Thyrotropin-releasing hormone receptor

Overview
NameThyrotropin-releasing hormone receptor
Smed IDSMED30005527
Length (bp)1065
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thyrotropin-releasing hormone receptor (SMED30005527) t-SNE clustered cells

Violin plots show distribution of expression levels for Thyrotropin-releasing hormone receptor (SMED30005527) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thyrotropin-releasing hormone receptor (SMED30005527) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thyrotropin-releasing hormone receptor (SMED30005527) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005527

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005527 dd_Smed_v4_17120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005527 dd_Smed_v4_17120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005527 dd_Smed_v4_17120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Human
Match: TRHR (thyrotropin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:12299])

HSP 1 Score: 176.407 bits (446), Expect = 3.706e-51
Identity = 127/303 (41.91%), Postives = 183/303 (60.40%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF--------------------QSSMRRSIGSSDR----NRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    LY M+W +L       + ++++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF                      +   ++ +S+R       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVI--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Human
Match: TRHR (thyrotropin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:12299])

HSP 1 Score: 176.407 bits (446), Expect = 3.706e-51
Identity = 127/303 (41.91%), Postives = 183/303 (60.40%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF--------------------QSSMRRSIGSSDR----NRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    LY M+W +L       + ++++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF                      +   ++ +S+R       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVI--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Human
Match: BRS3 (bombesin receptor subtype 3 [Source:HGNC Symbol;Acc:HGNC:1113])

HSP 1 Score: 83.5741 bits (205), Expect = 3.807e-17
Identity = 82/290 (28.28%), Postives = 152/290 (52.41%), Query Frame = 3
Query:  150 LTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCT-FRLHRKYYKAIY-MSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRK---SRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYED-----YWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKIL 989
            ++VG +GNA++I V  ++ +M T  N ++ SLA  D+ LL+  V  + T ++   + W  G   C +L F++      S  ++T  S +R+ A+  P++ +    I +  +   C+W    ++ +     ++  T R PN  M++E CT + + +K  + I+ +   ++FY +PL II V Y  I   L++S++          RK   SR ++ + ++V+V LF + WLP   L +Y+SF+ + Y D     + F +F+R +   NS +NP     +S+ F++ FK  L
Sbjct:   58 ISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYL--AEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQL 345          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Human
Match: OPRK1 (opioid receptor kappa 1 [Source:HGNC Symbol;Acc:HGNC:8154])

HSP 1 Score: 79.7221 bits (195), Expect = 5.557e-16
Identity = 90/287 (31.36%), Postives = 148/287 (51.57%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLP--NITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYK--AIYMSDIILFYF---LPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVY----NSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKK 983
            VG VGN++V+ V+ R + M T TN Y+ +LA+AD   L+ T +P  +    MN    W  G  LC I++ + YY   TS  ++T  S++R++A+C P+KA    T  +A+II ICIW       +  + L  TK +   + +    +C+ +     Y    ++M  I +F F   +P++II V Y   +M+L   S+R   GS +++R  R     +L+VV +  V     +  ++V      S S  A   Y+F +    +   NS++NPILY  + E F+R F+ 
Sbjct:   72 VGLVGNSLVMFVIIRYTKMKTATNIYIFNLALAD--ALVTTTMPFQSTVYLMN---SWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVI----ECSLQFPDDDYSWWDLFMK-ICVFIFAFVIPVLIIIVCYT--LMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCI---ALGYTNSSLNPILYAFLDENFKRCFRD 343          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Human
Match: OPRK1 (opioid receptor kappa 1 [Source:HGNC Symbol;Acc:HGNC:8154])

HSP 1 Score: 79.7221 bits (195), Expect = 5.557e-16
Identity = 90/287 (31.36%), Postives = 148/287 (51.57%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLP--NITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYK--AIYMSDIILFYF---LPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVY----NSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKK 983
            VG VGN++V+ V+ R + M T TN Y+ +LA+AD   L+ T +P  +    MN    W  G  LC I++ + YY   TS  ++T  S++R++A+C P+KA    T  +A+II ICIW       +  + L  TK +   + +    +C+ +     Y    ++M  I +F F   +P++II V Y   +M+L   S+R   GS +++R  R     +L+VV +  V     +  ++V      S S  A   Y+F +    +   NS++NPILY  + E F+R F+ 
Sbjct:   72 VGLVGNSLVMFVIIRYTKMKTATNIYIFNLALAD--ALVTTTMPFQSTVYLMN---SWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVI----ECSLQFPDDDYSWWDLFMK-ICVFIFAFVIPVLIIIVCYT--LMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCI---ALGYTNSSLNPILYAFLDENFKRCFRD 343          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Celegans
Match: trhr-1 (Thyrotropin-Releasing Hormone Receptor [Source:UniProtKB/TrEMBL;Acc:Q95YD7])

HSP 1 Score: 152.91 bits (385), Expect = 1.267e-42
Identity = 129/334 (38.62%), Postives = 180/334 (53.89%), Query Frame = 3
Query:  105 QPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRK--YYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS-------------------------------SMRRSIGSSDRNR-KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSF---SKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHK 995
            QP+ I L  + S + + +G +GN +VITVV +   M TPTNCYLVSLA +D      ++   +   + P DH+  G+  C +L +L Y   +TSSLSI  F+IER+  IC P KA+T+CT+KRA  II  IW    LY+  WL+LA         S      C+FRL R    YK +++ D +L+Y LP++   ++Y  I + L Q                                S R S  S  RN  K R QV+KML +VV +F V WLPYR +VVYNSF    K ++   W+   ++ +V +N AINPILYN MS +FR +F+ +L K
Sbjct:   29 QPMDITLAFVFSAISV-IGVLGNLLVITVVLKVRGMKTPTNCYLVSLAASDTLFFFASMPHEMMYLLGPNDHYLFGSLGCVLLTYLPYLAMNTSSLSILAFTIERYYGICNPYKARTMCTVKRATCIICGIWIFSMLYHSYWLFLATLIKDDIGTS------CSFRLERNSHAYKIVFLLDFVLWYVLPIMCDIIIYAKIGITLSQCGDKIKKSVKPKIPNEVIVEKSKTSSTSMGHYSGRDSHISGKRNSAKGRNQVVKMLAIVVAVFAVCWLPYRGMVVYNSFVSDPKYSWSPDWYINLSKTLVFINCAINPILYNLMSARFRAAFRSLLSK 355          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Celegans
Match: npr-15 (Neuropeptide receptor 15 [Source:UniProtKB/Swiss-Prot;Acc:Q09638])

HSP 1 Score: 72.7886 bits (177), Expect = 4.344e-14
Identity = 84/308 (27.27%), Postives = 144/308 (46.75%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPT-NCYLVSLAIADICLLIVTVLPNITEFMNPI----DHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTK-RFPNSL-----MSYEKCTFRLHRK-YYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF------QSSMRRSIGSSDRNRKS-----RXXXXXXXXXXXXXXXXXXXPYRTLVVYNS-FSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            I+   VG +GN +VI  +    NM     N  L++LA+AD+  LI T    I E++ P+      W   +FLC +  +L+      S  +     IER++AI  PM+A+ LC+ +   I ++  W     +   +      KTK R  NSL          C+  + +  +++   +++ + FYF+P  II V+Y  +   L+      Q   R  + +   +R S     R  V+KMLI  V ++ V + P + + +  +  +   +  Y F L    + +  SA NP+LY   S+KFRR  + +L+
Sbjct:   14 IILSVVGIIGNVIVIYAIAGDRNMRKSVMNILLLNLAVADLANLIFT----IPEWIPPVFFGSTDWLFPSFLCPVCRYLECVFLFASISTQMIVCIERYIAIVLPMQARQLCSRRNVLITVLVDWIFVACFASPYAVWHSVKTKDRNTNSLRFKLFQLSATCSNTVGKSTWWQGYKLTEFLAFYFVPCFIITVVYTKVAKCLWCKDPTLQCETRSCLDNKSSSRSSDALRTRRNVVKMLIACVAVYFVCYSPIQVIFLSKAVLNVTIHPPYDFILLMNALAMTCSASNPLLYTLFSQKFRRRLRDVLY 317          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Celegans
Match: nmur-2 (NMUR (NeuroMedin U Receptor) homolog [Source:UniProtKB/TrEMBL;Acc:O17239])

HSP 1 Score: 69.707 bits (169), Expect = 5.678e-13
Identity = 96/317 (30.28%), Postives = 150/317 (47.32%), Query Frame = 3
Query:  141 ILYLTV---GCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDH---WQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCT--------FRLHRKY----------YKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS--SMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPY---RTLVVYNSFSKKAYEDYWFRLFARNMVLM---------NSAINPILYNAMSEKFRRSF 977
            I+Y T+   G  GN     V+  + +M  PTN YL SLA++DI  LI+  LP   EF   +D+   ++    +C    FL  +    S + I  FS ERW+AIC P+++K   T+ RA ++II  W   F+  +   ++        P     Y+  T        F LH ++           K I +    +F+ +P + I ++Y HI + L  S   ++       R  KS   V+KML+ VVI F + WLP+   R L VY ++S+        +  +  M++          NSA NPILYN +S+K+R +F
Sbjct:   36 IIYGTIFLLGLFGNICTCIVIAANKSMHNPTNYYLFSLAVSDIIALILG-LP--MEFYQSLDYSYPYRFSEGICKARAFLIEFTSYASIMIICCFSFERWLAICHPLRSKIFSTLWRANVLIILAWTISFVCALPIAFIVQINKLPLPED-AKYQPWTNKVSTDGIFVLHTEFCAMNQSRPDQQKMIIIFAFTVFFVIPAIAIVIMYAHIAVQLESSEIDLKGDKMVKKRRNKSNRTVLKMLLSVVITFFICWLPFHIQRLLSVYTTWSETTTISPPVQFLS--MIVFYISGFCYYSNSAANPILYNILSQKYRSAF 346          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Celegans
Match: npr-34 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EDR6])

HSP 1 Score: 65.4698 bits (158), Expect = 1.693e-11
Identity = 65/227 (28.63%), Postives = 107/227 (47.14%), Query Frame = 3
Query:  144 LYLTV---GCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLL--IVTVLPNITEFMNPIDH-WQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLA-----------------------HTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSI 737
            LYLTV   G +GN+MVI VV R   M   TN +L SL+ AD+CL+   V ++     FM  + H W +G F C  + ++Q + C  S L++T  S ER++AI +PM+     +I RA+ +I+          ++W+  A                       H   +RFP   + Y + +        KA  M  ++L    P++ + + Y  +  ++++SS  R I
Sbjct:   78 LYLTVFLVGTIGNSMVIFVVNRFKRMRNVTNIFLASLSTADLCLIWFCVPIM-----FMKYMSHTWSMGRFACYSVHYIQQFTCFCSVLTMTMISFERFLAIAYPMRNIWFSSIGRAKKVIL----------LIWMSSAVLAVPTAVRMDYETNLSLSGQRVHWCRRRFPAQFLGYPRTSLN------KAYAMYQLLLLIIFPVLTMSICYARVSAIVYKSSKDRVI 283          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 58.9214 bits (141), Expect = 1.960e-9
Identity = 75/297 (25.25%), Postives = 136/297 (45.79%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVT----VLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRF--PNSLMSYEKC--TFRLHRKYYKAIYMSDIILFYFL-PLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYED-------YWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
            VG  GN++   + +R     +  N  L +L+  D  LL ++    V+PN+  + N +      A++  ++  +     + S   +   ++ERWVA+C P++ +  CT +++R  I+ I    FLYN +  +       RF    S   YEK       HR YY   Y    I+ +FL P  ++     H+++ + + S  R + +  + R+ +   + +LIV  +  +   LP+  L V  S     ++D       YW    +  +V++NS    I+Y   SEK+R++   IL  G
Sbjct:   17 VGIFGNSLSFILFSRPHMRSSSVNVLLCALSFFDFSLLTLSIPIFVIPNLDLWANDLSLSTYMAYILKLIYPINLMMQTCSVYIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFF-----EYRFVVTESGALYEKWLRDPGKHRWYYVGYYTILYIVTHFLVPFSVMAFANGHVIVAMCKLSKTRQMLTRQQQRE-QSTTVMLLIVTFVFAICNTLPF-LLNVSESIFPTLFQDESTRGLAYWLNDLSNLLVVLNSGTTFIIYFTFSEKYRQTLVFILKNG 306          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Fly
Match: ETHR (gene:FBgn0038874 transcript:FBtr0084054)

