Alpha-actinin

Overview
NameAlpha-actinin
Smed IDSMED30005523
Length (bp)2850
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-actinin (SMED30005523) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-actinin (SMED30005523) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-actinin (SMED30005523) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-actinin (SMED30005523) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005523

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005523SMESG000026000.1 Contig38860uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005523SMESG000026000.1 Contig38860newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005523SMESG000026000.1 Contig42247uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005523SMESG000026000.1 Contig42247newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005523SMESG000066927.1 SMESG000047299.1 SMESG000026000.1 Contig4157uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005523SMESG000066927.1 SMESG000047299.1 SMESG000026000.1 Contig4157newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005523SMESG000051188.1 Contig4157uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005523SMESG000051188.1 Contig4157newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30005523SMESG000026000.1 dd_Smed_v6_1951_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005523SMESG000026000.1 dd_Smed_v6_1951_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005523SMESG000026000.1 dd_Smed_v4_1951_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN1 (actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163])

HSP 1 Score: 1050.04 bits (2714), Expect = 0.000e+0
Identity = 499/905 (55.14%), Postives = 664/905 (73.37%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRA-------SVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE  EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE  RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q S L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+DH+  L P EFKACL+SLGY++  D    +   +    RA       ++GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PYTGP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQKKTGMMDTDDFRACLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 914          
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN1 (actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163])

HSP 1 Score: 1046.96 bits (2706), Expect = 0.000e+0
Identity = 497/898 (55.35%), Postives = 658/898 (73.27%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE  EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE  RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q S L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+DH+  L P EFKACL+SLGY++  D                 GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PYTGP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQ---------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN4 (actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166])

HSP 1 Score: 1043.88 bits (2698), Expect = 0.000e+0
Identity = 497/882 (56.35%), Postives = 656/882 (74.38%), Query Frame = 2
Query:  125 PLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            P WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LI+Y+ L KD+   NLN AF+VAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  +DR    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W+ LE +EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+  DY  A L +++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  +++ R   I + WD +G L   R E ++   + LE ID LHL++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L DA  E + ++AI K+ + +AE +++  +  NPYT VT Q +  +WE++  LVPKR   L EE ++Q+ +E+LR ++A+ AN VGPW+  + E++  +S   +  +LE+Q S L + E+ ++D++P  + L+Q  Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM+EFR  FNHFDKDH   L P EFKACL+SLGY+++ D+                GEA+F+RIM  VDPN+ G VTF AFIDFM+ ET D D++DQ++ SFKVLAGDK++IT EELRRELP +QAEYCIA M PY GP       DY+SFS +LYG SDL
Sbjct:   46 PAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIE-MNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQ---------------GEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN4 (actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166])

HSP 1 Score: 1043.88 bits (2698), Expect = 0.000e+0
Identity = 497/882 (56.35%), Postives = 656/882 (74.38%), Query Frame = 2
Query:  125 PLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            P WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LI+Y+ L KD+   NLN AF+VAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  +DR    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W+ LE +EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+  DY  A L +++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  +++ R   I + WD +G L   R E ++   + LE ID LHL++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L DA  E + ++AI K+ + +AE +++  +  NPYT VT Q +  +WE++  LVPKR   L EE ++Q+ +E+LR ++A+ AN VGPW+  + E++  +S   +  +LE+Q S L + E+ ++D++P  + L+Q  Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM+EFR  FNHFDKDH   L P EFKACL+SLGY+++ D+                GEA+F+RIM  VDPN+ G VTF AFIDFM+ ET D D++DQ++ SFKVLAGDK++IT EELRRELP +QAEYCIA M PY GP       DY+SFS +LYG SDL
Sbjct:   46 PAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIE-MNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQ---------------GEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN1 (actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163])

