIDNKSFYKSADICQILICKEEREDETEKESPNKNKKKDPNKVDKKYLFPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEII 188          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Fly
Match: Taf7 (gene:FBgn0024909 transcript:FBtr0081756)

HSP 1 Score: 121.709 bits (304), Expect = 6.029e-31
Identity = 64/164 (39.02%), Postives = 105/164 (64.02%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIK--FPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELL 606
             FIMR+P  +A  +   I+    ++D+  IQ D + R  E+  ++++L+ +++DLP +VE  K++D K+FYKS DI QI+IC + +    E +        +   +DK++ F  G+TPP KNVR +RFRKTLKKK ++  E+E+EVK L+R D  A +V++E++
Sbjct:   58 QFIMRVPKELADTVHEAINAG-TIKDRLTIQLDPDLRYGEVRIDDQILYTKLVDLPTVVESYKTIDNKSFYKSADICQILICKEEREDETEKESPNKNKKKDPNKVDKKYLFPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEII 220          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Zebrafish
Match: taf7 (TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-020419-18])

HSP 1 Score: 109.768 bits (273), Expect = 4.473e-27
Identity = 61/173 (35.26%), Postives = 101/173 (58.38%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDE 618
             FI+RLP   A+ ++     S   ++D+  I+   + R   +  +   L  +++DLPCI+E LK++D+KTFYK+ DI Q+++C+ +    P ++ P    + ++  K         +N G+T PLKN R +RFRKT KKK ++  +VE+EVK+L+  D  A  V WE++  DE
Sbjct:   25 QFILRLPQEYASTVRRIAQSSSMNMKDRLTIELHADGRHGIVRVDRVPLACKLVDLPCILESLKTVDKKTFYKTADICQMLVCTLDGDLYPPLEEPTGTTDSKSKKKDKDKDKKFVWNHGITLPLKNTRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSVRWEVIAEDE 197          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Zebrafish
Match: taf7 (TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-020419-18])

HSP 1 Score: 109.768 bits (273), Expect = 4.473e-27
Identity = 61/173 (35.26%), Postives = 101/173 (58.38%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDE 618
             FI+RLP   A+ ++     S   ++D+  I+   + R   +  +   L  +++DLPCI+E LK++D+KTFYK+ DI Q+++C+ +    P ++ P    + ++  K         +N G+T PLKN R +RFRKT KKK ++  +VE+EVK+L+  D  A  V WE++  DE
Sbjct:   25 QFILRLPQEYASTVRRIAQSSSMNMKDRLTIELHADGRHGIVRVDRVPLACKLVDLPCILESLKTVDKKTFYKTADICQMLVCTLDGDLYPPLEEPTGTTDSKSKKKDKDKDKKFVWNHGITLPLKNTRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSVRWEVIAEDE 197          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Xenopus
Match: fgf20 (fibroblast growth factor 20 [Source:Xenbase;Acc:XB-GENE-481880])

HSP 1 Score: 117.472 bits (293), Expect = 6.080e-30
Identity = 71/214 (33.18%), Postives = 120/214 (56.07%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDL-SEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANL-GQDAVAGQSLQEGGHLTRLSSQDKLNQLF 735
             FI+RLP   A+ ++  +   S   +D+  ++   + R   +  +   L  +++D+PC+VE LK++D+KT YK+ DI Q+++C+ +    P ++ P    + +   K+ +       +N G+TPPLKNVR +RFRKT KKK ++  +VE+EVK+L+  D  A  V WE++  DE   A    NL G D   G S  + G  +    +++L Q+F
Sbjct:   23 QFILRLPQEYASTVRRMVQSGSVNTKDRLSVELHPDGRHGIVRVDRVPLAAKLVDIPCVVECLKTIDKKTCYKTADICQMLVCTLDGDLYPPLEEPTGTSDPKASKKKDRDREKKFIWNHGITPPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSVRWEVIAEDESKEA---ENLTGLDVSPGMSGIKQGRGSSAVEREELRQIF 233          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Xenopus
Match: fgf20 (fibroblast growth factor 20 [Source:Xenbase;Acc:XB-GENE-481880])