HSP 1 Score: 102.834 bits (255), Expect = 7.149e-24
Identity = 97/296 (32.77%), Postives = 155/296 (52.36%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIV--MVLFQSSMRRSIGSS-DRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFS-KKAYED------YWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
            I+ + +G VGN MV  V+ ++ +M   TN +L +L+IAD+ +L+V     + E     + W LG  +C  + F++      S L+I   S ER+ AIC P+KA  +CT  RA +I +  W    L+    L++A  K   + +   S   C  +    +  A ++  I +F+ +P V + VLY  I   +V  +++M R+  +  + + K+R QV+ ML  VV+ F V  LP+R L ++   S  +   D      Y    F R M+ +NSA+NPILYN MS KFRR FK++    
Sbjct:   18 IVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTPTVLVEVNTRPETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGIAALFTSPILWVAEYKLAEYIDG-SSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVVLYGIIARNLVSNRAAMLRARPTKPELSLKARKQVVLMLGAVVLSFFVCLLPFRVLTLWIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTKFRRGFKRLCQDA 312          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Fly
Match: ETHR (gene:FBgn0038874 transcript:FBtr0339194)

HSP 1 Score: 102.834 bits (255), Expect = 7.149e-24
Identity = 97/296 (32.77%), Postives = 155/296 (52.36%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIV--MVLFQSSMRRSIGSS-DRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFS-KKAYED------YWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
            I+ + +G VGN MV  V+ ++ +M   TN +L +L+IAD+ +L+V     + E     + W LG  +C  + F++      S L+I   S ER+ AIC P+KA  +CT  RA +I +  W    L+    L++A  K   + +   S   C  +    +  A ++  I +F+ +P V + VLY  I   +V  +++M R+  +  + + K+R QV+ ML  VV+ F V  LP+R L ++   S  +   D      Y    F R M+ +NSA+NPILYN MS KFRR FK++    
Sbjct:   18 IVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTPTVLVEVNTRPETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGIAALFTSPILWVAEYKLAEYIDG-SSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVVLYGIIARNLVSNRAAMLRARPTKPELSLKARKQVVLMLGAVVLSFFVCLLPFRVLTLWIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTKFRRGFKRLCQDA 312          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Fly
Match: ETHR (gene:FBgn0038874 transcript:FBtr0084053)

HSP 1 Score: 87.8113 bits (216), Expect = 8.040e-19
Identity = 96/318 (30.19%), Postives = 148/318 (46.54%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF---------------QSSMRRSIGS-------------SDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVY------NSFSKKAYEDYWFRL-FARNMVLMNSAINPILYNAMSEKFRRSFKKIL 989
            I+ + +G VGN MV  V+ ++ +M   TN +L +L+IAD+ +L+V     + E     + W LG  +C  + F++      S L+I   S ER+ AIC P+KA  +CT  RA +I +  W    L+    + ++    + + +       CT      +    ++  I +F+FLP  I+ +LY  I   L                Q S   + GS             S+  RK R QVI ML+ VV  F V  LP+R   ++                Y+  L F+R M+ +NSA+NPILYN MS KFR  F ++L
Sbjct:   18 IVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTPTVLVEVNTRPETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAWGIAALFTSPIIAISTYSVEPYGDG-TDAPVCTTAADGFWSIFYFVGCITVFFFLPFGILVLLYAAIAYKLLRPNNAFHRPTSPQPQQPSGGATSGSSQVPSTKGNSHQQSNGMRKHRKQVIFMLVAVVSSFFVCLLPFRAFTLWVILASAEDVEGLGIAGYYNLLYFSRFMLYLNSAMNPILYNLMSSKFRSGFWRLL 334          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Fly
Match: PK2-R1 (gene:FBgn0038140 transcript:FBtr0082745)

HSP 1 Score: 72.0182 bits (175), Expect = 1.691e-13
Identity = 86/302 (28.48%), Postives = 149/302 (49.34%), Query Frame = 3
Query:  144 LYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLY---LAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS----SMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPY---RTLVVYN------SFSKKAYEDYWFRLFARNMVL--MNSAINPILYNAMSEKFRRSFKKILHK 995
            L    G +GN +   V++R++ M T TN YL +LA++D+ LL+  +   +     P D +     +C +   L     + + L+IT F++ER++AIC P +  T+  + RA                +WL    LA  +  +F + +   E  +  +   +Y  ++     +F+  P+  I VLYV I + L +S    S+ R    ++R   ++ +VI+ML+ V + F + W P+   R + VY         S+ A+ DY+  L   + VL  +++ INP+LYN MS KFR +FK  L +
Sbjct:  116 LIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILLVSGIPQELYNLWYP-DMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQHTMSKLSRA----------IKFIFAIWLAAFLLALPQAMQF-SVVYQNEGYSCTMENDFYAHVFAVSGFIFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVAVAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKITLTR 405          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Fly
Match: TrissinR (gene:FBgn0085410 transcript:FBtr0330222)

HSP 1 Score: 70.4774 bits (171), Expect = 5.324e-13
Identity = 58/196 (29.59%), Postives = 96/196 (48.98%), Query Frame = 3
Query:  144 LYLTVGCV---GNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSS 722
            LY  V C    GN +VI VVT S  + + TN +L +LA AD C+ +  V+ N++ ++  I+ W  G FLC +  F+     + S   +    +ER+ AI  P+  K + T  R R++I+ +W    +Y+      + T            E C         K + M + +L Y +PL+++ VLY  I + L++SS
Sbjct:  190 LYTLVFCCCFFGNLLVILVVTLSRRLRSITNFFLANLAFADFCVGLFCVMQNLSIYL--IESWVFGEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHPITCKQILTAARLRMVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMFNSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRSS 383          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 197.978 bits (502), Expect = 8.049e-60
Identity = 141/291 (48.45%), Postives = 186/291 (63.92%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRK-------SRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            IL   VG VGN MVI VV  + +M TPTNCYLVSLA+AD+ +L    LPNITE +     W  G   C  + + QY   + SS SIT F+IER++AIC P+KA+ +CT+ RA+ II+ +W    LY +MW YL  T+ K + N+++    C +++ R+ Y  IY +D  +FY +PL++  VLY  I  +LF + +      S RN K       SR QV KML VVVILF +LW+PYRTLVV NSF K+AY D  F LF R  + MNSAINPI+YNAMS+KFR +F K+ H
Sbjct:   27 ILICGVGIVGNVMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITEILFG-GQWVYGYAGCLSITYFQYLGINASSCSITAFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWFYLLDTREKVYDNAVLV--TCGYKVSRELYLPIYFTDYAVFYVIPLLLATVLYGLIARILFLNPLPSDPKESRRNWKKESTTVASRRQVTKMLAVVVILFALLWMPYRTLVVVNSFLKEAYLDTCFLLFCRLCIYMNSAINPIIYNAMSQKFRAAFHKLCH 314          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 193.741 bits (491), Expect = 4.257e-58
Identity = 141/303 (46.53%), Postives = 186/303 (61.39%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRK-------------------SRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            IL   VG VGN MVI VV  + +M TPTNCYLVSLA+AD+ +L    LPNITE +     W  G   C  + + QY   + SS SIT F+IER++AIC P+KA+ +CT+ RA+ II+ +W    LY +MW YL  T+ K + N+++    C +++ R+ Y  IY +D  +FY +PL++  VLY  I  +LF + +      S RN K                   SR QV KML VVVILF +LW+PYRTLVV NSF K+AY D  F LF R  + MNSAINPI+YNAMS+KFR +F K+ H
Sbjct:   27 ILICGVGIVGNVMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITEILFG-GQWVYGYAGCLSITYFQYLGINASSCSITAFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWFYLLDTREKVYDNAVLV--TCGYKVSRELYLPIYFTDYAVFYVIPLLLATVLYGLIARILFLNPLPSDPKESRRNWKKESSVHGNSRSSSNSTTVASRRQVTKMLAVVVILFALLWMPYRTLVVVNSFLKEAYLDTCFLLFCRLCIYMNSAINPIIYNAMSQKFRAAFHKLCH 326          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 193.741 bits (491), Expect = 5.991e-58
Identity = 141/303 (46.53%), Postives = 186/303 (61.39%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRK-------------------SRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            IL   VG VGN MVI VV  + +M TPTNCYLVSLA+AD+ +L    LPNITE +     W  G   C  + + QY   + SS SIT F+IER++AIC P+KA+ +CT+ RA+ II+ +W    LY +MW YL  T+ K + N+++    C +++ R+ Y  IY +D  +FY +PL++  VLY  I  +LF + +      S RN K                   SR QV KML VVVILF +LW+PYRTLVV NSF K+AY D  F LF R  + MNSAINPI+YNAMS+KFR +F K+ H
Sbjct:   27 ILICGVGIVGNVMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITEILFG-GQWVYGYAGCLSITYFQYLGINASSCSITAFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWFYLLDTREKVYDNAVLV--TCGYKVSRELYLPIYFTDYAVFYVIPLLLATVLYGLIARILFLNPLPSDPKESRRNWKKESSVHGNSRSSSNSTTVASRRQVTKMLAVVVILFALLWMPYRTLVVVNSFLKEAYLDTCFLLFCRLCIYMNSAINPIIYNAMSQKFRAAFHKLCH 326          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 193.356 bits (490), Expect = 9.498e-58
Identity = 141/303 (46.53%), Postives = 186/303 (61.39%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRK-------------------SRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            IL   VG VGN MVI VV  + +M TPTNCYLVSLA+AD+ +L    LPNITE +     W  G   C  + + QY   + SS SIT F+IER++AIC P+KA+ +CT+ RA+ II+ +W    LY +MW YL  T+ K + N+++    C +++ R+ Y  IY +D  +FY +PL++  VLY  I  +LF + +      S RN K                   SR QV KML VVVILF +LW+PYRTLVV NSF K+AY D  F LF R  + MNSAINPI+YNAMS+KFR +F K+ H
Sbjct:   31 ILICGVGIVGNVMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITEILFG-GQWVYGYAGCLSITYFQYLGINASSCSITAFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWFYLLDTREKVYDNAVLV--TCGYKVSRELYLPIYFTDYAVFYVIPLLLATVLYGLIARILFLNPLPSDPKESRRNWKKESSVHGNSRSSSNSTTVASRRQVTKMLAVVVILFALLWMPYRTLVVVNSFLKEAYLDTCFLLFCRLCIYMNSAINPIIYNAMSQKFRAAFHKLCH 330          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Zebrafish
Match: trhrb (thyrotropin-releasing hormone receptor b [Source:ZFIN;Acc:ZDB-GENE-060503-382])

HSP 1 Score: 175.637 bits (444), Expect = 5.794e-51
Identity = 135/319 (42.32%), Postives = 184/319 (57.68%), Query Frame = 3
Query:  144 LYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF------------------QSSMRRSIGSSDR----NRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNV 1034
            L   +G VGN MVI VV  + +M TPTN YLVSLA+AD+ +L+   LP+I + +     W  G   C  + + QY   + SS SIT F+IER++AIC P+KA+ LCT+ RA+ III +W    LY +MW YL+  +   + ++ +    C +++ R  Y  IY  D  +F+ LPL +  VLY  I  +LF                    + R  + SS R       SR QV KML VVVILF VLW+PYRTLVV NSF + AY D WF LF R  V +NSAINP++YNAMS+KFR +F+++   G      +  Y+V
Sbjct:   31 LICALGIVGNVMVILVVLTTKHMRTPTNGYLVSLAVADLMVLVAAGLPSIADSL--FGSWVFGHAGCLCITYFQYLGINASSCSITAFTIERYIAICHPIKAQFLCTLSRAKKIIIGVWVFTSLYCVMWFYLSDVQQVLYKDATII--TCAYKVSRNLYLPIYFFDFGIFFVLPLTLATVLYGLIARILFLNPLPSDTKEEKNGHGNFSKAKRNKLKSSSRCSSTTAASRRQVTKMLAVVVILFAVLWMPYRTLVVVNSFLQDAYLDTWFLLFCRTCVYLNSAINPLIYNAMSQKFRAAFRRLCRCGRNAQANKAAYSV 345          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Xenopus
Match: ENSXETT00000016730.1 (thyrotropin-releasing hormone receptor 3 [Source:NCBI gene;Acc:100489565])