HSP 1 Score: 1038.1 bits (2683), Expect = 0.000e+0
Identity = 492/898 (54.79%), Postives = 657/898 (73.16%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE  EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE  RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q S L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+  T M++ ++F+ACL+S+GYN+                    GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PYTGP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNM--------------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 887          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 458/885 (51.75%), Postives = 633/885 (71.53%), Query Frame = 2
Query:  104 EQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKA-VENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLY 2755
            ++  ++DP WEKQQK TFTAWCNSHLRK   +I+ IE+DFR+GLKLM LLEVISGE LPK D+GKMR HKIANVNK L +I  KGVKL  IG+EEIVDGNVKMTLG+IWTIILRFAIQDI +E+LSA++GLLLWCQRKTAPY NV V NFH S+KDGLAFCALIHRHRPDL+DY+ LHK +   NLNLAFD+AEKHLDIP+MLDAEDM   ++PDE +VM YVS YYH FSG +KAETA+NRIC+VL VNQENEK+M +YE L+++LL WI + +P   +RS   +++    KL+++R YR  EKPP+ E+KG+LET +NTLQTRLRLSNRP F+P +   I DIN  W  LE+SEK FEEWL+SE+ RLE+L++L  +F  +C  HE W++GK + L+S D+ +  L +++AL KR +AFESD   H+ RV +I  IA EL  L Y D+  I+AR  +I   WD +G+L ++R E +++  ++ E +DSL+LDFAK+     NW++ A+EDL D  +VH + E++ L++ H QFK +L DA  E+  +  I  +++ L   H L +  + NPYT +++ ++R +W E+ + VP+R  +L+ EL RQ+ +E LR  +A  AN+VGPWL+   E++ ++     +  LE+   +L  +++ V+ ++P  +EL++  QE+ +  +FENR ++YSME +RV WE LL+SI KT NE +NQ+L RDSKG+S EQ+ EFR  F+HFDK+    L+P + ++CL+S+GY ++  ++               G+A+  R++  VDPN  G V F+AF+DFMT E +D+D+ +QM+ SF++LA  K +IT +EL RELP++QA YC+A M P   PG     +DY +FS SLY
Sbjct:   26 DREGLLDPAWEKQQKKTFTAWCNSHLRKAGTSIDTIEEDFRNGLKLMLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDMAN-SQPDEKAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLGG-RGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERAG-LDPEQLRSCLISVGYTIRPGRE---------------GDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLY 892          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 454/908 (50.00%), Postives = 627/908 (69.05%), Query Frame = 2
Query:  116 VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGA---------------------------QKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKA-VENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLY 2755
            ++DP WEKQQK TFTAWCNSHLRK   +I+ IE+DFR+GLKLM LLEVISGE LPK D+GKMR HKIANVNK L +I  KGVKL  IG+EEIVDGNVKMTLG+IWTIILRFAIQDI +E+LSA++GLLLWCQRKTAPY NV V NFH S+KDGLAFCALIHRHRPDL+DY+ LHK +   NLNLAFD+AEKHLDIP+MLDAED+ +   PDE S M YVS +YHAF                              + AETA+NRIC+VL VNQENEK+M +YE L+++LL WI + +P   +RS   +++    KL+++R YR  EKPP+ E+KG+LET +NTLQTRLRLSNRP F+P +   I DIN  W  LE+SEK FEEWL+SE+ RLE+L++L  +F  +C  HE W++GK + L+S D+ +  L +++AL KR +AFESD   H+ RV +I  IA EL  L Y D+  I+AR  +I   WD +G+L ++R E +++  ++ E +DSL+LDFAK+     NW++ A+EDL D  +VH + E++ L++ H QFK +L DA  E+  +  I  +++ L   H L +  + NPYT +++ ++R +W E+ + VP+R  +L+ EL RQ+ +E LR  +A  AN+VGPWL+   E++ ++     +  LE+   +L  +++ V+ ++P  +EL++  QE+ +  +FENR ++YSME +RV WE LL+SI KT NE +NQ+L RDSKG+S EQ+ EFR  F+HFDK+    L+P + ++CL+S+GY ++  ++               G+A+  R++  VDPN  G V F+AF+DFMT E +D+D+ +QM+ SF++LA  K +IT +EL RELP++QA YC+A M P   PG     +DY +FS SLY
Sbjct:   30 LLDPAWEKQQKKTFTAWCNSHLRKAGTSIDTIEEDFRNGLKLMLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDVSR--HPDEKSTMTYVSCFYHAFRNMRDPPPPVIRQPPPQRVVVAPPPERDWRKDAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLGG-RGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERAG-LDPEQLRSCLISVGYTIRPGRE---------------GDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLY 918          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 428/839 (51.01%), Postives = 595/839 (70.92%), Query Frame = 2
Query:  242 MQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGK-AVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLY 2755
            M LLEVISGE LPK D+GKMR HKIANVNK L +I  KGVKL  IG+EEIVDGNVKMTLG+IWTIILRFAIQDI +E+LSA++GLLLWCQRKTAPY NV V NFH S+KDGLAFCALIHRHRPDL+DY+ LHK +   NLNLAFD+AEKHLDIP+MLDAEDM   ++PDE +VM YVS YYH FSG +KAETA+NRIC+VL VNQENEK+M +YE L+++LL WI + +P   +RS   +++    KL+++R YR  EKPP+ E+KG+LET +NTLQTRLRLSNRP F+P +   I DIN  W  LE+SEK FEEWL+SE+ RLE+L++L  +F  +C  HE W++GK + L+S D+ +  L +++AL KR +AFESD   H+ RV +I  IA EL  L Y D+  I+AR  +I   WD +G+L ++R E +++  ++ E +DSL+LDFAK+     NW++ A+EDL D  +VH + E++ L++ H QFK +L DA  E+  +  I  +++ L   H L +  + NPYT +++ ++R +W E+ + VP+R  +L+ EL RQ+ +E LR  +A  AN+VGPWL+   E++ ++     +  LE+   +L  +++ V+ ++P  +EL++  QE+ +  +FENR ++YSME +RV WE LL+SI KT NE +NQ+L RDSKG+S EQ+ EFR  F+HFDK+    L+P + ++CL+S+GY ++  ++               G+A+  R++  VDPN  G V F+AF+DFMT E +D+D+ +QM+ SF++LA  K +IT +EL RELP++QA YC+A M P   PG     +DY +FS SLY
Sbjct:    1 MLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDMAN-SQPDEKAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLGG-RGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERAG-LDPEQLRSCLISVGYTIRPGRE---------------GDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLY 821          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 424/866 (48.96%), Postives = 591/866 (68.24%), Query Frame = 2
Query:  242 MQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGA---------------------------QKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKA-VENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLY 2755
            M LLEVISGE LPK D+GKMR HKIANVNK L +I  KGVKL  IG+EEIVDGNVKMTLG+IWTIILRFAIQDI +E+LSA++GLLLWCQRKTAPY NV V NFH S+KDGLAFCALIHRHRPDL+DY+ LHK +   NLNLAFD+AEKHLDIP+MLDAED+ +   PDE S M YVS +YHAF                              + AETA+NRIC+VL VNQENEK+M +YE L+++LL WI + +P   +RS   +++    KL+++R YR  EKPP+ E+KG+LET +NTLQTRLRLSNRP F+P +   I DIN  W  LE+SEK FEEWL+SE+ RLE+L++L  +F  +C  HE W++GK + L+S D+ +  L +++AL KR +AFESD   H+ RV +I  IA EL  L Y D+  I+AR  +I   WD +G+L ++R E +++  ++ E +DSL+LDFAK+     NW++ A+EDL D  +VH + E++ L++ H QFK +L DA  E+  +  I  +++ L   H L +  + NPYT +++ ++R +W E+ + VP+R  +L+ EL RQ+ +E LR  +A  AN+VGPWL+   E++ ++     +  LE+   +L  +++ V+ ++P  +EL++  QE+ +  +FENR ++YSME +RV WE LL+SI KT NE +NQ+L RDSKG+S EQ+ EFR  F+HFDK+    L+P + ++CL+S+GY ++  ++               G+A+  R++  VDPN  G V F+AF+DFMT E +D+D+ +QM+ SF++LA  K +IT +EL RELP++QA YC+A M P   PG     +DY +FS SLY
Sbjct:    1 MLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDVSR--HPDEKSTMTYVSCFYHAFRNMRDPPPPVIRQPPPQRVVVAPPPERDWRKDAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLGG-RGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERAG-LDPEQLRSCLISVGYTIRPGRE---------------GDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLY 847          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 408.683 bits (1049), Expect = 2.568e-121
Identity = 213/463 (46.00%), Postives = 291/463 (62.85%), Query Frame = 2
Query:  143 QKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDL------SAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKL 1513
            QK TFT W NSHL +V+  ++ +  D RDG  L++LL V+SGERLPK   GKMR+H + NV K L F+  + V L  +GS +IVDGN ++TLG+IWTIILRF IQDI  ED       SAKE LLLWCQ KTA Y NV V NF TS++DGLAF ALIH+HRPDL+DY+NL K NA  NL  AFD AE  L + + LDAED +   +PDE S++ YV +YYH F+  ++      RI KV+    EN+K++N YETLS++LL+WI   I +  +R    ++E +  +L  F  YR  EKPPK +EKG+LE    TLQ+ +R +N+  F+P E K I DIN  W+ LE +E + E  L  EL R E+L+ L  RF+ +    E+W     + L S+D    +L  + A  K+ +A E+D   +E RV  +  +A EL    YHD   I+ R  ++++ W+Y+ +L
Sbjct:   42 QKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAED-VNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTEN-QRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQL 502          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0070344)