HSP 1 Score: 117.472 bits (293), Expect = 8.167e-30
Identity = 71/214 (33.18%), Postives = 120/214 (56.07%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDL-SEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANL-GQDAVAGQSLQEGGHLTRLSSQDKLNQLF 735
             FI+RLP   A+ ++  +   S   +D+  ++   + R   +  +   L  +++D+PC+VE LK++D+KT YK+ DI Q+++C+ +    P ++ P    + +   K+ +       +N G+TPPLKNVR +RFRKT KKK ++  +VE+EVK+L+  D  A  V WE++  DE   A    NL G D   G S  + G  +    +++L Q+F
Sbjct:   22 QFILRLPQEYASTVRRMVQSGSVNTKDRLSVELHPDGRHGIVRVDRVPLAAKLVDIPCVVECLKTIDKKTCYKTADICQMLVCTLDGDLYPPLEEPTGTSDPKASKKKDRDREKKFIWNHGITPPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSVRWEVIAEDESKEA---ENLTGLDVSPGMSGIKQGRGSSAVEREELRQIF 232          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Mouse
Match: Taf7 (TATA-box binding protein associated factor 7 [Source:MGI Symbol;Acc:MGI:1346348])

HSP 1 Score: 110.538 bits (275), Expect = 1.846e-27
Identity = 70/213 (32.86%), Postives = 114/213 (53.52%), Query Frame = 1
Query:  124 FIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQD-AVAGQSLQEGGHLTRLSSQDKLNQLF 735
            FI+RLPP  A  ++  +      L+DK  I+   + R   +  +   L  +++DLPC+ E LK++D+KTFYK+ DI Q+++ + +    P ++      + +   K+ +       +N G+T PLKNVR +RFRKT KKK ++  +VE+EVK+L+  D  A    WE++  DE        N G D +  G S    GH +     D+L ++F
Sbjct:   16 FILRLPPEYAATVRRAVQSGHVNLKDKLSIELHPDGRHGIVRVDRVPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEAAATADPKANKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDE---TKETENQGLDISSPGMSGHRQGHDSL--EHDELREIF 223          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Mouse
Match: Taf7l2 (Taf7l2 [Source:MGI Symbol;Acc:MGI:6274337])

HSP 1 Score: 106.301 bits (264), Expect = 8.685e-26
Identity = 64/189 (33.86%), Postives = 102/189 (53.97%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDI-DLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQN----KSSLPEIKFPIHAL---NQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKT------------MDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVA 627
             FI+RLPP  A+ ++  I   +  + +K  I    + R+A +  +   L  +++DLPC++  LK+ D KTFYK+ D+ Q+++CS +     +S  E      A    N++  + ++ +  G+TPPLKNVR KRFRK  KK              +D  +VE+EVK+L+R D  A    WE++  DE  A
Sbjct:   15 QFILRLPPEQASAVRKIIRSGNAAMREKLKIDLSPDSRRAVVQVDGVSLSAKLVDLPCVIGSLKTHDGKTFYKTADVSQMLLCSADDGDPHTSPEEPATSAGATVVGNKKEAEGKYIWKHGITPPLKNVRKKRFRKPTKKPADMKQGEESCRAYIDSKDVEKEVKRLLRSDAEAISSRWEVVVDDETKA 203          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Mouse
Match: Taf7l (TATA-box binding protein associated factor 7 like [Source:MGI Symbol;Acc:MGI:1921719])

HSP 1 Score: 90.1225 bits (222), Expect = 9.086e-20
Identity = 77/245 (31.43%), Postives = 125/245 (51.02%), Query Frame = 1
Query:   70 SVNIHMQTAEAEDVDLFHFIMRLPPNIATKLQNDI-DLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLD--------KQHQFNRGLTPPLKNVRAKRFRKTLKK----KTMDWM---------EVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQDAVAGQSLQEGGHLTRLSSQDKLNQLFG 738
            S+++ ++  + E+     FI+RLPP  A  ++  I   +   +DK  I F  +   A +  +N  L  ++++LPC++  LK++DRKTFYK+ D+ Q+++CS         + P+ +     +         K++ +  G+TPPLKNVR KRFRKT KK    K +D +          VE+EVK+L+  D  A  V WE++  D+D A  + +        G S Q GG    LS  D   ++ G
Sbjct:   96 SMSVRLECHDVEE----QFILRLPPEQAYAVRKIIHSRNAAWKDKLKIDFSPDGHHAVVQVDNVSLPAKLVNLPCVIGSLKTIDRKTFYKTADVSQMLVCSPEGEPHSPPEEPVVSTGPTVIGISEGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQSPSVEKEVKRLLYSDAEAVSVRWEVV--DDDDAKEIESQGSMPTTPGIS-QMGG--ASLSDYDVFREMMG 331          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Mouse
Match: Taf7l (TATA-box binding protein associated factor 7 like [Source:MGI Symbol;Acc:MGI:1921719])