HSP 1 Score: 178.718 bits (452), Expect = 3.539e-52
Identity = 132/320 (41.25%), Postives = 182/320 (56.88%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS----------------------SMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNV 1034
            +L   VG  GN MV+ VV R+ +M+TPTNCYLVSLAIAD+ +L+   LPNI+E    +  W  G   C  + +LQY   + S+ SIT F++ER++AIC  +KA+ +CT+ RA+ II  +WF   +Y +MW +L      +F + +     C +R+ R  Y  IY  D  +FY +PLV+  VLY  I  +LF +                      S++ S   +     SR QV KML VVVILF +LW+PYRTLVV NSF    Y + WF LF R  + +NSAINPI+YN MS+KFR +FK +            +YNV
Sbjct:   23 LLICGVGIAGNIMVVLVVLRTKHMMTPTNCYLVSLAIADLIVLLAAGLPNISEV---VASWVYGYVGCLCITYLQYLGINISACSITAFTVERYIAICHSIKAQFICTVSRAKKIIAFVWFFTSMYCVMWFFLVDITEVKFADGVQV--NCGYRVSRNLYTPIYFLDFTIFYVIPLVLATVLYGLIARILFMNPLPSNPQDLSRMSSKHYGKPYNSIKLSGKGNKNTASSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFMDPPYLNVWFVLFCRLCIYLNSAINPIIYNLMSQKFRAAFKNLCKCEQKRTEKAAKYNV 337          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Xenopus
Match: ENSXETT00000016751.1 (thyrotropin-releasing hormone receptor 3 [Source:NCBI gene;Acc:100489565])

HSP 1 Score: 178.718 bits (452), Expect = 5.089e-52
Identity = 132/320 (41.25%), Postives = 182/320 (56.88%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS----------------------SMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNV 1034
            +L   VG  GN MV+ VV R+ +M+TPTNCYLVSLAIAD+ +L+   LPNI+E    +  W  G   C  + +LQY   + S+ SIT F++ER++AIC  +KA+ +CT+ RA+ II  +WF   +Y +MW +L      +F + +     C +R+ R  Y  IY  D  +FY +PLV+  VLY  I  +LF +                      S++ S   +     SR QV KML VVVILF +LW+PYRTLVV NSF    Y + WF LF R  + +NSAINPI+YN MS+KFR +FK +            +YNV
Sbjct:   41 LLICGVGIAGNIMVVLVVLRTKHMMTPTNCYLVSLAIADLIVLLAAGLPNISEV---VASWVYGYVGCLCITYLQYLGINISACSITAFTVERYIAICHSIKAQFICTVSRAKKIIAFVWFFTSMYCVMWFFLVDITEVKFADGVQV--NCGYRVSRNLYTPIYFLDFTIFYVIPLVLATVLYGLIARILFMNPLPSNPQDLSRMSSKHYGKPYNSIKLSGKGNKNTASSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFMDPPYLNVWFVLFCRLCIYLNSAINPIIYNLMSQKFRAAFKNLCKCEQKRTEKAAKYNV 355          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Xenopus
Match: ENSXETT00000031646.1 (thyrotropin-releasing hormone receptor 3 [Source:NCBI gene;Acc:100489565])

HSP 1 Score: 178.333 bits (451), Expect = 7.992e-52
Identity = 132/320 (41.25%), Postives = 182/320 (56.88%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS----------------------SMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNV 1034
            +L   VG  GN MV+ VV R+ +M+TPTNCYLVSLAIAD+ +L+   LPNI+E    +  W  G   C  + +LQY   + S+ SIT F++ER++AIC  +KA+ +CT+ RA+ II  +WF   +Y +MW +L      +F + +     C +R+ R  Y  IY  D  +FY +PLV+  VLY  I  +LF +                      S++ S   +     SR QV KML VVVILF +LW+PYRTLVV NSF    Y + WF LF R  + +NSAINPI+YN MS+KFR +FK +            +YNV
Sbjct:   41 LLICGVGIAGNIMVVLVVLRTKHMMTPTNCYLVSLAIADLIVLLAAGLPNISEV---VASWVYGYVGCLCITYLQYLGINISACSITAFTVERYIAICHSIKAQFICTVSRAKKIIAFVWFFTSMYCVMWFFLVDITEVKFADGVQV--NCGYRVSRNLYTPIYFLDFTIFYVIPLVLATVLYGLIARILFMNPLPSNPQDLSRMSSKHYGKPYNSIKLSGKGNKNTASSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFMDPPYLNVWFVLFCRLCIYLNSAINPIIYNLMSQKFRAAFKNLCKCEQKRTEKAAKYNV 355          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Xenopus
Match: kiaa1324l (KIAA1324-like [Source:Xenbase;Acc:XB-GENE-5954588])

HSP 1 Score: 171.785 bits (434), Expect = 2.225e-49
Identity = 129/303 (42.57%), Postives = 178/303 (58.75%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSM------------------------RRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSF 977
            +L   +G VGN MV+ VV ++ +M TPTNCYLVSLAIAD+ +L+   LPNITE +     W  G   C  + +LQY   + SS SIT F++ER++AIC P+KA+ LCTI RA+ II+ +W    LY +MW +L    T  + ++  +   C +R+ R +Y  IY+ D  +FY +P+ +  VLY  I  +LF + +                        + S   S+    SR QV KML VVVILF  LW+PYRTLVV NSF  + Y   WF LF R  + +NSAINP++YN MS+KFR +F
Sbjct:   33 VLICGLGIVGNIMVVLVVLQTKHMRTPTNCYLVSLAIADLIVLVAAGLPNITESV--YGSWVYGYIGCLCITYLQYLGINASSCSITAFTVERYLAICHPIKAQFLCTISRAKKIIVFVWAFTSLYCLMWFFLLDLNTTIYKDA--TVVNCGYRVPRSFYSPIYLIDFGIFYAVPMTLATVLYGLIARILFLNPIPSDPKENSKTWKNDVTHQNKAFNSKMSSRCSNNTIASRRQVTKMLAVVVILFAFLWMPYRTLVVVNSFLSRPYLQTWFVLFCRICIYLNSAINPVIYNLMSQKFRAAF 331          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Xenopus
Match: epx (eosinophil peroxidase [Source:Xenbase;Acc:XB-GENE-6039946])

HSP 1 Score: 162.155 bits (409), Expect = 9.926e-46
Identity = 119/302 (39.40%), Postives = 173/302 (57.28%), Query Frame = 3
Query:  177 MVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF-----------------QSSMRRSIGSSDRNR-----------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
            MV+ VV  + +M TPTNCYLVSLA+AD+ +L+   LPN+++ +     W  G   C  + + QY   + SS SIT F++ER++AIC PM+A+T+CT+ RA+ II  +W    +Y M W +L      +         +C +++ R  Y  IY++D  +FY  PL++  +LY  I  +LF                 +SS  ++   ++ N+            SR QV KML VVV+LF +LW+PYRTLV+ NSF  K Y D WF LF R  V  NSAINP++YN MS+KFR +FK++   G
Sbjct:   48 MVVLVVFTTRDMRTPTNCYLVSLAVADLMVLVAAGLPNVSDSL--AGTWIYGHAGCLGITYFQYLGINASSCSITAFTVERYIAICHPMRAQTVCTVSRAKRIIAIVWIFTSIYCMFWFFLVDIHVNKSQQV-----ECGYKVSRNLYLPIYLADFAIFYVTPLLVATILYGLIGRILFLSPIPQHPESTTERWREKSSKEKTESETEGNKPSNRLKTKGALSSRKQVTKMLAVVVVLFALLWMPYRTLVLVNSFMDKPYLDPWFLLFCRICVYANSAINPVIYNLMSQKFRTAFKRLCKCG 342          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Mouse
Match: Trhr (thyrotropin releasing hormone receptor [Source:MGI Symbol;Acc:MGI:98824])

HSP 1 Score: 176.792 bits (447), Expect = 2.018e-51
Identity = 129/303 (42.57%), Postives = 184/303 (60.73%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF----------QSSM--------RRSIGSSDRNR------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    +Y M+W +L       + N+++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF           S M         +++  +  NR       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVV--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIHQNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Mouse
Match: Trhr (thyrotropin releasing hormone receptor [Source:MGI Symbol;Acc:MGI:98824])

HSP 1 Score: 176.792 bits (447), Expect = 2.018e-51
Identity = 129/303 (42.57%), Postives = 184/303 (60.73%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF----------QSSM--------RRSIGSSDRNR------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    +Y M+W +L       + N+++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF           S M         +++  +  NR       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVV--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIHQNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Mouse
Match: Trhr (thyrotropin releasing hormone receptor [Source:MGI Symbol;Acc:MGI:98824])

HSP 1 Score: 176.792 bits (447), Expect = 2.018e-51
Identity = 129/303 (42.57%), Postives = 184/303 (60.73%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF----------QSSM--------RRSIGSSDRNR------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    +Y M+W +L       + N+++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF           S M         +++  +  NR       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVV--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIHQNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Mouse
Match: Trhr2 (thyrotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:2177284])