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 493/898 (54.90%), Postives = 651/898 (72.49%), Query Frame = 2
Query:   77 GYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            GY++ +   E+  ++DP WEKQQK TFTAWCNSHLRK    I+ IE+DFR+GLKLM LLEVISGE LPK D+GKMR HKIANVNK L+FIA KGV L  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+++AKEGLLLWCQRKTAPYKNV V NFH SFKDGLAFCALIHRHRPDLIDY  L KDN  ENLN AFDVAEK+LDIPRMLD +D+   A PDE +VM YVSSYYH FSGAQKAETA+NRICKVL VNQENE+LM EYE L+++LL+WI + +P    R    S+  +  KL+ +R YR   KPP+ E+K +LET +NTLQT+LRLSNRP ++P E KT+ DI++ WK LE +EK FEEWL++E  RLE+L++L ++F  + + HE W+ GK EMLQS+D+    L EL+AL K+ +AFESD + H+ RV +I  IA+EL  LEYHD  S++AR   I + WD +G L   R   +    ++LE ID LHL+FAK+     NW++  +EDL D F+VH ++E++ L+  H QFK +L +A  E++ ++ + ++++S+ ++H +   +ENPYT +T+ ++  +W ++  LVP+R + L  EL +Q+ +E LR ++A  AN VGPW++ + + + ++    +Q SLE+Q   L + EQ V  ++P  EEL++  Q + + +IFENR+T Y+ME +RV WEQLL+SI +  NE++NQILTRDSKG+S EQ+ EFR  FNHFDK+ T  L P EFK+CLVSLGY++ +D+                G+ DF RI+  VDPNN GYV FDAF+DFMT E+ D D+++Q++ SF++LA DK YI  +ELRRELP +QAEYCI  M PY GP G     DY SFS +LYG +DL
Sbjct:   14 GYMEQEEEWEREGLLDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLQNTALPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGLENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMG-LQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQ---------------GDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0333801)