HSP 1 Score: 83.1889 bits (204), Expect = 1.360e-17
Identity = 65/215 (30.23%), Postives = 107/215 (49.77%), Query Frame = 1
Query:   97 EAEDVDLFHFIMRLPPNIATKLQNDI-DLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQDAVAGQSLQEGGHLTRLSSQDKLNQLFG 738
            E  DV+   FI+RLPP  A  ++  I   +   +DK  I F  +   A +  +N  L  ++++LPC++  LK++DRKTFYK+ D+ Q+++CS      PE+  P+  + ++   K  +      P +K V    F +  +  +     VE+EVK+L+  D  A  V WE++  D+D A  + +        G S Q GG    LS  D   ++ G
Sbjct:   17 ECHDVEE-QFILRLPPEQAYAVRKIIHSRNAAWKDKLKIDFSPDGHHAVVQVDNVSLPAKLVNLPCVIGSLKTIDRKTFYKTADVSQMLVCS------PEVTPPLKNVRKKRFRKTTK----KLPDVKQVDEINFSEYTQSPS-----VEKEVKRLLYSDAEAVSVRWEVV--DDDDAKEIESQGSMPTTPGIS-QMGG--ASLSDYDVFREMMG 210          
BLAST of Transcription initiation factor TFIID subunit 7 vs. UniProt/SwissProt
Match: sp|Q9VHY5|TAF7_DROME (Transcription initiation factor TFIID subunit 7 OS=Drosophila melanogaster OX=7227 GN=Taf7 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 6.044e-30
Identity = 64/164 (39.02%), Postives = 105/164 (64.02%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIK--FPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELL 606
             FIMR+P  +A  +   I+    ++D+  IQ D + R  E+  ++++L+ +++DLP +VE  K++D K+FYKS DI QI+IC + +    E +        +   +DK++ F  G+TPP KNVR +RFRKTLKKK ++  E+E+EVK L+R D  A +V++E++
Sbjct:   58 QFIMRVPKELADTVHEAINAG-TIKDRLTIQLDPDLRYGEVRIDDQILYTKLVDLPTVVESYKTIDNKSFYKSADICQILICKEEREDETEKESPNKNKKKDPNKVDKKYLFPHGITPPCKNVRKRRFRKTLKKKNVEAPEIEKEVKHLLRIDNEAVRVDYEII 220          
BLAST of Transcription initiation factor TFIID subunit 7 vs. UniProt/SwissProt
Match: sp|Q5R7L9|TAF7_PONAB (Transcription initiation factor TFIID subunit 7 OS=Pongo abelii OX=9601 GN=TAF7 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.852e-28
Identity = 71/213 (33.33%), Postives = 120/213 (56.34%), Query Frame = 1
Query:  124 FIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQD-AVAGQSLQEGGHLTRLSSQDKLNQLF 735
            FI+RLPP  A+ ++  +      L+D+  I+   + R   +  +   L  +++DLPC++E LK++D+KTFYK+ DI Q+++ + +    P ++ P+ + + +   K+ +       +N G+T PLKNVR +RFRKT KKK ++  +VE+EVK+L+  D  A    WE++  DE   A    N G D +  G S    GH +     D+L ++F
Sbjct:   16 FILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEA---ENQGLDISSPGMSGHRQGHDSL--EHDELREIF 223          
BLAST of Transcription initiation factor TFIID subunit 7 vs. UniProt/SwissProt
Match: sp|Q4R5A5|TAF7_MACFA (Transcription initiation factor TFIID subunit 7 OS=Macaca fascicularis OX=9541 GN=TAF7 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.852e-28
Identity = 71/213 (33.33%), Postives = 120/213 (56.34%), Query Frame = 1
Query:  124 FIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQD-AVAGQSLQEGGHLTRLSSQDKLNQLF 735
            FI+RLPP  A+ ++  +      L+D+  I+   + R   +  +   L  +++DLPC++E LK++D+KTFYK+ DI Q+++ + +    P ++ P+ + + +   K+ +       +N G+T PLKNVR +RFRKT KKK ++  +VE+EVK+L+  D  A    WE++  DE   A    N G D +  G S    GH +     D+L ++F
Sbjct:   16 FILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEA---ENQGLDISSPGMSGHRQGHDSL--EHDELREIF 223          
BLAST of Transcription initiation factor TFIID subunit 7 vs. UniProt/SwissProt
Match: sp|Q15545|TAF7_HUMAN (Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.852e-28
Identity = 71/213 (33.33%), Postives = 120/213 (56.34%), Query Frame = 1
Query:  124 FIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQD-AVAGQSLQEGGHLTRLSSQDKLNQLF 735
            FI+RLPP  A+ ++  +      L+D+  I+   + R   +  +   L  +++DLPC++E LK++D+KTFYK+ DI Q+++ + +    P ++ P+ + + +   K+ +       +N G+T PLKNVR +RFRKT KKK ++  +VE+EVK+L+  D  A    WE++  DE   A    N G D +  G S    GH +     D+L ++F
Sbjct:   16 FILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEA---ENQGLDISSPGMSGHRQGHDSL--EHDELREIF 223          
BLAST of Transcription initiation factor TFIID subunit 7 vs. UniProt/SwissProt
Match: sp|Q6R1L1|TAF7_CRIGR (Transcription initiation factor TFIID subunit 7 OS=Cricetulus griseus OX=10029 GN=TAF7 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 9.160e-28
Identity = 70/214 (32.71%), Postives = 118/214 (55.14%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQD-AVAGQSLQEGGHLTRLSSQDKLNQLF 735
             FI+RLPP  A+ ++  +      L+D+  I+   + R   +  +   L  +++DLPC++E LK++D+KTFYK+ DI Q+++ + +    P ++ P+   + +   K+ +       +N G+T PLKNVR +RFRKT KKK ++  +VE+EVK+L+  D  A    WE++  DE        N G D +  G S    GH +     D+L ++F
Sbjct:   15 QFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLAAKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVAPADPKASKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDE---TKETENQGLDISSPGMSGHRQGHDSL--EHDELREIF 223          
BLAST of Transcription initiation factor TFIID subunit 7 vs. TrEMBL
Match: A0A210QE85 (Transcription initiation factor TFIID subunit 7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12524 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.869e-39
Identity = 83/207 (40.10%), Postives = 124/207 (59.90%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDL-SEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQDAVAGQSLQEGGHLTRLSSQDKLNQLFG 738
             FI+RLPP  +  L+ D+   S  ++DKF I+   + R   + Y NELL+G++MDLPCI+E  K++D KTFYK+ DI QI+ICS       + +       +++ +K++ +  G+TPPLKNVR +RFRKTLKKK M+  ++E+EVK+L R D  A  V+WE++  +ED   A +   GQ  + G    + G   + S       LFG
Sbjct:   23 QFILRLPPGPSMALRRDVQAGSLTMKDKFSIEVQPDHRHCVVRYGNELLYGKLMDLPCIIESHKTVDMKTFYKTADISQILICSYTDEETSQDENESPKKKEKDKNKKYHYPHGVTPPLKNVRKRRFRKTLKKKYMEQPDIEKEVKRLFRTDAEAINVKWEII-VEEDKPTADSNGQGQTTMEGWVGGQSGQWNQNSGGLDYGNLFG 228          
BLAST of Transcription initiation factor TFIID subunit 7 vs. TrEMBL
Match: A0A5S6QIB7 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.881e-36
Identity = 74/183 (40.44%), Postives = 112/183 (61.20%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLP----EIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQD 657
            HFI+RLP + A  L + ++    L D+  I  D + R  ++ + N  +H  + DLPCIVE LK+ D+KTFYK+ D+ Q+++C +  +  P    E   P      +  +KQHQ+  G+TPPLKNVR +RFRKTL+KK MD  E+E+E+K+L+R D+ A  ++WE++   E+V    N N   D
Sbjct:   25 HFILRLPSDAAESLSSLLN-DGMLVDELQINLDSDMRSGKVKFGNREMHASLDDLPCIVETLKTTDKKTFYKAADVAQLLVCREGPAEPPADSEECSDP------KKREKQHQWPHGITPPLKNVRKRRFRKTLRKKYMDAPELEKELKRLLRADIEAASIKWEIVSIQEEVKQKANMNEALD 200          
BLAST of Transcription initiation factor TFIID subunit 7 vs. TrEMBL
Match: A0A3L8DL12 (TAFII55_N domain-containing protein OS=Ooceraea biroi OX=2015173 GN=DMN91_005480 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 8.365e-36
Identity = 77/196 (39.29%), Postives = 124/196 (63.27%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMIC-SQNKSSLPEIKFPIHALNQE--NLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDED------VAAAMNANLGQDAVAGQSLQ 681
             F+MRLPP  A  L+  +  S PL+D+  I+ + + R  E+  ++ LLH ++MDLP IVE LK++D K+FYK+ DI QI+IC  ++  S  + + P+    ++   +DK+  +  G+TPP KNVR +RFRKTLKKK ++  E+E+EVK+L+R D  A  V+WE++  DED      V+++      ++++ G + Q
Sbjct:   14 QFVMRLPPEPAKILREALRSSLPLKDRLTIKLENDMRYGEVRVDHWLLHAKVMDLPTIVESLKTIDNKSFYKTADICQIVICKEEDDPSATDEESPVKQKKKDPNKVDKKFLWPHGVTPPTKNVRRRRFRKTLKKKYVEAPEIEKEVKRLLRVDNDAVNVKWEVICEDEDQSKPSKVSSSGTVKTKRESINGNTSQ 209          
BLAST of Transcription initiation factor TFIID subunit 7 vs. TrEMBL
Match: K7JNJ1 (TAFII55_N domain-containing protein OS=Nasonia vitripennis OX=7425 GN=100678359 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.535e-35
Identity = 73/200 (36.50%), Postives = 121/200 (60.50%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQ---NKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDED------VAAAMNANLGQDAVAGQSLQEGGH 693
             F+MRLPP  A  L+  +    PL+D+  ++ + + R  E+ +++ LLHGR++DLP I+E +K++D K+FYK+ DI Q++IC +     ++  E +      +   +DK+     G+TPPLKNVR KRFRKTL+KK ++  E+E+EV++L+R+D  A  V WE++  DED      V+++      ++    QS+    H
Sbjct:   22 QFVMRLPPEPAKVLRETLQSGLPLKDRLSVKLENDLRYGEVRFDHWLLHGRVVDLPTIIESMKTIDNKSFYKTADICQLLICKEEDDQTTTDEESQVKQKKKDPTKVDKKFLCPHGITPPLKNVRKKRFRKTLRKKYVEAPEIEKEVRRLLRNDNEAANVRWEVICEDEDQTKPNIVSSSGTVQTKRENDTSQSVDVAEH 221          
BLAST of Transcription initiation factor TFIID subunit 7 vs. TrEMBL
Match: A0A183V920 (TAFII55_N domain-containing protein OS=Toxocara canis OX=6265 GN=TCNE_LOCUS17241 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.284e-35
Identity = 74/194 (38.14%), Postives = 114/194 (58.76%), Query Frame = 1
Query:   28 SFKL*KKYIFKNFFSVNIHMQTAEAEDVDLFHFIMRLPPNIATKLQ--NDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWEL 603
            S KL  K++ ++       MQ  E       H I+R P +IA ++       + E  E++  I+F  + R A + +   ++ GRI DLPC+ E++K++D+K  YK  D+ QIMICS    + P       A   ++ DK +Q+  GLTPP+KNVR KRFRKT+KKK +D  E+ERE++ L+R+D+ A+ V WE+
Sbjct:    5 SSKLLAKHVPRHLADAAERMQEWEN------HIIIRFPEDIAEQIGIFAGKVVDESREERLAIRFSPDLRNANVRFGENVMSGRIYDLPCVSEVMKTIDKKNVYKVADVSQIMICSHTADTAPRCSSSKLASETKD-DKAYQWPHGLTPPMKNVRKKRFRKTIKKKYVDVPEIERELRMLLRNDVAADSVHWEV 191          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Cavefish
Match: taf7 (TATA-box binding protein associated factor 7 like [Source:NCBI gene;Acc:103026206])