HSP 1 Score: 176.022 bits (445), Expect = 2.673e-51
Identity = 125/296 (42.23%), Postives = 177/296 (59.80%), Query Frame = 3
Query:  153 TVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSM--------RRSIGSSDRNRKS----------RXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKI 986
            TVG VGNAMV+ VV  S +M TPTNCYLVSLA+AD+ +L+   LPN+++ +  + HW  G   C  + + QY   + SS SI  F++ER++AIC PM+A+T+CT+ RAR II  IW    LY ++W +L     +   N  +   +C +++ R  Y  IY+ D  +F+  PL+   VLY  I  +LFQS +        R+S G S+    +          R Q  +ML V+V+LF VLW PYRTLV+ NSF  + + D W  LF R  V  NSAINP++Y+ MS+KFR +F K+
Sbjct:   34 TVGIVGNAMVVLVVLTSRDMHTPTNCYLVSLALADLIVLLAAGLPNVSDSL--VGHWIYGHAGCLGITYFQYLGINVSSCSILAFTVERYIAICHPMRAQTVCTVARARRIIAGIWGVTSLYCLLWFFLVDLNVRD--NQRL---ECGYKVSRGLYLPIYLLDFAVFFIAPLLGTLVLYGFIGRILFQSPLSQEAWQKERQSHGQSEGTPGNCSRSKSSMSSRKQATRMLAVIVLLFAVLWTPYRTLVLLNSFLARPFLDPWVLLFCRTCVYTNSAINPVIYSLMSQKFRAAFLKL 322          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 85.1149 bits (209), Expect = 5.599e-18
Identity = 90/313 (28.75%), Postives = 150/313 (47.92%), Query Frame = 3
Query:  129 CIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFP--NSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF------------------QSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTL--VVYNSFSKKAYEDYWFRLFARNMVL-MNSAINPILYNAMSEKFRRSFKKILHKG 998
            C+  +L   VG +GN +  TV+ R+  M TPTN YL SLA++D+ +L+V +   + E M     +QLGA  C   + L    C  S L++T  S+ER+VA+  P++AK++ T    R ++  IW    L+++    L        P    +     C+      +YK + ++  +LF+ LP+V I VLY+ I + L                   Q +  R I   DR R+   +++  L+VV  +    +   R +  +VY   ++  +  Y     A  +   + SA NP+LY+ MS +FR +F + L  G
Sbjct:    8 CVTYLLIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYE-MQQNYPFQLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQLTVPCRGPVPDSAICSLVGPMDFYKLVVLTTALLFFCLPMVTISVLYLLIGLRLRRERMLLQVEVKGRKTAATQETSHRRIQLQDRGRRQVTKMLFALVVVFGICWAPFHADRIMWSLVYGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLMSTRFRETFLQALGLG 319          
BLAST of Thyrotropin-releasing hormone receptor vs. UniProt/SwissProt
Match: sp|Q28596|TRFR_SHEEP (Thyrotropin-releasing hormone receptor OS=Ovis aries OX=9940 GN=TRHR PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.394e-51
Identity = 128/303 (42.24%), Postives = 184/303 (60.73%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSM------------------RRSIGSSDRNR------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    +Y M+W +L       + ++++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF S +                   +++ S   NR       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVV--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLSPIPSDPKENSNTWKNDSTHQNKNLNSKTSNRYFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. UniProt/SwissProt
Match: sp|O93603|TRFR_CHICK (Thyrotropin-releasing hormone receptor OS=Gallus gallus OX=9031 GN=TRHR PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.589e-51
Identity = 130/306 (42.48%), Postives = 182/306 (59.48%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF------------------QSSMRRSIGSSDRNRK------SRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKI 986
            +L   +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNITE +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    +Y M+W +L       + ++  +   C +++ R YY  IYM D  +FY LP+V+  VLY  I  +LF                   +   +++ S   N+       SR QV KML VVV+LF  LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+
Sbjct:   35 LLICGLGIVGNIMVVLVVLRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITESL--YKSWVYGYVGCLCITYLQYLGINASSFSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWSFASVYCMLWFFLLDLNIAVYKDT--TVVSCGYKVSRSYYSPIYMMDFGIFYVLPMVLATVLYGLIARILFLNPIPSDPKENSNTWKNDMAQQNKTVNSKMTNKSFNSTIASRRQVTKMLAVVVVLFAFLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKL 336          
BLAST of Thyrotropin-releasing hormone receptor vs. UniProt/SwissProt
Match: sp|O46639|TRFR_BOVIN (Thyrotropin-releasing hormone receptor OS=Bos taurus OX=9913 GN=TRHR PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.722e-51
Identity = 127/303 (41.91%), Postives = 183/303 (60.40%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF------------------QSSMRRSIGSSDRNR------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    +Y M+W +L       + ++++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF                   +   +++ S   NR       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVV--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSNMWKNDSTHQNKNLNSKTSNRYFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. UniProt/SwissProt
Match: sp|P21761|TRFR_MOUSE (Thyrotropin-releasing hormone receptor OS=Mus musculus OX=10090 GN=Trhr PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.411e-50
Identity = 129/303 (42.57%), Postives = 184/303 (60.73%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF----------QSSM--------RRSIGSSDRNR------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    +Y M+W +L       + N+++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF           S M         +++  +  NR       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVV--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIHQNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. UniProt/SwissProt
Match: sp|P34981|TRFR_HUMAN (Thyrotropin-releasing hormone receptor OS=Homo sapiens OX=9606 GN=TRHR PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.780e-50
Identity = 127/303 (41.91%), Postives = 183/303 (60.40%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF--------------------QSSMRRSIGSSDR----NRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            +G VGN MV+ VV R+ +M TPTNCYLVSLA+AD+ +L+   LPNIT+ +     W  G   C  + +LQY   + SS SIT F+IER++AIC P+KA+ LCT  RA+ III +W    LY M+W +L       + ++++    C +++ R YY  IY+ D  +FY +P+++  VLY  I  +LF                      +   ++ +S+R       SR QV KML VVVILF +LW+PYRTLVV NSF    +++ WF LF R  + +NSAINP++YN MS+KFR +F+K+ +
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSI--YGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVI--SCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCN 336          
BLAST of Thyrotropin-releasing hormone receptor vs. TrEMBL
Match: A0A0K0PUG3 (EFLGamide receptor 1 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.760e-72
Identity = 159/310 (51.29%), Postives = 208/310 (67.10%), Query Frame = 3
Query:   96 KYYQPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIG------SSDRNR---KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
             YY   Y  +GC    L   VG VGN MV+ VV R+S+M TPTNCYLVSLA+AD+ +LI   LP I EF   ID   +G   C I+VFLQY   + SSLSIT F++ER++AIC P+K++T+CT+KRA+ II+ IW     Y   WL LA T  ++F +   + E CTF+L R  Y  IYM+D+++FY  PLV+  +LY  I  +LF+S++  + G      S+ ++R    SR+QV+KML VVV+LF  LW+PYR LVVYNSF+ K Y DYWF LF R MV MNSAINP+LYNAMS KFRR++K +L  G
Sbjct:   45 SYYSIPYRIVGCFFVSLIFLVGLVGNMMVVIVVARTSSMHTPTNCYLVSLAVADVLVLISATLPTIYEFFLIIDQCIIGKVGCAIMVFLQYLGINASSLSITAFTVERYIAICHPIKSQTMCTVKRAKRIILSIWAFSIAYCSPWLGLATTVERQFSDG-TTIEACTFKLKRSSYLTIYMADLVIFYVFPLVMTCILYGLIARILFRSTIPSTPGKANGINSTHKSRSVTSSRVQVVKMLAVVVLLFAFLWMPYRVLVVYNSFASKPYADYWFILFCRLMVYMNSAINPVLYNAMSVKFRRAYKHLLSCG 353          
BLAST of Thyrotropin-releasing hormone receptor vs. TrEMBL
Match: R7TCJ0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_90908 PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.731e-65
Identity = 157/313 (50.16%), Postives = 205/313 (65.50%), Query Frame = 3
Query:   99 YYQPLY-IWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQ-----------SSMRRSIGSSDRNRK----SRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKIL 989
            YY P Y +  G   SI++ +VG VGN MVI VV R+ ++ TPTNCYL+SLA+AD+ LLI   LP + E    ID   LG   C I+VFLQY   + SSLS+TFF+IER++AIC PMKA+T+CT+ RA+ II+ +W     Y   WL+L HT  K F +  +  +KC F+L R  Y   YM+D+ILFY +PL++  VLY  I  +L+            +S     G  +R++K    SR+QVIKML +VV LF VLW+PYR  VVYNSF+K  Y D WF LF R MV +NSA+NPILYNAMS KFRR+FK++L
Sbjct:    2 YYPPAYRVIAGIFVSIIF-SVGLVGNIMVILVVWRTRSLHTPTNCYLLSLALADVILLISAPLPTLVEIFLIIDQNFLGDAGCRIIVFLQYLGVNVSSLSMTFFTIERYMAICHPMKAQTICTVSRAKRIIVALWVFGICYCCPWLFLLHTNIKTFSDGTV-IKKCGFKLARHKYLIYYMADLILFYVIPLLLTCVLYALIGAILYSGSRPMAHAGKTASNGSQSGGGNRSQKASTSSRVQVIKMLAIVVGLFAVLWMPYRVFVVYNSFAKTTYTDLWFILFCRIMVYVNSAVNPILYNAMSVKFRRAFKRLL 312          
BLAST of Thyrotropin-releasing hormone receptor vs. TrEMBL
Match: A0A210QHU7 (Thyrotropin-releasing hormone receptor OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14454 PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.223e-64
Identity = 146/312 (46.79%), Postives = 198/312 (63.46%), Query Frame = 3
Query:  138 SILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSS---------DRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNVI*TD 1046
            +I+   VG VGN +V+ VV R+ +M TPTNCYL+SL++AD  +L+   LP + E    ++ W  G  +C+IL+FLQY     S+LS+T F++ER++AIC PMKA+ +CT+KRA  I   IW    +Y   WL L  T T+R P S     +CT+RL R  Y   YM+D+I FY LPL+I   LY  I  +LF +++ ++ G            +N  SR QV++MLIV+V +F  LWLPYR +VVYNSFS+  Y D WF LF R M+ +NSAINPILYNAMS KFRR+F+K+L     GIR     N I +D
Sbjct:   68 AIIIFIVGFVGNILVVLVVCRTKSMHTPTNCYLLSLSVADCLVLLSATLPAVPEPFFQVNEWPWGQAMCSILIFLQYLGVDASALSMTAFTVERYIAICHPMKAQRMCTVKRAMKITAGIWIFTLMYTAPWLGL--TMTRRHPKS--GIVQCTYRLKRNQYLFYYMTDLIAFYVLPLIIAACLYGLIARILFSTNISKTPGGKYKENGKYRVKKNTSSRKQVVRMLIVIVGVFATLWLPYRAMVVYNSFSRHKYLDTWFLLFCRVMIYINSAINPILYNAMSVKFRRAFQKVL---CCGIRHMKHQNEIYSD 372          
BLAST of Thyrotropin-releasing hormone receptor vs. TrEMBL
Match: A0A3Q0KMD9 (Putative thyrotropin-releasing hormone receptor OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.724e-64
Identity = 147/331 (44.41%), Postives = 205/331 (61.93%), Query Frame = 3
Query:  114 YIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRR--------------SIGSSDR------------------NR-KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKIL--HKGI 1001
            Y  +G I   + LTVG +GN  V+ V+T SS + TPTNCYL+SL+ +D+ +L+ +    + EF  P +HW+LG F C + V LQY     S+LSI  FS+ERWV IC+PM+A  +CTIKRA  II  IW     YN+ W++++ T  K++ +   S+E CTF+  R  YKAIYM D+I+FY LPL+I  V+Y  I   LF++  +               S G ++R                  NR ++R QV+K+L+++V+LF   WLPYR++VVYNSFS   Y D WFR+F+R M  +NSA+NPILYNAMS KFRR+ K++L  HK I
Sbjct:   26 YKLVGTISLSVILTVGVIGNIFVMLVLTLSSKLHTPTNCYLISLSASDLLVLMTSTTLMVQEFYQPYNHWRLGNFACQLSVCLQYLSVDASALSICAFSVERWVGICYPMRAHYMCTIKRAIKIITGIWIFTLTYNIPWIFMS-TTVKQY-SEYGSFETCTFKFKRTAYKAIYMCDLIVFYVLPLLITSVMYCQISWRLFRTDNKGISLVGQQINFNQIISSGKTERSYATISETQHNLKLRKVINRARARRQVVKLLMIIVVLFASFWLPYRSMVVYNSFSLHGYHDLWFRMFSRIMAFLNSAVNPILYNAMSRKFRRALKRLLKCHKVI 354          
BLAST of Thyrotropin-releasing hormone receptor vs. TrEMBL
Match: A0A430QN94 (Thyrotropin-releasing hormone receptor OS=Schistosoma bovis OX=6184 GN=DC041_0009753 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.786e-63
Identity = 147/338 (43.49%), Postives = 205/338 (60.65%), Query Frame = 3
Query:   93 LKYYQPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMR------------RSIGSSDRNR---------------------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKIL--HKGI 1001
            L +Y   Y  +G I   + LTVG +GN  V+ V+  SS + TPTNCYL+SL+ +D+ +L+ +    + EF  P +HW+LG F C + V LQY     S+LSI  FS+ERWV IC+PM+A  +CTIKRA  II  IW     YN+ W++++ T  K++ +   S+E CTF+  R  YKAIYM D+I+FY LPL+I  V+Y  I   LF++  +            + I SS   R                     ++R QV+K+L+++V+LF   WLPYR++VVYNSFS   Y D WFR+F+R M  +NSA+NPILYNAMS KFRR+ K++L  HK I
Sbjct:   20 LIHYSLPYKLVGTISLSVILTVGVIGNIFVMLVLILSSKLHTPTNCYLISLSASDLLVLMTSTTLMVQEFYQPYNHWRLGNFACQLSVCLQYLSVDASALSICAFSVERWVGICYPMRAHYMCTIKRAIKIITGIWIFTLTYNIPWIFMS-TTVKQY-SEYGSFETCTFKFKRTAYKAIYMCDLIVFYVLPLLITSVMYCQISWRLFRTDNKGISLVGQHINFNQIISSSKTERSYATISETQHNLKLRKVINRVRARRQVVKLLMIIVVLFASFWLPYRSMVVYNSFSLHGYHDLWFRMFSRIMAFLNSAVNPILYNAMSRKFRRALKRLLKCHKVI 355          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Cavefish
Match: TRHR (thyrotropin-releasing hormone receptor [Source:NCBI gene;Acc:103040459])