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 491/898 (54.68%), Postives = 651/898 (72.49%), Query Frame = 2
Query:   77 GYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            GY++ +   E+  ++DP WEKQQK TFTAWCNSHLRK    I+ IE+DFR+GLKLM LLEVISGE LPK D+GKMR HKIANVNK L+FIA KGV L  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+++AKEGLLLWCQRKTAPYKNV V NFH SFKDGLAFCALIHRHRPDLIDY  L KDN  ENLN AFDVAEK+LDIPRMLD +D+I   KPDE ++M YVS YYHAF GAQ+AETA+NRICKVL VNQENE+LM EYE L+++LL+WI + +P    R    S+  +  KL+ +R YR   KPP+ E+K +LET +NTLQT+LRLSNRP ++P E KT+ DI++ WK LE +EK FEEWL++E  RLE+L++L ++F  + + HE W+ GK EMLQS+D+    L EL+AL K+ +AFESD + H+ RV +I  IA+EL  LEYHD  S++AR   I + WD +G L   R   +    ++LE ID LHL+FAK+     NW++  +EDL D F+VH ++E++ L+  H QFK +L +A  E++ ++ + ++++S+ ++H +   +ENPYT +T+ ++  +W ++  LVP+R + L  EL +Q+ +E LR ++A  AN VGPW++ + + + ++    +Q SLE+Q   L + EQ V  ++P  EEL++  Q + + +IFENR+T Y+ME +RV WEQLL+SI +  NE++NQILTRDSKG+S EQ+ EFR  FNHFDK+ T  L P EFK+CLVSLGY++ +D+                G+ DF RI+  VDPNN GYV FDAF+DFMT E+ D D+++Q++ SF++LA DK YI  +ELRRELP +QAEYCI  M PY GP G     DY SFS +LYG +DL
Sbjct:   14 GYMEQEEEWEREGLLDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGLENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMG-LQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQ---------------GDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0070343)

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 491/898 (54.68%), Postives = 651/898 (72.49%), Query Frame = 2
Query:   77 GYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            GY++ +   E+  ++DP WEKQQK TFTAWCNSHLRK    I+ IE+DFR+GLKLM LLEVISGE LPK D+GKMR HKIANVNK L+FIA KGV L  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+++AKEGLLLWCQRKTAPYKNV V NFH SFKDGLAFCALIHRHRPDLIDY  L KDN  ENLN AFDVAEK+LDIPRMLD +D+I   KPDE ++M YVS YYHAF GAQ+AETA+NRICKVL VNQENE+LM EYE L+++LL+WI + +P    R    S+  +  KL+ +R YR   KPP+ E+K +LET +NTLQT+LRLSNRP ++P E KT+ DI++ WK LE +EK FEEWL++E  RLE+L++L ++F  + + HE W+ GK EMLQS+D+    L EL+AL K+ +AFESD + H+ RV +I  IA+EL  LEYHD  S++AR   I + WD +G L   R   +    ++LE ID LHL+FAK+     NW++  +EDL D F+VH ++E++ L+  H QFK +L +A  E++ ++ + ++++S+ ++H +   +ENPYT +T+ ++  +W ++  LVP+R + L  EL +Q+ +E LR ++A  AN VGPW++ + + + ++    +Q SLE+Q   L + EQ V  ++P  EEL++  Q + + +IFENR+T Y+ME +RV WEQLL+SI +  NE++NQILTRDSKG+S EQ+ EFR  FNHFDK+ T  L P EFK+CLVSLGY++ +D+                G+ DF RI+  VDPNN GYV FDAF+DFMT E+ D D+++Q++ SF++LA DK YI  +ELRRELP +QAEYCI  M PY GP G     DY SFS +LYG +DL
Sbjct:   14 GYMEQEEEWEREGLLDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGLENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMG-LQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQ---------------GDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0303048)

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 491/898 (54.68%), Postives = 651/898 (72.49%), Query Frame = 2
Query:   77 GYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            GY++ +   E+  ++DP WEKQQK TFTAWCNSHLRK    I+ IE+DFR+GLKLM LLEVISGE LPK D+GKMR HKIANVNK L+FIA KGV L  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+++AKEGLLLWCQRKTAPYKNV V NFH SFKDGLAFCALIHRHRPDLIDY  L KDN  ENLN AFDVAEK+LDIPRMLD +D+I   KPDE ++M YVS YYHAF GAQ+AETA+NRICKVL VNQENE+LM EYE L+++LL+WI + +P    R    S+  +  KL+ +R YR   KPP+ E+K +LET +NTLQT+LRLSNRP ++P E KT+ DI++ WK LE +EK FEEWL++E  RLE+L++L ++F  + + HE W+ GK EMLQS+D+    L EL+AL K+ +AFESD + H+ RV +I  IA+EL  LEYHD  S++AR   I + WD +G L   R   +    ++LE ID LHL+FAK+     NW++  +EDL D F+VH ++E++ L+  H QFK +L +A  E++ ++ + ++++S+ ++H +   +ENPYT +T+ ++  +W ++  LVP+R + L  EL +Q+ +E LR ++A  AN VGPW++ + + + ++    +Q SLE+Q   L + EQ V  ++P  EEL++  Q + + +IFENR+T Y+ME +RV WEQLL+SI +  NE++NQILTRDSKG+S EQ+ EFR  FNHFDK+ T  L P EFK+CLVSLGY++ +D+                G+ DF RI+  VDPNN GYV FDAF+DFMT E+ D D+++Q++ SF++LA DK YI  +ELRRELP +QAEYCI  M PY GP G     DY SFS +LYG +DL
Sbjct:   14 GYMEQEEEWEREGLLDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGLENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMG-LQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQ---------------GDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0310657)