HSP 1 Score: 112.849 bits (281), Expect = 2.952e-28
Identity = 73/215 (33.95%), Postives = 119/215 (55.35%), Query Frame = 1
Query:  121 HFIMRLPPNIATKL-QNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQ-DAVAGQSLQEGGHLTRLSS--QDKLNQLF 735
             FI+RLP   A+ + Q     S  ++D+  I+   + R   +  +   L  +++DLPCI+E LK++D+KTFYK+ D+ Q+++C+ +    P ++ P    + ++  K         +N G+T PLKN + +RFRKT KKK ++  +VE+EVK+L+  D  A  V WE++  DE   A  N +L   D+  G S    GH    SS   D+L ++F
Sbjct:   24 QFILRLPQEYASTVRQIAGSGSMNIKDRLTIELHADGRHGIVRVDRVPLACKLVDLPCILESLKTVDKKTFYKTADLCQMLVCTLDGDLYPPLEEPTGTADSKSKKKDKDKDKKFVWNHGITCPLKNTKKRRFRKTAKKKYIESPDVEKEVKRLLSTDSEAVSVRWEVIAEDESKEADNNLSLSNLDSSPGTS----GHKGHGSSVPHDELREIF 234          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Cavefish
Match: taf7 (TATA-box binding protein associated factor 7 like [Source:NCBI gene;Acc:103026206])