HSP 1 Score: 192.586 bits (488), Expect = 1.704e-57
Identity = 136/316 (43.04%), Postives = 191/316 (60.44%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF-----------QSSMRRSIGSSDRNRKS------------RXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNV 1034
            +G +GNAMVI VV  + +M TPTNCYLVSLA+AD+ +L    LPNIT+ +   + W  G   C  + +LQY   + SS SIT F++ER++AIC P++A++LCT+ RA+ II  +W    LY +MW  LA  + +   N+ +    C +++ R  Y  IY +D  LFY LPL++  VLY  I  +L              + R+S  +S   +++            R QV KML VVVILF +LW+PYRTLVV NSF +K Y D WF LF R  + +NSAINP++YNAMS+KFR +F+K+ H G   +   P Y+V
Sbjct:   43 LGIIGNAMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITDSL--FEQWVYGYAGCLSITYLQYVGINASSCSITAFTVERYIAICHPIRAQSLCTLSRAKKIIALVWTFTGLYCVMWFCLADLEQQTHGNTTVVI--CAYKVSRTQYLPIYFTDFALFYVLPLLLATVLYGLIARILILNPLPSDPKENSKAWRKSTNTSSSTQRAAKSSSYSTTATSRRQVTKMLAVVVILFALLWMPYRTLVVVNSFLEKPYLDTWFVLFCRICIYLNSAINPVIYNAMSQKFRAAFRKLCHCGPQHLEKPPAYSV 354          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Cavefish
Match: ENSAMXT00000054912.1 (thyrotropin-releasing hormone receptor-like [Source:NCBI gene;Acc:103035526])

HSP 1 Score: 185.267 bits (469), Expect = 1.027e-54
Identity = 133/306 (43.46%), Postives = 182/306 (59.48%), Query Frame = 3
Query:  138 SILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSM-----RRSIGSSDRNR----------------KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH 992
            ++L   VG  GN MV+ VV R+ +M+TPTNCYLVSLAIAD+ +L+   LPNI+E    +  W  G   C  + +LQY   + SS SIT F++ER++AIC  +KA+ +CT+ RA+ II C+W    LY +MW +L  T    + N ++   +C +R+ R  Y  +Y  D  LFY +PL++  VLY  I  +LF + +      R   S  + R                 SR QV KML VVV+LF +LW+PYRTLVV NS     Y + WF LF R  +  NSAINPI+YNAMS+KFR +FKK+ H
Sbjct:   36 TLLICGVGIAGNVMVVLVVLRTKHMMTPTNCYLVSLAIADLIVLLAAGLPNISEV---VASWIYGYAGCLCITYLQYLGINVSSCSITAFTVERYIAICHSIKAQFICTVSRAKKIIACVWIFTSLYCIMWFFLVDTHEMVYANGVIV--RCGYRVSRNLYMPVYFLDFTLFYVIPLIVATVLYGLIARILFMNPLPSNLSERGSDSIHQGRTNSTVKVSCKPNKGAVSSRKQVTKMLAVVVVLFALLWMPYRTLVVVNSLMDPPYLNTWFLLFCRMSIYTNSAINPIIYNAMSQKFRTAFKKLCH 336          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Cavefish
Match: trhrb (thyrotropin-releasing hormone receptor-like [Source:NCBI gene;Acc:103029490])

HSP 1 Score: 179.874 bits (455), Expect = 6.940e-53
Identity = 132/313 (42.17%), Postives = 185/313 (59.11%), Query Frame = 3
Query:  132 IQSILYLTV---GCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF---------------------QSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
            I +++ LT+   G VGN MVI VV  + +M TPTNCYLVSLA AD+ +L+   LP++ + +     W  G   C  + + QY   + SS SIT F++ER++AIC P++A++LCT  RA+ II+ +W    LY +MW YLA  +   + ++ +    C +++ R  Y  IY  D  +F+ LPL +  VLY  I  +LF                      + ++ S   S     SR QV KML VVVILF VLW+PYRTLVV NSF ++AY D WF LF R  V +NSAINP++YNAMS+KFR +FK++   G
Sbjct:   24 ISTLIVLTICALGIVGNVMVILVVLTTKHMRTPTNCYLVSLAAADLMVLVAAGLPSVADSL--YGSWLFGRVGCLCITYFQYLGINASSCSITAFTVERYIAICHPIRAQSLCTYTRAKRIILGVWVTTSLYCVMWFYLADIEELVYEDATIV--SCAYKVSRNLYLPIYFFDFGVFFVLPLTLSTVLYGLIARILFLNPLPKTKSKNGHDGVYSGNKTNGLKSSSQCSSTTAASRRQVTKMLAVVVILFAVLWMPYRTLVVVNSFLQEAYLDTWFLLFCRTCVYLNSAINPVIYNAMSQKFRAAFKRLCRCG 332          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Cavefish
Match: trhr2 (thyrotropin-releasing hormone receptor-like [Source:NCBI gene;Acc:103031192])

HSP 1 Score: 173.711 bits (439), Expect = 2.782e-49
Identity = 130/307 (42.35%), Postives = 181/307 (58.96%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS--------------SMRRSI--------GSSDRNR---KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKI 986
            +L   VG VGN MV+ VV  + +M TPTNCYLVSLA+AD+ +L+   LPNI+E +  +  W  G   C  + +LQY   + SS SIT F++ER++AIC PM+A+T+CT+ RA+ II  +W    +Y M+WL+L   +            +C +R+ R  Y  IY+ D  +FY +PL++   LY  I  +L+ S              ++RRS         G   R +    SR QV KML VVVILF +LW+PYRTLV+ NSF  K Y D WF LF R  +  NSAINP++YN MS+KFR +F+ +
Sbjct:   41 LLVCGVGIVGNIMVVLVVLTTRHMRTPTNCYLVSLAVADLTVLVAAGLPNISESL--MATWVYGHAGCLGITYLQYLGINVSSCSITAFTVERYIAICHPMRAQTVCTVSRAKRIIAGVWAFTCVYCMLWLFLVDIQVNSD-----GRVQCGYRVSRDLYLPIYLIDFAIFYVIPLLLAIALYGLIARILYLSPLPHPPDSGTVTATTLRRSCKEPVDAVKGRQGRPKSALSSRKQVTKMLAVVVILFALLWMPYRTLVLINSFVSKPYLDAWFLLFCRTCIYANSAINPVVYNLMSQKFRSAFRGL 340          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Cavefish
Match: oprk1 (delta-type opioid receptor [Source:NCBI gene;Acc:103032206])

HSP 1 Score: 81.2629 bits (199), Expect = 8.720e-17
Identity = 90/305 (29.51%), Postives = 154/305 (50.49%), Query Frame = 3
Query:  105 QPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLP-NITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYF---LPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFR---LFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
             P+   +  + S++++ VG VGN +V+ V+ R + M T TN Y+ +LA+AD   L+ T +P    +++  ++ W  G  +C + + + YY   TS  ++T  S++R+VA+C P+KA    T  +A+II I IW       +  + L  T+T           +C  +    Y     +  I +F F    PL+II V Y  +VM L   S+R   GS +++R  R ++ ++++VVV +FVV W P    ++  + +    E         F   +   NS++NPILY  + E F+R F+     G
Sbjct:   52 SPIIPVITAVYSVVFV-VGLVGNCLVMYVIIRYTKMKTATNIYIFNLAVAD--ALVTTAMPFQSADYL--LNSWPFGEVVCKVFISIDYYNMFTSIFTLTMMSVDRYVAVCHPVKALDFRTPVKAKIINILIWVLSSAAGIPAMVLGSTQTNN------GTTECALQFPDPYMYWDTLMKICVFIFGFVAPLIIITVCYTLMVMRL--KSVRLLSGSREKDRNLR-RITRLVLVVVAVFVVCWTPIHIFILVKALAPGVPETTAVMGAYFFCVALGYTNSSLNPILYAFLDENFKRCFRDFCCPG 342          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Sea Lamprey
Match: trhrb (thyrotropin-releasing hormone receptor b [Source:ZFIN;Acc:ZDB-GENE-060503-382])

HSP 1 Score: 165.236 bits (417), Expect = 2.439e-48
Identity = 127/308 (41.23%), Postives = 178/308 (57.79%), Query Frame = 3
Query:  159 GCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYL--AHTKTK-----RFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVL---------------------FQSSMRRSIGSSDRNRK----SRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKI 986
            G VGN M++ VV R+ +M TPTN YL SLAIAD+ +L+   LPN+++ +   + W  G   C  + +LQY   + SS SIT F++ER++AIC P++A++LCT+ RA+ I+  +W    +Y ++W +L   H +++       P S  +  +C +R+ R  Y  IY  D   FY LPLV+  VLY  I  VL                       +    ++ S +R  K    SR QV KML VVV+LF VLWLPYR LVV NSF    Y D WF LF R  +  NSAINP++YNAMS+KFR +F+K+
Sbjct:   46 GIVGNVMIVLVVVRTKHMRTPTNYYLGSLAIADLLVLLAAGLPNVSDSLA--ESWVYGYAGCLAITYLQYLGINVSSCSITAFTLERYLAICHPIRAQSLCTVSRAKRILALVWSSTAIYCLVWFFLVDVHPRSQGGGGGEDPRS--NVTECGYRVSRNLYLPIYFFDFAAFYVLPLVLACVLYALIARVLLLPPPPASRTLAAPAVPLSLPLAAVCSGAVPSVNRRGKSAYSSRKQVTKMLAVVVLLFAVLWLPYRMLVVVNSFVSSPYHDAWFLLFCRLCLYANSAINPVVYNAMSQKFRAAFRKL 349          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Sea Lamprey
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 75.485 bits (184), Expect = 1.420e-15
Identity = 85/301 (28.24%), Postives = 149/301 (49.50%), Query Frame = 3
Query:  120 WLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHR----KYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGS------SDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKK---AYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKK 983
            WL  +   L + VG VGN++VI V+T++  M T TN ++V+LA  DI  L+  V    T  + P+  W  G F+C  + +LQ      + +++T  S++R     +P+++    T   A  I I IW    + ++       T TK +      Y   T+         +  A  +   +L Y LPLV I V Y  ++  + + ++     +      ++RN  +R +V +M++VVV++F++ W P +  +++ SF      +Y  Y  + +A  M   NS+INP +Y  M + FR++FKK
Sbjct:   37 WLVPLLFALIMLVGLVGNSLVIFVITKNRQMRTVTNFFIVNLAGTDIIFLVCCV--PFTATLYPLPSWVFGDFMCKFVNYLQQVTVQATCMTLTAMSVDRCYVTVYPIRSLQHRTPCLAACISIGIWIGSLVMSLPMALYHKTDTKEW------YGPKTYCFDAFPSVPHEHAFVLYSFVLVYMLPLVTISVCYSIMIKKIGRPAVEPQDDNVQLQMLTERNEATRAKVTRMVVVVVLVFMLCWGPIQLFILFQSFYPHFAISYTTYKLKTWANCMSYANSSINPFVYCFMGDSFRKTFKK 329          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Sea Lamprey
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 73.559 bits (179), Expect = 6.189e-15
Identity = 77/288 (26.74%), Postives = 150/288 (52.08%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVT-----RSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSK--KAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKK 983
            +L   +G  GN++VI V+       SSN  T TN ++++L++AD+C ++  V    T +   +D W  G+FLC  + F+ +     SS ++   S++R++AI +P++++ L T ++A  +I  IW    ++     YL++ +   F N  M    C     ++  K + M   +  Y +P+ ++ + Y   +  L+ +     +     +++++ +V  M+++V  LF   WLP+  L++Y  F      +  Y FRL +  M   NS +NP++Y  +S+ FR+ F+K
Sbjct:   33 LLIFLLGAFGNSLVIIVLLCSGQRGSSN--TTTNIFILNLSVADLCFILFCVPFQATIYT--LDGWIFGSFLCKAVHFIIFLTMFASSFTLAAVSVDRYLAIRYPLRSRELRTPRKAAAVIAAIWGLALVFAGP--YLSYYQAVTFQNMSM----CMPVWAKEPRKLMDMVTFVCGYLVPVSVLGLAYAFTLKYLWTAV--DPLEEMSESKRAKRKVTTMILIVAGLFCACWLPHHVLILYFWFGHFPLTHATYAFRLLSHCMSYANSCLNPLVYALVSKHFRKGFRK 308          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Sea Lamprey
Match: galr1a (galanin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-290])