HSP 1 Score: 1028.08 bits (2657), Expect = 0.000e+0
Identity = 493/900 (54.78%), Postives = 651/900 (72.33%), Query Frame = 2
Query:   77 GYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEEL--RKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            GY++ +   E+  ++DP WEKQQK TFTAWCNSHLRK    I+ IE+DFR+GLKLM LLEVISGE LPK D+GKMR HKIANVNK L+FIA KGV L  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+++AKEGLLLWCQRKTAPYKNV V NFH SFKDGLAFCALIHRHRPDLIDY  L KDN  ENLN AFDVAEK+LDIPRMLD +D+   A PDE +VM YVSSYYH FSGAQKAETA+NRICKVL VNQENE+LM EYE L+++LL+WI + +P    R    S+  +  KL+ +R YR   KPP+ E+K +LET +NTLQT+LRLSNRP ++P E KT+ DI++ WK LE +EK FEEWL++E  RLE+L++L ++F  + + HE W+ GK EMLQS+D+    L EL+AL K+ +AFESD + H+ RV +I  IA+EL    LEYHD  S++AR   I + WD +G L   R   +    ++LE ID LHL+FAK+     NW++  +EDL D F+VH ++E++ L+  H QFK +L +A  E++ ++ + ++++S+ ++H +   +ENPYT +T+ ++  +W ++  LVP+R + L  EL +Q+ +E LR ++A  AN VGPW++ + + + ++    +Q SLE+Q   L + EQ V  ++P  EEL++  Q + + +IFENR+T Y+ME +RV WEQLL+SI +  NE++NQILTRDSKG+S EQ+ EFR  FNHFDK+ T  L P EFK+CLVSLGY++ +D+                G+ DF RI+  VDPNN GYV FDAF+DFMT E+ D D+++Q++ SF++LA DK YI  +ELRRELP +QAEYCI  M PY GP G     DY SFS +LYG +DL
Sbjct:   14 GYMEQEEEWEREGLLDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLQNTALPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNVSTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGLENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMG-LQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQ---------------GDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 897          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn4 (actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-940])

HSP 1 Score: 1057.36 bits (2733), Expect = 0.000e+0
Identity = 502/914 (54.92%), Postives = 675/914 (73.85%), Query Frame = 2
Query:   44 FSDMNSISNYSGYVDPDYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            +  +N+   YS    P Y+E+++D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LIDY+ L KD+   NLN AF+VAE++LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  ++R+   ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN  W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE W++GK  ML  +DY  A+L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I E WD +G L   R E+++   + LE+ID L+L++AK+     NW+E A EDLQD F+VH IDE++ L+  H QFK +L +A  E + + AI  +++ +A  + +  A  NPYT +T Q++  +WE++  LVP+R + L+EELTRQ+ +++LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + EQ +++++P  ++L+   Q + + LIF+N++T Y+ME +RV WEQLL++I +T NEI+NQ+LTRD+KG+S EQ+ E+R  FNHFDKDH+ +L+  EFKACL+SLGY+++ DK                G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D D++DQ++ SFK+LAGDK+YIT EELRRELP +QAEYCIA M PY+GP       DY SFS +LYG SDL
Sbjct:    4 YHAVNNQGQYSAGGPPTYMEQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIDYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRAPEKTMAEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINGAWHKLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEGWTDGKEAMLTQKDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICEQWDALGSLTQNRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIDEIQGLITAHEQFKSTLPEANKEREAIQAIQAEVQKIANYNGIKLAGNNPYTTITPQSIDKKWEKVQQLVPQRDQALQEELTRQQSNDHLRRQFANQANMIGPWIQNKMEEIGRISIE-MNGTLEDQLTHLSQYEQSIIEYKPNIDQLEGDHQLIQEALIFDNKYTAYTMEHLRVGWEQLLTTIARTINEIENQVLTRDAKGISQEQLHEYRTSFNHFDKDHSGLLQSEEFKACLISLGYDVENDKQ---------------GDAEFARIMGIVDPNNSGAVTFQAFIDFMSRETTDTDTADQVIASFKILAGDKNYITAEELRRELPPDQAEYCIARMAPYSGPDAVAGALDYMSFSTALYGESDL 901          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn4 (actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-940])

HSP 1 Score: 1055.43 bits (2728), Expect = 0.000e+0
Identity = 503/921 (54.61%), Postives = 679/921 (73.72%), Query Frame = 2
Query:   44 FSDMNSISNYSGYVDPDYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRA-------SVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            +  +N+   YS    P Y+E+++D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LIDY+ L KD+   NLN AF+VAE++LDIP+MLDAED++   +PDE ++M YVS +YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  ++R+   ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN  W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE W++GK  ML  +DY  A+L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I E WD +G L   R E+++   + LE+ID L+L++AK+     NW+E A EDLQD F+VH IDE++ L+  H QFK +L +A  E + + AI  +++ +A  + +  A  NPYT +T Q++  +WE++  LVP+R + L+EELTRQ+ +++LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + EQ +++++P  ++L+   Q + + LIF+N++T Y+ME +RV WEQLL++I +T NEI+NQ+LTRD+KG+S EQ+ E+R  FNHFDKDH+ +L+  EFKACL+SLGY+++ DK   +   +    RA       S+G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D D++DQ++ SFK+LAGDK+YIT EELRRELP +QAEYCIA M PY+GP       DY SFS +LYG SDL
Sbjct:    4 YHAVNNQGQYSAGGPPTYMEQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIDYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVGTLRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRAPEKTMAEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINGAWHKLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEGWTDGKEAMLTQKDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICEQWDALGSLTQNRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIDEIQGLITAHEQFKSTLPEANKEREAIQAIQAEVQKIANYNGIKLAGNNPYTTITPQSIDKKWEKVQQLVPQRDQALQEELTRQQSNDHLRRQFANQANMIGPWIQNKMEEIGRISIE-MNGTLEDQLTHLSQYEQSIIEYKPNIDQLEGDHQLIQEALIFDNKYTAYTMEHLRVGWEQLLTTIARTINEIENQVLTRDAKGISQEQLHEYRTSFNHFDKDHSGLLQSEEFKACLISLGYDVENDKQKRTGIMDSDDFRALLISTGNSLGDAEFARIMGIVDPNNSGAVTFQAFIDFMSRETTDTDTADQVIASFKILAGDKNYITAEELRRELPPDQAEYCIARMAPYSGPDAVAGALDYMSFSTALYGESDL 923          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn4 (actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-940])