HSP 1 Score: 112.849 bits (281), Expect = 7.006e-28
Identity = 73/214 (34.11%), Postives = 119/214 (55.61%), Query Frame = 1
Query:  124 FIMRLPPNIATKL-QNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ------FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQ-DAVAGQSLQEGGHLTRLSS--QDKLNQLF 735
            FI+RLP   A+ + Q     S  ++D+  I+   + R   +  +   L  +++DLPCI+E LK++D+KTFYK+ D+ Q+++C+ +    P ++ P    + ++  K         +N G+T PLKN + +RFRKT KKK ++  +VE+EVK+L+  D  A  V WE++  DE   A  N +L   D+  G S    GH    SS   D+L ++F
Sbjct:   25 FILRLPQEYASTVRQIAGSGSMNIKDRLTIELHADGRHGIVRVDRVPLACKLVDLPCILESLKTVDKKTFYKTADLCQMLVCTLDGDLYPPLEEPTGTADSKSKKKDKDKDKKFVWNHGITCPLKNTKKRRFRKTAKKKYIESPDVEKEVKRLLSTDSEAVSVRWEVIAEDESKEADNNLSLSNLDSSPGTS----GHKGHGSSVPHDELREIF 234          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Yeast
Match: TAF7 (TFIID subunit (67 kDa); involved in RNA polymerase II transcription initiation [Source:SGD;Acc:S000004840])