HSP 1 Score: 67.0106 bits (162), Expect = 8.520e-13
Identity = 78/288 (27.08%), Postives = 146/288 (50.69%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTR----SSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKT----KRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYED--YWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKIL 989
            +G VGN++VI V+ R     S+ IT  N ++++L++AD+  L   V    T +  P   W  GAFLC  + ++       S  ++   S++R++AI    +A  + +++RA   +  +     L  ++ +  AH  T    K   N    +E  + +  +  Y+A+  S   L Y LPLV+I   Y  +   +F  + R S    D  ++S  Q  K ++V+V++F+V WLP+  ++++  F      +  + FR+ A  +   NS +NP +Y  +S+ FR +++++L
Sbjct:   52 LGIVGNSLVILVLVRIKFGKSHSIT--NVFVLTLSVADLTFLFFCVPSEATYYFLP--DWVFGAFLCKGVPYVFTASMLVSIFTLVAMSVDRYIAIVHARRAAAVRSVRRA---LGAVSALWLLSLVLAVPRAHYHTIVVYKEHGN--FCWEVWSHKNLKSTYRAVIFS---LGYLLPLVLISACYARVGSTVF--TCRDSAELVDETKQSVRQTAKTVLVLVVVFLVSWLPHHVILLWVEFGSFPLTNASFAFRIVAHCLSYGNSCVNPFIYGFLSQNFREAYRQLL 325          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Sea Lamprey
Match: oprk1 (opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE-030729-1])

HSP 1 Score: 62.3882 bits (150), Expect = 2.330e-11
Identity = 84/301 (27.91%), Postives = 143/301 (47.51%), Query Frame = 3
Query:  195 TRSSNMITPTNCYLVSLAIADICLLIVTVLP-NITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKR--------FPNSLMSYEK----CTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNS----FSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILH--------KGIIGIRGRP 1022
            TR + M T TN Y+ +LA+AD   L+ T LP    +++  +  W  G  +C +++ + YY   TS  ++T  S++R++A+C P+KA    T  +A++I ICIW       +  + +   K +         FP+  + +E     C F               I  + LP++II V Y   +MVL   ++R   GS +++R  R ++ +M+++VV +FV+ W P    V+  S             W+   A  +   NS +NP+LY  + E F+R FK+           +G   + GRP
Sbjct:    1 TRYTKMKTATNTYIFNLALADT--LVTTTLPFQSADYL--MGSWPFGEVICKVVMSIDYYNMFTSIFTLTIMSVDRYIAVCHPVKALDFRTPSKAKLINICIWILSSAIGIPVIVMGTAKKEEGIIECILDFPHPAVKWENLLKICVF---------------IFAFILPVLIIVVCYS--LMVLRLRTVRLLSGSKEKDRNLR-RITRMVLIVVAIFVICWTPIHLFVIIKSRVSISDTPTVSAAWYICVA--LGYTNSCLNPVLYAFLDENFKRCFKEFCFPAAFRRDLQGSSRVGGRP 277          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Nematostella
Match: EDO42883 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S011])

HSP 1 Score: 81.6481 bits (200), Expect = 1.070e-17
Identity = 87/285 (30.53%), Postives = 137/285 (48.07%), Query Frame = 3
Query:  168 GNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS-----SMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLM---------NSAINPILYNAMSEKFRRSFK 980
            GN +VI V++R  NM T TN  L++L IAD+ L+    LP +T  +   DHW  G F+C I+ F Q      S L +T  S+ER++ +C   K+  +    R   II  + +   +   + L +A T       S+   E C       +     +  + LFYF+PL+++  LY  I   LF+S     SMR SI S+     S+ ++ K+ + +++ F + W P   L +   FS+   E Y       NM++          N A+NP+LY  MS+ FR + K
Sbjct:   11 GNCLVIYVISRVHNMKTSTNTLLLNLCIADL-LIAAFYLPFVTVDLYITDHWIFGGFMCRIVSFSQSVGTKASILILTALSLERYLTVC---KSNLVIVTARNTCIICIVLWGVAIAFTLPLLIAKTTI-----SIEENEYCIESWTSSHAIIYTLVVLTLFYFVPLIVMTALYAKIGKKLFRSTRRTNSMRLSISSNKLTVTSKARLTKICVTIILSFALSWAPTHILTLVYYFSEMTPESYTI----VNMIIFPIVSCVAFSNCALNPLLYCYMSQNFRNALK 282          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Nematostella
Match: EDO50045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF68])

HSP 1 Score: 68.9366 bits (167), Expect = 2.124e-13
Identity = 84/295 (28.47%), Postives = 147/295 (49.83%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMIT----PTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLY-----NMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLM---NSAINPILYNAMSEKFRRSFKKIL 989
            +  LTVG  GN MV  VV ++  + +        YL+SLA AD+C+ ++ +   I  +   +  W  GA +C ++  LQ    S S  ++T  + ER+ AI  PMKA+    I R ++ I+ +      +      +    LA   T+  P +    E     +HR+ Y  +  S     Y +PL+IIF  YV +++ L     +RS   ++ +RK+R + +++L+ VV++F + +LP  ++ +   F       Y F +  + M L+    S  NPI+Y A+ E FR+ +++IL
Sbjct:    7 VFILTVG--GNIMVCIVVLKNKKLRSFQRFYNGYYLMSLACADLCVALLCIPFTIVYYETGV--WPFGAAICKMVPTLQVTSVSASIFTLTVMTYERYQAIVRPMKAQ----ITRRKVFIMLVSAWLAAFVTGSPEIFAFQLAQNTTEHLPCN----EYWPQPIHRQIYTMVLFSCT---YLVPLLIIFPAYVKMIITL-----KRSHSFNNSDRKARWRSLRVLMAVVMIFAISYLPQHSMFIALDFGHAKSFRY-FEITLKYMYLLIWVASCSNPIIYGALDEYFRQGYRRIL 280          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Nematostella
Match: EDO40944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Q4])

HSP 1 Score: 67.3958 bits (163), Expect = 8.687e-13
Identity = 84/286 (29.37%), Postives = 137/286 (47.90%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNI-TEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMR-RSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSF--SKKAYEDYW-FRLFARNMVLMNSAINPILYNAMSEKFRRSFKK 983
            ++   +  VGN++V  V+ R   M T TN ++++LAIAD+ L  + +  +I  + MN +  W  G F+C IL  LQ      S  ++T  S+ R+ AI  P++ + L      RII+          +     L+H        SL   E       RK Y A+     +  Y LPL +I   Y+ I + L +   R RS G  D + +   +V++ML VV ++F V  LP   + ++  F  +++ Y+ +W    F   +   NSA NPI Y  ++E +R+ FK 
Sbjct:    1 VIIFLISAVGNSLVCIVILRRRRMKTVTNYFVLNLAIADLALTCICIPFDIPVQEMNYV--WPYGGFMCKILYPLQTLSLFASVFTLTAVSLTRYWAIVHPLR-QQLSVSNSKRIIVAIWVISIIPVSPYSYVLSHED-----GSLSCEENWGDTSMRKVYTAVLF---MFQYVLPLTVIAGAYIGIGIELRKRQTRDRSGGLRDVHAEETRKVLRMLKVVTVVFAVFVLPTNIMWLWLDFGHAEQEYDRFWDLVAFCNIVTFANSAANPICYTVLNETYRKEFKS 275          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Nematostella
Match: EDO36473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH8])

HSP 1 Score: 64.6994 bits (156), Expect = 7.473e-12
Identity = 77/295 (26.10%), Postives = 122/295 (41.36%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDH----WQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFP--NSLM---SYEKCTFRLHRKYYKAIYMSDIILF-YFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSF---------SKKAYEDYW-FRLFARNMVLMNSAINPILYNAMSEKFRRSFK 980
            +  VGN MV  ++ R   M T TN ++++LA+AD+ L  + +      F  P+      W  GA +C +L  LQ      S  ++T   + R+ AI  PMK +   T  +             +   +WL    +    FP  NSL        C      K  + I+ + I +F Y LPL +I   Y  I        +RR   +   N K R    +    VV +  V+ + +   V+ N+          + +  E +W    F   +   NSA NP+ Y A++E +RR FK
Sbjct:   20 ISAVGNTMVCAIIVRRKKMKTVTNYFILNLAVADLALTCICI-----PFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVGLTRYWAIVHPMKRQLSITQSK------------LVIAFIWL---GSVVPVFPYANSLKFTRETHTCEEYWSSKKVREIFTAVIFVFQYVLPLGVIGTAYAAI-----GRELRRRKATKSGNHKLRHLQAQEARKVVNMLSVVTMVFAICVLPNNIMWLWLDFGDADQKVEYFWEIVAFCNVVTFANSAANPVCYTALNETYRREFK 289          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Nematostella
Match: EDO33974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR4])

HSP 1 Score: 63.5438 bits (153), Expect = 1.632e-11
Identity = 75/287 (26.13%), Postives = 140/287 (48.78%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKC--TFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSI-GSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWF--RLFARNMVLM--NSAINPILYNAMSEKFRRSFK 980
            +L   +G +GN +V  VV R   M   TN ++V+LA AD+ +L++ +  +  E +   ++W  G+ +C ++  LQ    + S  ++   S+ R++AI +P++ +   T  +             +  ++W+      +       M  + C  TF        A  M+  +L Y LPL +I + Y      +    MRRS+ G   +  K   +V+K+L  VVI F +L LP   + ++  F +    D+ +  ++ +   +L+  NSA NP++YNA++E+FR  F+
Sbjct:    2 VLIFIIGVIGNILVCLVVCRQRKMKNVTNYFIVNLAAADLAVLLICIPFDFGEIIT--NYWPYGSIMCKLVYPLQTMATTASVGTLVAISLNRFMAIVYPLRPQLTTTDAKK------------VITVVWVLSLALVSPYIAVLRMRGQHCQETFEERGMQAGAYTMAIFLLQYVLPLTLIGLSYTDPGTHILAHYMRRSLRGHQQKALKKAHKVVKVLTGVVITFALLMLPNHVVFIWIDFGRGGGCDHEYVNQIVSLGQILVYFNSATNPLIYNAVNEQFREGFR 274          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Medaka
Match: trhr (thyrotropin releasing hormone receptor [Source:NCBI gene;Acc:100533508])

HSP 1 Score: 199.134 bits (505), Expect = 1.343e-60
Identity = 129/294 (43.88%), Postives = 180/294 (61.22%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF--------QSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXX-----XPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
            VG VGN MVI VV  + +M TPTNCYLVSLA AD+ +L    LPNIT+ +     W  G   C  + + QY   + SS SIT F++ER++AIC P+KA+ LCT+ RA+ II+ +W    +Y +MWL+L+ TK   + N ++    C +++ R +Y  IY +D  +FY LPL++  VLY  I  +LF        ++S  R  G S R   SR Q  +  +  ++  VV+      +PYRTLVV NSF +KAY D WF LF R  + +NSAINP++YNAMS+KFR +FKK+   G
Sbjct:   39 VGIVGNMMVILVVLTTKHMRTPTNCYLVSLAAADLMVLTAAGLPNITDALR--GQWVYGYAGCLGITYFQYLGINASSCSITAFTVERYIAICHPIKAQFLCTLSRAKKIIMLVWALTSVYCVMWLFLSDTKKLVYDNVVL--LTCAYKVSRSHYLPIYFTDFTVFYVLPLLLATVLYGLIARILFLNPLPADPKASSSRGCGDSQRRESSRRQEPQPGVTKMLAVVVVLFAVLWMPYRTLVVVNSFLEKAYLDTWFLLFCRLCIYLNSAINPVIYNAMSQKFRTAFKKLCQCG 328          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Medaka
Match: trhr1b (TRHR1b protein [Source:NCBI gene;Acc:100533509])