HSP 1 Score: 1052.35 bits (2720), Expect = 0.000e+0
Identity = 500/914 (54.70%), Postives = 673/914 (73.63%), Query Frame = 2
Query:   44 FSDMNSISNYSGYVDPDYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            +  +N+   YS    P Y+E+++D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LIDY+ L KD+   NLN AF+VAE++LDIP+MLDAED++   +PDE ++M YVS +YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  ++R+   ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN  W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE W++GK  ML  +DY  A+L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I E WD +G L   R E+++   + LE+ID L+L++AK+     NW+E A EDLQD F+VH IDE++ L+  H QFK +L +A  E + + AI  +++ +A  + +  A  NPYT +T Q++  +WE++  LVP+R + L+EELTRQ+ +++LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + EQ +++++P  ++L+   Q + + LIF+N++T Y+ME +RV WEQLL++I +T NEI+NQ+LTRD+KG+S EQ+ E+R  FNHFDKDH+ +L+  EFKACL+SLGY+++ DK                G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D D++DQ++ SFK+LAGDK+YIT EELRRELP +QAEYCIA M PY+GP       DY SFS +LYG SDL
Sbjct:    4 YHAVNNQGQYSAGGPPTYMEQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIDYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVGTLRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRAPEKTMAEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINGAWHKLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEGWTDGKEAMLTQKDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICEQWDALGSLTQNRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIDEIQGLITAHEQFKSTLPEANKEREAIQAIQAEVQKIANYNGIKLAGNNPYTTITPQSIDKKWEKVQQLVPQRDQALQEELTRQQSNDHLRRQFANQANMIGPWIQNKMEEIGRISIE-MNGTLEDQLTHLSQYEQSIIEYKPNIDQLEGDHQLIQEALIFDNKYTAYTMEHLRVGWEQLLTTIARTINEIENQVLTRDAKGISQEQLHEYRTSFNHFDKDHSGLLQSEEFKACLISLGYDVENDKQ---------------GDAEFARIMGIVDPNNSGAVTFQAFIDFMSRETTDTDTADQVIASFKILAGDKNYITAEELRRELPPDQAEYCIARMAPYSGPDAVAGALDYMSFSTALYGESDL 901          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn1 (actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-4])

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 498/898 (55.46%), Postives = 664/898 (73.94%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDYN L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DI++ W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W++GK EMLQ +D+  A+L E++AL K+ +AFESD + H+ RV +I  IA+EL +LEY+D  S++AR   I + WD +G L  +R+E ++   +LLE ID L+L+FAK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  A +NPYT +  Q +  +W+++  LVP+R + L EE  RQ+ +E LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQM EFR  FNHFD+DH+  L   EFKACL+SLG+++  D               + GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFKVLAGDK+YI  +ELRRELP +QAEYCIA M PY+GP       DY SFS +LYG SDL
Sbjct:   21 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALGFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYNKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNSWGRLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTDGKEEMLQHKDFETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQRICDQWDSLGVLTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGQNPYTTINPQEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLTHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGND---------------AQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQAEYCIARMTPYSGPDSVPGALDYMSFSTALYGESDL 902          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn1 (actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-4])

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 498/898 (55.46%), Postives = 664/898 (73.94%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDYN L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DI++ W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W++GK EMLQ +D+  A+L E++AL K+ +AFESD + H+ RV +I  IA+EL +LEY+D  S++AR   I + WD +G L  +R+E ++   +LLE ID L+L+FAK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  A +NPYT +  Q +  +W+++  LVP+R + L EE  RQ+ +E LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQM EFR  FNHFD+DH+  L   EFKACL+SLG+++  D               + GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFKVLAGDK+YI  +ELRRELP +QAEYCIA M PY+GP       DY SFS +LYG SDL
Sbjct:   21 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALGFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYNKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNSWGRLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTDGKEEMLQHKDFETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQRICDQWDSLGVLTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGQNPYTTINPQEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLTHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGND---------------AQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQAEYCIARMTPYSGPDSVPGALDYMSFSTALYGESDL 902          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: actn4 (actinin alpha 4 [Source:NCBI gene;Acc:448522])