HSP 1 Score: 63.1586 bits (152), Expect = 1.467e-11
Identity = 45/169 (26.63%), Postives = 82/169 (48.52%), Query Frame = 1
Query:  223 NRRQAEIVYENELLHGRIM-DLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQH----------------------------------------QFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELL 606
            N R A +V  N++++G I+ DLP ++E+ KS+DRK   K+ D+ Q+++C +      E+ + + A + E+L  +H                                         +  G++PPL NVR +RFR+ +    +D+  VE+ V  L++ D  AE+V ++L+
Sbjct:  147 NERHA-VVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIRPIQEEEEV-YALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEIDY--VEKVVDMLLKQDKQAEEVSYDLV 311          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Nematostella
Match: EDO35404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ3])

HSP 1 Score: 119.013 bits (297), Expect = 6.934e-32
Identity = 71/198 (35.86%), Postives = 116/198 (58.59%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICS-QNKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQDA-------VAGQSLQEGG 690
             F++RLP   A  ++  +     +++K  I+F  + R A +   +E L  +++DLPC++E  K+ D K+FYK+ DI Q+++C+ +++ S  E +   H   +    K+  +N G+TPPLKNVR +RFRK  KKK  +  E+E+EVK+L+R DL A KV +E++  DE+       NL  DA       V+ + L +GG
Sbjct:   15 QFVLRLPKKQADAVKKYVSGGS-IKEKLSIEFQADYRHATVRVGDEALSAKLVDLPCVMETHKTFDDKSFYKTADICQMLLCTDEDQDSQSEDEDQRHHKRES---KKFVWNHGITPPLKNVRKRRFRKIAKKKVSESPEIEKEVKRLLRTDLSAAKVTFEVI-NDEEKPDDSKKNLPTDADLASASGVSPRVLSKGG 207          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Medaka
Match: taf7 (TATA-box binding protein associated factor 7 like [Source:NCBI gene;Acc:101165566])

HSP 1 Score: 124.79 bits (312), Expect = 1.057e-32
Identity = 71/213 (33.33%), Postives = 121/213 (56.81%), Query Frame = 1
Query:  121 HFIMRLPPNIATKLQNDIDLSE-PLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQ-----FNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQ-DAVAGQSLQEGGHLTRLSSQDKLNQLFG 738
             FI+RLPP  A+ ++     S   ++D+  I+   + R   +  +   L  +++DLPC++E LK++D+KTFYK+ DI Q+++C+ +    P ++ P     +     + +     +N G+T PLKN R +RFRKT KKK ++  +VE+EVK+L+  D  A  V WE++  DE   A  N++L   D+  G S  + GH + +   D+L ++F 
Sbjct:   25 QFILRLPPEYASTVRRIAQSSSMNMKDRLTIELHPDGRHGIVRVDRVPLACKLVDLPCMIESLKTVDKKTFYKTADICQMLVCTLDGDLYPPLEEPTGTDPKSKKKDKDKDKKFIWNHGITCPLKNTRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSVRWEVIAEDESKEADQNSSLANLDSSPGTSGHKMGHGSSV-PHDELREIFN 236          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Planmine SMEST
Match: SMESG000037101.1 (SMESG000037101.1)