HSP 1 Score: 187.193 bits (474), Expect = 1.905e-55
Identity = 135/301 (44.85%), Postives = 185/301 (61.46%), Query Frame = 3
Query:  159 GCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF------QSSMRRSIGS------------SDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIG 1007
            G VGN MVI VV  + +M TPTNCYLVSLA+AD+ +L    LP IT+ +     W  G + C  + + QY   + SS SIT F+IER++AIC P+KA+ LCT+ RA+ II+ +W    +Y +MW YL+  +   + N  ++   C +R+ RK+Y  +Y  D  +F+ LPL++  VLY  I  +LF      +   ++  G+            S     SR QV KML VVVILF VLW+PYRTLVV NSF  +AY D WF LF R  + +NSAINP++YNAMS+KFR +F+KI H G+ G
Sbjct:   39 GIVGNIMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPAITDSI--FATWVFGRYGCLCITYFQYLGINASSCSITAFTIERYIAICHPIKAQFLCTLSRAKKIILFVWAFTSIYCVMWFYLSDIQELVYEN--ITIITCGYRVPRKFYLPVYFFDFGVFFVLPLLLSAVLYGLIARILFLNPLPSEHKAKKKSGANNPKTSCKNSRHSSSTATSRRQVTKMLAVVVILFAVLWMPYRTLVVVNSFLDQAYLDSWFLLFCRICIYLNSAINPVIYNAMSQKFRAAFQKICHCGMKG 335          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Medaka
Match: trhr (thyrotropin releasing hormone receptor [Source:NCBI gene;Acc:100533508])

HSP 1 Score: 185.652 bits (470), Expect = 8.501e-55
Identity = 136/303 (44.88%), Postives = 185/303 (61.06%), Query Frame = 3
Query:  156 VGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSM------------RRSIGSSDR----------NRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKG 998
            VG VGN MVI VV  + +M TPTNCYLVSLA AD+ +L    LPNIT+ +     W  G   C  + + QY   + SS SIT F++ER++AIC P+KA+ LCT+ RA+ II+ +W    +Y +MWL+L+ TK   + N ++    C +++ R +Y  IY +D  +FY LPL++  VLY  I  +LF + +            +R    + R             SR QV KML VVV+LF VLW+PYRTLVV NSF +KAY D WF LF R  + +NSAINP++YNAMS+KFR +FKK+   G
Sbjct:   47 VGIVGNMMVILVVLTTKHMRTPTNCYLVSLAAADLMVLTAAGLPNITDALR--GQWVYGYAGCLGITYFQYLGINASSCSITAFTVERYIAICHPIKAQFLCTLSRAKKIIMLVWALTSVYCVMWLFLSDTKKLVYDNVVL--LTCAYKVSRSHYLPIYFTDFTVFYVLPLLLATVLYGLIARILFLNPLPADPKGASSHKWKREASQAGRMISASSSSSTTASSRRQVTKMLAVVVVLFAVLWMPYRTLVVVNSFLEKAYLDTWFLLFCRLCIYLNSAINPVIYNAMSQKFRTAFKKLCQCG 345          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Medaka
Match: trhr2 (TRHR2 protein [Source:NCBI gene;Acc:100533510])

HSP 1 Score: 182.185 bits (461), Expect = 5.238e-54
Identity = 130/305 (42.62%), Postives = 185/305 (60.66%), Query Frame = 3
Query:  141 ILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS-----------SMRRSI---------GSSDRNR---KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKI 986
            +L   VG +GN MV+ VV  + +M TPTNCYLVSLAIAD+ +L+   LPN+++ +     W  G   C  + +LQY   + SS SIT F++ER++AIC PMKA+T+CT+ RA+ II  +W    +Y M+WL+L   +    P+    + +C +R+ R+ Y  IY+ D  +FY +PL++  VLY  I  +L+ S           ++RRS          G   R +    SR QV KML VVVILF +LW+PYRTLV+ NSF    Y + WF LF R  +  NSAINP++YNAMS+KFR +F+ +
Sbjct:   30 LLVCGVGIIGNVMVVLVVFTTRHMRTPTNCYLVSLAIADLTVLVAAGLPNVSDSLT--GTWIFGQAGCLGITYLQYLGINVSSCSITAFTVERYIAICHPMKAQTVCTVSRAKRIIAGVWIFTCVYCMLWLFLVDIQVG--PD---GHVQCGYRVKRELYLPIYLIDFAIFYVIPLLLAIVLYALIARILYLSPLPHQPDTSATTLRRSCRDTSEAARPGRQGRPKSALSSRKQVTKMLAVVVILFALLWMPYRTLVLINSFVSTPYLNAWFLLFCRTCIYANSAINPVIYNAMSQKFRLAFRGL 327          
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Medaka
Match: trhr3 (TRHR3 protein [Source:NCBI gene;Acc:100533511])

HSP 1 Score: 182.57 bits (462), Expect = 6.633e-54
Identity = 135/313 (43.13%), Postives = 186/313 (59.42%), Query Frame = 3
Query:  138 SILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQS---SMRRSIGS---------SDRNRKS---RXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYN 1031
            ++L   VG  GN MV+ VV R+ +M+TPTNCYLVSLA+AD+ +L+   LPNI++    +  W  G   C  + +LQY   + SS SIT F+IER++AIC  +KA+ +CT+ RA+ II  +W    LY  MW +L       + N ++    C +R+ R  Y  IY  D  +FY +PL++  VLY  I  +LF S   S R   GS         S  N+ +   R Q+ KML+VVV+LF +LW+PYRTLVV NSF    Y D WF LF R  +  NSAINPI+YN MS+KFR +F+K+   G    RG  +Y+
Sbjct:   35 TLLICGVGIAGNVMVVLVVLRTKHMVTPTNCYLVSLAVADLIVLLAAGLPNISDV---VACWIYGYTGCLFITYLQYLGINVSSCSITAFTIERYIAICHSIKAQFICTVSRAKRIIAGVWIFTSLYCTMWFFLVDIDETVYANGVVV--NCGYRVSRSLYMPIYFLDFTVFYVVPLIVATVLYGLIARILFISPLPSDRAGGGSVHQGHYNSTSSANKGAIAARKQITKMLVVVVVLFALLWMPYRTLVVINSFIDPPYHDTWFILFCRMCIYSNSAINPIIYNLMSQKFRVAFRKLCKCGC--RRGEAKYD 340          
BLAST of Thyrotropin-releasing hormone receptor vs. Planmine SMEST
Match: SMESG000066580.1 (SMESG000066580.1)

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 330/330 (100.00%), Postives = 330/330 (100.00%), Query Frame = 3
Query:   48 MFNNXXXXXXXXXXXLKYYQPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNVI 1037
            MFNNSSYESFSQLSSLKYYQPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYCCSTSSLSITFFSIERWVAICFPMKAKTLCTIKRARIIIICIWFCCFLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRIQVIKMLIVVVILFVVLWLPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNVI
Sbjct:    1 MFNNSSYESFSQLSSLKYYQPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYCCSTSSLSITFFSIERWVAICFPMKAKTLCTIKRARIIIICIWFCCFLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRIQVIKMLIVVVILFVVLWLPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYNVI 330          
BLAST of Thyrotropin-releasing hormone receptor vs. Planmine SMEST
Match: SMESG000036494.1 (SMESG000036494.1)

HSP 1 Score: 266.929 bits (681), Expect = 2.810e-87
Identity = 157/313 (50.16%), Postives = 221/313 (70.61%), Query Frame = 3
Query:   93 LKYYQPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFKKILHKGIIGIRGRPRYN 1031
            +K++  LY+++   QS+  L +G +GN MVI VV R +   +PTN YL++LA AD+  L VT++PNI E   PI+HW LG FLC +LVFLQYY C+TS + IT FS ERWVAIC+PMKA+ +  I + R+II   W   F+Y+  W YLA T  ++   ++  ++KCTFR +R+YYK IY+ D  +FYFLPL+++ V Y+HI   L+      ++ +  ++R SRIQ+IKML++V I F +L LPYRTLVVYNSFSKK + D+WF LF++NM+L+NSA+NPI YN MSE FRR+FKK++ + I G +  P +N
Sbjct:   13 IKHFSHLYVFINAFQSLNLLVIGSLGNIMVIIVVLRRAVSGSPTNLYLLTLAAADLIFLNVTIIPNIIELNYPINHWHLGTFLCPVLVFLQYYSCNTSVIFITLFSHERWVAICYPMKARLVSNIDKVRVIIWSTWISSFIYHSAWFYLAKTNIEKI--NMKYFQKCTFRFNREYYKFIYIFDASMFYFLPLLLMSVFYIHIAYTLYVQK-PFNLHTFSKSRSSRIQIIKMLMLVSISFAILCLPYRTLVVYNSFSKKKFLDFWFLLFSKNMMLLNSAVNPIFYNVMSENFRRAFKKLILQIIFGTKFNPSHN 322          
BLAST of Thyrotropin-releasing hormone receptor vs. Planmine SMEST
Match: SMESG000076461.1 (SMESG000076461.1)

HSP 1 Score: 185.267 bits (469), Expect = 1.322e-55
Identity = 130/270 (48.15%), Postives = 179/270 (66.30%), Query Frame = 3
Query:  159 GCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKRFPNSLMSYEK-CTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNR---KSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYNAMS 956
            G +GN  V  ++T + NM + TNCYLVS+A+ADI +L+ T++P +      I+   L ++ C+++++LQY   ++S+L+IT FS ERWVAIC+PMKA T+CTI RA  I+I IW    +YN  W+YL     K   N   SY+  CTFR  R+ Y  IYM D +LFY +PL++   LY  I+  L +  M  +    D  +    S++QV+KML+ VVILF +LWLPYR L+VYNSF+ K+Y D WF LFAR MV +NSAINPILYNA+S
Sbjct:   45 GLIGNLSVSIILTFAKNMQSSTNCYLVSVAVADILVLLSTIVPFLYNINQDINISLLPSWGCSLIIYLQYLSVNSSALTITSFSFERWVAICYPMKAHTMCTISRAVKIVIGIWIFNLIYNSSWIYLTGIVKKGPLNG--SYKSVCTFRFERRKYMNIYMFDFMLFYCIPLLLTTFLYCAIIRTLVKRPMSGTTSGRDPRKHMNHSKMQVVKMLMAVVILFAMLWLPYRALMVYNSFASKSYLDLWFLLFARIMVFINSAINPILYNALS 312          
BLAST of Thyrotropin-releasing hormone receptor vs. Planmine SMEST
Match: SMESG000077152.1 (SMESG000077152.1)