HSP 1 Score: 1041.57 bits (2692), Expect = 0.000e+0
Identity = 499/900 (55.44%), Postives = 663/900 (73.67%), Query Frame = 2
Query:   86 DPDYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            D  Y+E++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LI+Y+ L KD+   NLN AF+VAE++LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  ++R    ++ +M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W+ LE +EK FEEWL++ ++RLE+LD+L  +F  +   HE+W+ GK  ML+ +DY +A L +++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L   R E ++   + LE ID L+L++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L DA  E + ++ I  + + +A+  ++  A  NPYT VT Q +  +WE++  LVPKR   LK E  +Q+ +E+LRL++A+LAN VGPW+ A+ E++  ++   +  +LE+Q + L + EQ V++++P  ++L+Q  Q + + LIF+N+HT Y+ME +RV WE LL++I +T NE++NQILTRD+KG+S EQM E+R  FNHFD+DHT  L P EFKACL+SLGY+++ D+                G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D D++DQ++ SFKVLAGDK+YIT  ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:   21 DQRYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRVPEKTMHDMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGFEEWLLNAIRRLERLDHLAEKFRQKALIHEAWTEGKEAMLKQKDYESATLADIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDLLGSLTHTRREALEVTEKQLEAIDQLYLEYAKRAAPFNNWMEGAMEDLQDMFIVHTIEEIEGLIAAHEQFKSTLPDADREREAILGIQNEAQKIADYSHIKLASGNPYTTVTPQIINSKWEKVQQLVPKRDGALKGEHDKQQSNEHLRLQFASLANVVGPWIQAKMEEIGRIAIE-LHGTLEDQMTHLKQYEQSVINYKPNIDKLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEHLLTTIARTSNEVENQILTRDAKGISQEQMHEYRASFNHFDRDHTGALGPEEFKACLISLGYDVENDRQ---------------GDAEFNRIMAIVDPNNTGMVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNYITAAELRRELPPDQAEYCIARMAPYQGPDAVPGALDYMSFSTALYGESDL 904          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: actn4 (actinin alpha 4 [Source:NCBI gene;Acc:448522])

HSP 1 Score: 1040.41 bits (2689), Expect = 0.000e+0
Identity = 500/907 (55.13%), Postives = 666/907 (73.43%), Query Frame = 2
Query:   86 DPDYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRA-------SVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            D  Y+E++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LI+Y+ L KD+   NLN AF+VAE++LDIP+MLDAED++   +PDE ++M YVS +YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  ++R    ++ +M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W+ LE +EK FEEWL++ ++RLE+LD+L  +F  +   HE+W+ GK  ML+ +DY +A L +++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L   R E ++   + LE ID L+L++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L DA  E + ++ I  + + +A+  ++  A  NPYT VT Q +  +WE++  LVPKR   LK E  +Q+ +E+LRL++A+LAN VGPW+ A+ E++  ++   +  +LE+Q + L + EQ V++++P  ++L+Q  Q + + LIF+N+HT Y+ME +RV WE LL++I +T NE++NQILTRD+KG+S EQM E+R  FNHFD+DHT  L P EFKACL+SLGY+++ D+       +    RA       S+G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D D++DQ++ SFKVLAGDK+YIT  ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:   12 DQRYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVGTLRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRVPEKTMHDMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGFEEWLLNAIRRLERLDHLAEKFRQKALIHEAWTEGKEAMLKQKDYESATLADIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDLLGSLTHTRREALEVTEKQLEAIDQLYLEYAKRAAPFNNWMEGAMEDLQDMFIVHTIEEIEGLIAAHEQFKSTLPDADREREAILGIQNEAQKIADYSHIKLASGNPYTTVTPQIINSKWEKVQQLVPKRDGALKGEHDKQQSNEHLRLQFASLANVVGPWIQAKMEEIGRIAIE-LHGTLEDQMTHLKQYEQSVINYKPNIDKLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEHLLTTIARTSNEVENQILTRDAKGISQEQMHEYRASFNHFDRDHTGALGPEEFKACLISLGYDVENDRQKRIGALDADDFRALLISTGYSLGDAEFNRIMAIVDPNNTGMVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNYITAAELRRELPPDQAEYCIARMAPYQGPDAVPGALDYMSFSTALYGESDL 917          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:780123])

HSP 1 Score: 1040.41 bits (2689), Expect = 0.000e+0
Identity = 484/882 (54.88%), Postives = 656/882 (74.38%), Query Frame = 2
Query:  125 PLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            P WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAE++LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R+   +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W  LE +EK +EEW+++E++RLE+LD+L  +F  + + HE+W++GK  MLQ +DY  A+L +++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D ++++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  +  NPYT +T Q + ++W+ +  LVP+R + L EE  RQ+Q+E LR ++A  AN +GPW+  + +++  ++   +  +LE+Q + L + E+ +++++PK ++L+   Q++ + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQ+LTRD+KG+S EQM EFR  F+HFD+DH+  L P EFKACL+SLGY++  D                 GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:   25 PAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAEKGYEEWMLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLQKKDYETASLSDIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSQTVNARCQRICDQWDNLGALTQQRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPEADKERQAILGIQNEISKIMQTYHVNMSGSNPYTSITPQEINNKWDHVRQLVPRRDQALTEEHARQQQNERLRKQFAAQANVIGPWIQTKMQEIGRIAIE-MHGTLEDQLNNLRQYEKSIVNYKPKIDQLESDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQVLTRDAKGISQEQMNEFRNSFSHFDRDHSGRLGPEEFKACLISLGYDIGNDPQ---------------GEAEFARIMSIVDPNRLGLVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITADELRRELPPDQAEYCIARMAPYLGPDAVPGALDYMSFSTALYGESDL 890          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: actn4 (actinin alpha 4 [Source:NCBI gene;Acc:448522])