HSP 1 Score: 460.685 bits (1184), Expect = 1.315e-165
Identity = 246/248 (99.19%), Postives = 246/248 (99.19%), Query Frame = 1
Query:   85 MQTAEAEDVDLFHFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQDAVAGQSLQEGGHLTRLSSQDKLNQLFGXXXXXXXXXXXXXXXXXXXRDALPAKETIG 828
            MQTAEAEDVDLFHFIMRLP NIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQDAVAGQSLQEGGHLTRLSSQDKLNQLFGELSDSEEDEEEELDDPDSSRDALP KETIG
Sbjct:    1 MQTAEAEDVDLFHFIMRLPLNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQDAVAGQSLQEGGHLTRLSSQDKLNQLFGELSDSEEDEEEELDDPDSSRDALPVKETIG 248          
BLAST of Transcription initiation factor TFIID subunit 7 vs. Planmine SMEST
Match: SMESG000020156.1 (SMESG000020156.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.250e-14
Identity = 49/173 (28.32%), Postives = 86/173 (49.71%), Query Frame = 1
Query:  103 EDVDLFHFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQAEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSSLPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWMEVEREVKKLIRDDLLAEKVEWELLYTDED 621
            E +DL H I+RLP ++A  L  D+     L +K  +      R A I Y++E L G I++LP  V  LK+ + + F    +I  +++  +N             +N +  +K+     G+ PP+KNV   R+RK  K +++  ME    VK ++ +D  AE   ++++   +D
Sbjct:    8 EKIDLDHVILRLPEHLAESLNKDLSECVKLHNKLSLTVCSETRSALINYKDEELKGMILNLPNEVSTLKTTNNEIFTNLLNIKHMIMIDEN-------------INPQKYNKKFVLRDGIAPPMKNVNLMRYRKLKKNQSIKMMEF---VKGMLSEDSKAESTWYKMMDKSDD 164          
The following BLAST results are available for this feature:
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TAF75.938e-2933.33TATA-box binding protein associated factor 7 [Sour... [more]
TAF7L3.042e-2532.89TATA-box binding protein associated factor 7 like ... [more]
TAF7L8.137e-2532.72TATA-box binding protein associated factor 7 like ... [more]
TAF7L8.559e-2531.58TATA-box binding protein associated factor 7 like ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf-7.21.054e-2336.84TAF (TBP-associated transcription factor) family ... [more]
taf-7.11.135e-1931.31TAF (TBP-associated transcription factor) family ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Taf72.815e-3139.02gene:FBgn0024909 transcript:FBtr0114520[more]
Taf76.029e-3139.02gene:FBgn0024909 transcript:FBtr0081756[more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf74.473e-2735.26TAF7 RNA polymerase II, TATA box binding protein (... [more]
taf74.473e-2735.26TAF7 RNA polymerase II, TATA box binding protein (... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fgf206.080e-3033.18fibroblast growth factor 20 [Source:Xenbase;Acc:XB... [more]
fgf208.167e-3033.18fibroblast growth factor 20 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Taf71.846e-2732.86TATA-box binding protein associated factor 7 [Sour... [more]
Taf7l28.685e-2633.86Taf7l2 [Source:MGI Symbol;Acc:MGI:6274337][more]
Taf7l9.086e-2031.43TATA-box binding protein associated factor 7 like ... [more]
Taf7l1.360e-1730.23TATA-box binding protein associated factor 7 like ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VHY5|TAF7_DROME6.044e-3039.02Transcription initiation factor TFIID subunit 7 OS... [more]
sp|Q5R7L9|TAF7_PONAB2.852e-2833.33Transcription initiation factor TFIID subunit 7 OS... [more]
sp|Q4R5A5|TAF7_MACFA2.852e-2833.33Transcription initiation factor TFIID subunit 7 OS... [more]
sp|Q15545|TAF7_HUMAN2.852e-2833.33Transcription initiation factor TFIID subunit 7 OS... [more]
sp|Q6R1L1|TAF7_CRIGR9.160e-2832.71Transcription initiation factor TFIID subunit 7 OS... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QE851.869e-3940.10Transcription initiation factor TFIID subunit 7 OS... [more]
A0A5S6QIB71.881e-3640.44Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A3L8DL128.365e-3639.29TAFII55_N domain-containing protein OS=Ooceraea bi... [more]
K7JNJ11.535e-3536.50TAFII55_N domain-containing protein OS=Nasonia vit... [more]
A0A183V9202.284e-3538.14TAFII55_N domain-containing protein OS=Toxocara ca... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf72.952e-2833.95TATA-box binding protein associated factor 7 like ... [more]
taf77.006e-2834.11TATA-box binding protein associated factor 7 like ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAF71.467e-1126.63TFIID subunit (67 kDa); involved in RNA polymerase... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO354046.934e-3235.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf71.057e-3233.33TATA-box binding protein associated factor 7 like ... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000037101.11.315e-16599.19SMESG000037101.1[more]
SMESG000020156.11.250e-1428.32SMESG000020156.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005541 ID=SMED30005541|Name=Transcription initiation factor TFIID subunit 7|organism=Schmidtea mediterranea sexual|type=transcript|length=933bp
TTTAATATTAGTCGTTTAGTTTTACTTTCATTTAAATTATAAAAAAAATA
TATTTTTAAAAATTTTTTTTCTGTTAACATACATATGCAAACTGCAGAAG
CTGAAGATGTAGATTTATTTCATTTTATTATGCGATTACCTCCCAATATT
GCTACGAAATTACAAAATGATATCGATTTATCAGAACCTCTTGAAGATAA
GTTCTTTATTCAATTTGATGAAAATAGAAGGCAAGCGGAAATAGTCTATG
AAAATGAATTGCTTCATGGCAGGATAATGGATTTACCTTGTATCGTAGAA
ATGCTGAAATCTCTCGACAGGAAAACATTTTATAAATCCGGAGACATTGG
ACAAATAATGATTTGTTCCCAGAATAAGTCGTCGCTGCCAGAGATTAAGT
TTCCAATTCACGCTCTCAATCAGGAAAACCTCGACAAGCAGCACCAATTC
AACAGAGGCCTGACGCCGCCATTGAAGAATGTGCGCGCCAAGCGATTCAG
GAAAACTCTCAAGAAAAAAACGATGGACTGGATGGAAGTGGAAAGAGAGG
TGAAGAAATTGATCCGTGATGATTTGCTTGCGGAAAAGGTCGAGTGGGAA
CTGCTGTACACAGATGAGGATGTTGCTGCCGCTATGAATGCCAATCTGGG
CCAGGACGCTGTTGCAGGGCAATCTCTGCAGGAGGGGGGCCATTTGACCC
GGCTGTCCAGTCAAGACAAACTCAATCAGCTATTCGGGGAACTCAGTGAC
AGCGAGGAGGACGAGGAGGAGGAGCTAGATGATCCCGACAGCAGCCGTGA
TGCCCTTCCTGCCAAGGAGACGATTGGATGACTTTATGTTGTGGAATAAA
TGATTTGTTGTTCTCTTGATTTGGGGCCCTCGTTGGTGTTGTCGCACGCT
CACCTTTGCTTGGTTGCTAGTGGTTACTCGCCG
back to top