HSP 1 Score: 149.058 bits (375), Expect = 1.395e-42
Identity = 92/217 (42.40%), Postives = 140/217 (64.52%), Query Frame = 3
Query:   99 YYQPLYIWLGCIQSILYLTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTKTKR-FPNSLMSYEKCTFRLHRKYYKAIYMSDIILFYFLPLVIIFVLYVHIVMVLF--QSSMRRSIG 740
            YY  +Y  +G I  ++ L++G +GN +V+ VV  S  M TPTNC+LVSL+IAD+  L+ ++LP I+E+ + +++W+    LC I VFLQ+   + S++SIT FS ERW+AIC P+ A+ +CT+ RA  II  IW    LYN  WLYL   K +  + NS +    CT+RL+ +Y + +Y+ D+I+FY  PL++  VLY+ IV+ L   + S  R +G
Sbjct:   21 YYSNIYKIIGTINLMVILSLGIIGNFLVVIVVYFSRGMHTPTNCFLVSLSIADMITLLSSILPVISEYHSKMNYWRFAPELCPITVFLQFCSANASAMSITCFSFERWMAICKPLTAQVMCTLTRAVKIIFGIWVFNLLYNSSWLYLTTLKYRESYINSSILNPVCTYRLNPEYLRIVYLCDLIIFYITPLIVTSVLYIDIVLTLLNKKDSKLRIVG 237          
BLAST of Thyrotropin-releasing hormone receptor vs. Planmine SMEST
Match: SMESG000044227.1 (SMESG000044227.1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.249e-21
Identity = 100/309 (32.36%), Postives = 164/309 (53.07%), Query Frame = 3
Query:  132 IQSILY---LTVGCVGNAMVITVVTRSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDH---WQLGAFLCTILVFLQYYXXXXXXXXXXXXXXERWVAICFPMKAKTLCTIKRARXXXXXXXXXXXLYNMMWLYLAHTK-TKRFPNSLMSYEKCTFRLHRKYYKAIYMSDI------------------ILFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRXXXXXXXXXXXXXXXXXXXPYRTLVVYNSFSKKA-YEDYWFRLFARNMVLMNSAINPILYNAMSEKFRRSFK 980
            +Q ++Y   LT G  GN    TV+  +  + T TN YL +LA++DI LL++T LP  +E +  + +   W LG F C +   L       S L+IT F+IER++AIC P+K + + T++R+  ++I IW    L+++ +  L        FPN   +  +C   L+ + YK I  S++                   LF+ +PL ++ VLY HI + L++  + RS  S+  + + R  VI+MLI VVI F + W P+ T  +  +F       D+     + ++  M+S +NPI+YN +S KFR++FK
Sbjct:    8 LQGLIYTCVLTFGFCGNICTCTVIISNKYLHTTTNIYLFNLAVSDI-LLLLTGLP--SEILYSVGNGYPWILGNFYCHLRAMLLEMSSIVSVLTITAFTIERYIAICHPLKQQIISTMQRSFFVVIFIWLISSLFSLPYGVLCKLDYMLTFPNMTANNSECFDALNSEVYKPIEDSNLCVGPRNSSFFNYIIRTSTFLFFLIPLAVLLVLYFHIALTLWRRKITRSHLSN--HSRGRNGVIRMLIFVVIAFFISWAPFHTQRILATFRHSVDILDFIIYYLSGSLFYMSSVLNPIVYNIISSKFRKAFK 311          
The following BLAST results are available for this feature:
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRHR3.706e-5141.91thyrotropin releasing hormone receptor [Source:HGN... [more]
TRHR3.706e-5141.91thyrotropin releasing hormone receptor [Source:HGN... [more]
BRS33.807e-1728.28bombesin receptor subtype 3 [Source:HGNC Symbol;Ac... [more]
OPRK15.557e-1631.36opioid receptor kappa 1 [Source:HGNC Symbol;Acc:HG... [more]
OPRK15.557e-1631.36opioid receptor kappa 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trhr-11.267e-4238.62Thyrotropin-Releasing Hormone Receptor [Source:Un... [more]
npr-154.344e-1427.27Neuropeptide receptor 15 [Source:UniProtKB/Swiss-... [more]
nmur-25.678e-1330.28NMUR (NeuroMedin U Receptor) homolog [Source:UniP... [more]
npr-341.693e-1128.63NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
frpr-181.960e-925.25FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ETHR7.149e-2432.77gene:FBgn0038874 transcript:FBtr0084054[more]
ETHR7.149e-2432.77gene:FBgn0038874 transcript:FBtr0339194[more]
ETHR8.040e-1930.19gene:FBgn0038874 transcript:FBtr0084053[more]
PK2-R11.691e-1328.48gene:FBgn0038140 transcript:FBtr0082745[more]
TrissinR5.324e-1329.59gene:FBgn0085410 transcript:FBtr0330222[more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trhra8.049e-6048.45thyrotropin-releasing hormone receptor a [Source:Z... [more]
trhra4.257e-5846.53thyrotropin-releasing hormone receptor a [Source:Z... [more]
trhra5.991e-5846.53thyrotropin-releasing hormone receptor a [Source:Z... [more]
trhra9.498e-5846.53thyrotropin-releasing hormone receptor a [Source:Z... [more]
trhrb5.794e-5142.32thyrotropin-releasing hormone receptor b [Source:Z... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000016730.13.539e-5241.25thyrotropin-releasing hormone receptor 3 [Source:N... [more]
ENSXETT00000016751.15.089e-5241.25thyrotropin-releasing hormone receptor 3 [Source:N... [more]
ENSXETT00000031646.17.992e-5241.25thyrotropin-releasing hormone receptor 3 [Source:N... [more]
kiaa1324l2.225e-4942.57KIAA1324-like [Source:Xenbase;Acc:XB-GENE-5954588][more]
epx9.926e-4639.40eosinophil peroxidase [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trhr2.018e-5142.57thyrotropin releasing hormone receptor [Source:MGI... [more]
Trhr2.018e-5142.57thyrotropin releasing hormone receptor [Source:MGI... [more]
Trhr2.018e-5142.57thyrotropin releasing hormone receptor [Source:MGI... [more]
Trhr22.673e-5142.23thyrotropin releasing hormone receptor 2 [Source:M... [more]
Nmur15.599e-1828.75neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28596|TRFR_SHEEP1.394e-5142.24Thyrotropin-releasing hormone receptor OS=Ovis ari... [more]
sp|O93603|TRFR_CHICK1.589e-5142.48Thyrotropin-releasing hormone receptor OS=Gallus g... [more]
sp|O46639|TRFR_BOVIN1.722e-5141.91Thyrotropin-releasing hormone receptor OS=Bos taur... [more]
sp|P21761|TRFR_MOUSE1.411e-5042.57Thyrotropin-releasing hormone receptor OS=Mus musc... [more]
sp|P34981|TRFR_HUMAN1.780e-5041.91Thyrotropin-releasing hormone receptor OS=Homo sap... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K0PUG32.760e-7251.29EFLGamide receptor 1 OS=Platynereis dumerilii OX=6... [more]
R7TCJ01.731e-6550.16G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A210QHU71.223e-6446.79Thyrotropin-releasing hormone receptor OS=Mizuhope... [more]
A0A3Q0KMD91.724e-6444.41Putative thyrotropin-releasing hormone receptor OS... [more]
A0A430QN941.786e-6343.49Thyrotropin-releasing hormone receptor OS=Schistos... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRHR1.704e-5743.04thyrotropin-releasing hormone receptor [Source:NCB... [more]
ENSAMXT00000054912.11.027e-5443.46thyrotropin-releasing hormone receptor-like [Sourc... [more]
trhrb6.940e-5342.17thyrotropin-releasing hormone receptor-like [Sourc... [more]
trhr22.782e-4942.35thyrotropin-releasing hormone receptor-like [Sourc... [more]
oprk18.720e-1729.51delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trhrb2.439e-4841.23thyrotropin-releasing hormone receptor b [Source:Z... [more]
kiss1rb1.420e-1528.24KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
galr2a6.189e-1526.74galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
galr1a8.520e-1327.08galanin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
oprk12.330e-1127.91opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428831.070e-1730.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500452.124e-1328.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409448.687e-1329.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364737.473e-1226.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339741.632e-1126.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trhr1.343e-6043.88thyrotropin releasing hormone receptor [Source:NCB... [more]
trhr1b1.905e-5544.85TRHR1b protein [Source:NCBI gene;Acc:100533509][more]
trhr8.501e-5544.88thyrotropin releasing hormone receptor [Source:NCB... [more]
trhr25.238e-5442.62TRHR2 protein [Source:NCBI gene;Acc:100533510][more]
trhr36.633e-5443.13TRHR3 protein [Source:NCBI gene;Acc:100533511][more]
back to top
BLAST of Thyrotropin-releasing hormone receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066580.10.000e+0100.00SMESG000066580.1[more]
SMESG000036494.12.810e-8750.16SMESG000036494.1[more]
SMESG000076461.11.322e-5548.15SMESG000076461.1[more]
SMESG000077152.11.395e-4242.40SMESG000077152.1[more]
SMESG000044227.11.249e-2132.36SMESG000044227.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005527 ID=SMED30005527|Name=Thyrotropin-releasing hormone receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1065bp
TTTACTTAACTTGTTTGAAATTATAATGAATTGAACTGAGTAAAGAAATG
TTTAATAATTCTTCTTATGAAAGCTTTTCCCAATTGTCGTCTTTGAAGTA
TTATCAACCCCTGTACATATGGCTAGGCTGTATTCAAAGCATTCTTTATT
TGACTGTTGGATGTGTTGGAAATGCAATGGTTATAACAGTCGTGACTCGA
TCTTCAAATATGATAACTCCGACAAATTGTTATCTTGTATCTTTGGCAAT
AGCCGATATTTGTTTGCTAATAGTGACAGTGTTACCAAACATAACAGAGT
TTATGAATCCCATAGATCATTGGCAATTGGGCGCTTTTCTCTGTACGATT
TTGGTGTTTCTTCAATACTATTGTTGCAGTACGAGTTCATTGTCGATTAC
GTTTTTCTCCATTGAACGCTGGGTAGCAATTTGTTTTCCCATGAAAGCGA
AAACGTTGTGCACAATCAAACGGGCTCGAATAATAATCATTTGTATTTGG
TTCTGTTGTTTTCTCTACAATATGATGTGGCTGTATTTGGCCCACACGAA
AACCAAAAGATTTCCAAACAGTCTCATGAGCTATGAAAAATGTACTTTTC
GATTACACAGAAAATATTACAAGGCGATTTATATGAGCGATATTATTTTA
TTTTATTTTCTTCCATTAGTCATTATTTTTGTATTATATGTGCACATTGT
CATGGTCTTGTTTCAAAGCAGCATGCGCCGATCGATTGGATCCAGTGATC
GTAATAGAAAATCTAGAATTCAAGTAATTAAAATGCTAATAGTTGTGGTT
ATTCTATTCGTCGTACTCTGGCTTCCATATCGCACTTTAGTTGTATATAA
TAGTTTCAGCAAAAAGGCTTATGAAGATTATTGGTTTCGGCTATTTGCTA
GAAATATGGTCCTAATGAATTCTGCAATCAATCCGATTTTGTACAATGCA
ATGTCCGAAAAGTTCCGCAGATCATTCAAAAAAATTCTACATAAAGGTAT
TATAGGAATTCGTGGTCGTCCTCGATACAATGTTATTTGAACGGACTAAT
AATTTTTCGCTGCAA
back to top

protein sequence of SMED30005527-orf-1

>SMED30005527-orf-1 ID=SMED30005527-orf-1|Name=SMED30005527-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=331bp
MFNNSSYESFSQLSSLKYYQPLYIWLGCIQSILYLTVGCVGNAMVITVVT
RSSNMITPTNCYLVSLAIADICLLIVTVLPNITEFMNPIDHWQLGAFLCT
ILVFLQYYCCSTSSLSITFFSIERWVAICFPMKAKTLCTIKRARIIIICI
WFCCFLYNMMWLYLAHTKTKRFPNSLMSYEKCTFRLHRKYYKAIYMSDII
LFYFLPLVIIFVLYVHIVMVLFQSSMRRSIGSSDRNRKSRIQVIKMLIVV
VILFVVLWLPYRTLVVYNSFSKKAYEDYWFRLFARNMVLMNSAINPILYN
AMSEKFRRSFKKILHKGIIGIRGRPRYNVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004997thyrotropin-releasing hormone receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: INTERPRO
TermDefinition
IPR002120TRH_rcpt_1
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 195..218
score: 26.15
coord: 243..267
score: 29.05
coord: 106..128
score: 24.28
coord: 142..163
score: 19.03
coord: 26..50
score: 22.13
coord: 281..307
score: 28.62
coord: 59..80
score: 31.27
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 35..314
e-value: 0.0045
score: -64.2
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 41..299
e-value: 1.9E-48
score: 165.1
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 112..128
IPR002120Thyrotropin-releasing hormone receptorPRINTSPR01846TRHRFAMILYcoord: 281..292
score: 45.83
coord: 238..247
score: 64.29
coord: 303..316
score: 43.37
coord: 267..277
score: 36.36
coord: 98..114
score: 32.35
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 14..321
e-value: 2.6E-73
score: 248.7
NoneNo IPR availablePANTHERPTHR46061FAMILY NOT NAMEDcoord: 31..227
coord: 225..315
NoneNo IPR availableCDDcd149957tmA_TRH-Rcoord: 29..310
e-value: 1.81581E-85
score: 256.543
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 3..318
NoneNo IPR availableTMHMMTMhelixcoord: 243..265
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 23..45
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
NoneNo IPR availableTMHMMTMhelixcoord: 280..302
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 41..299
score: 42.739