protein sequence of SMED30005541-orf-1

>SMED30005541-orf-1 ID=SMED30005541-orf-1|Name=SMED30005541-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MQTAEAEDVDLFHFIMRLPPNIATKLQNDIDLSEPLEDKFFIQFDENRRQ
AEIVYENELLHGRIMDLPCIVEMLKSLDRKTFYKSGDIGQIMICSQNKSS
LPEIKFPIHALNQENLDKQHQFNRGLTPPLKNVRAKRFRKTLKKKTMDWM
EVEREVKKLIRDDLLAEKVEWELLYTDEDVAAAMNANLGQDAVAGQSLQE
GGHLTRLSSQDKLNQLFGELSDSEEDEEEELDDPDSSRDALPAKETIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR037817TAF7
IPR006751TAFII55_prot_cons_reg
Vocabulary: biological process
TermDefinition
GO:0006367transcription initiation from RNA polymerase II promoter
GO:0006413translational initiation
Vocabulary: cellular component
TermDefinition
GO:0005669transcription factor TFIID complex
Vocabulary: molecular function
TermDefinition
GO:0003743translation initiation factor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006751TAFII55 protein, conserved regionSMARTSM01370TAFII55_N_2coord: 13..168
e-value: 2.0E-49
score: 180.2
IPR006751TAFII55 protein, conserved regionPFAMPF04658TAFII55_Ncoord: 13..166
e-value: 9.7E-43
score: 145.7
IPR006751TAFII55 protein, conserved regionCDDcd08047TAF7coord: 13..173
e-value: 3.67429E-51
score: 162.438
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 220..235
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 215..248
IPR037817Transcription initiation factor TFIID subunit 7PANTHERPTHR12228TRANSCRIPTION INITIATION FACTOR TFIID 55 KD SUBUNIT-RELATEDcoord: 13..237