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 500/907 (55.13%), Postives = 666/907 (73.43%), Query Frame = 2
Query:   86 DPDYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRA-------SVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            D  Y+E++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LI+Y+ L KD+   NLN AF+VAE++LDIP+MLDAED++   +PDE ++M YVS +YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  ++R    ++ +M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W+ LE +EK FEEWL++ ++RLE+LD+L  +F  +   HE+W+ GK  ML+ +DY +A L +++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L   R E ++   + LE ID L+L++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L DA  E + ++ I  + + +A+  ++  A  NPYT VT Q +  +WE++  LVPKR   LK E  +Q+ +E+LRL++A+LAN VGPW+ A+ E++  ++   +  +LE+Q + L + EQ V++++P  ++L+Q  Q + + LIF+N+HT Y+ME +RV WE LL++I +T NE++NQILTRD+KG+S EQM E+R  FNHFD+DHT  L P EFKACL+SLGY+++ D+       +    RA       S+G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D D++DQ++ SFKVLAGDK+YIT  ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:   21 DQRYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVGTLRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRVPEKTMHDMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGFEEWLLNAIRRLERLDHLAEKFRQKALIHEAWTEGKEAMLKQKDYESATLADIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDLLGSLTHTRREALEVTEKQLEAIDQLYLEYAKRAAPFNNWMEGAMEDLQDMFIVHTIEEIEGLIAAHEQFKSTLPDADREREAILGIQNEAQKIADYSHIKLASGNPYTTVTPQIINSKWEKVQQLVPKRDGALKGEHDKQQSNEHLRLQFASLANVVGPWIQAKMEEIGRIAIE-LHGTLEDQMTHLKQYEQSVINYKPNIDKLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEHLLTTIARTSNEVENQILTRDAKGISQEQMHEYRASFNHFDRDHTGALGPEEFKACLISLGYDVENDRQKRIGALDADDFRALLISTGYSLGDAEFNRIMAIVDPNNTGMVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNYITAAELRRELPPDQAEYCIARMAPYQGPDAVPGALDYMSFSTALYGESDL 926          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: actn4 (actinin alpha 4 [Source:NCBI gene;Acc:448522])

HSP 1 Score: 1036.94 bits (2680), Expect = 0.000e+0
Identity = 497/900 (55.22%), Postives = 661/900 (73.44%), Query Frame = 2
Query:   86 DPDYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            D  Y+E++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LI+Y+ L KD+   NLN AF+VAE++LDIP+MLDAED++   +PDE ++M YVS +YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  ++R    ++ +M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W+ LE +EK FEEWL++ ++RLE+LD+L  +F  +   HE+W+ GK  ML+ +DY +A L +++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L   R E ++   + LE ID L+L++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L DA  E + ++ I  + + +A+  ++  A  NPYT VT Q +  +WE++  LVPKR   LK E  +Q+ +E+LRL++A+LAN VGPW+ A+ E++  ++   +  +LE+Q + L + EQ V++++P  ++L+Q  Q + + LIF+N+HT Y+ME +RV WE LL++I +T NE++NQILTRD+KG+S EQM E+R  FNHFD+DHT  L P EFKACL+SLGY+++ D+                G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D D++DQ++ SFKVLAGDK+YIT  ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:   21 DQRYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVGTLRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRVPEKTMHDMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGFEEWLLNAIRRLERLDHLAEKFRQKALIHEAWTEGKEAMLKQKDYESATLADIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDLLGSLTHTRREALEVTEKQLEAIDQLYLEYAKRAAPFNNWMEGAMEDLQDMFIVHTIEEIEGLIAAHEQFKSTLPDADREREAILGIQNEAQKIADYSHIKLASGNPYTTVTPQIINSKWEKVQQLVPKRDGALKGEHDKQQSNEHLRLQFASLANVVGPWIQAKMEEIGRIAIE-LHGTLEDQMTHLKQYEQSVINYKPNIDKLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEHLLTTIARTSNEVENQILTRDAKGISQEQMHEYRASFNHFDRDHTGALGPEEFKACLISLGYDVENDRQ---------------GDAEFNRIMAIVDPNNTGMVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNYITAAELRRELPPDQAEYCIARMAPYQGPDAVPGALDYMSFSTALYGESDL 904          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn4 (actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773])

HSP 1 Score: 1047.73 bits (2708), Expect = 0.000e+0
Identity = 499/887 (56.26%), Postives = 663/887 (74.75%), Query Frame = 2
Query:  125 PLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHS-DKDNQHG----RRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            P WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LI+Y+ L KD+   NLN AF+VAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  +DR    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W+ LE +EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+  DY  A L +++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  +++ R   I + WD +G L   R E ++   + LE ID LHL++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L DA  E + ++AI K+ + +AE +++  +  NPYT VT Q +  +WE++  LVPKR   L EE ++Q+ +E+LR ++A+ AN VGPW+  + E++  +S   +  +LE+Q S L + E+ ++D++P  + L+Q  Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM+EFR  FNHFDKDH   L P EFKACL+SLGY+++ D+ + S D D+          S+G+A+F+RIM  VDPN+ G VTF AFIDFM+ ET D D++DQ++ SFKVLAGDK++IT EELRRELP +QAEYCIA M PY GP       DY+SFS +LYG SDL
Sbjct:   47 PAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKQRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDNLGSLTHSRREALEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANMVGPWIQTKMEEIGRISIE-MNGTLEDQLSHLKQYERSIVDYKPSLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQTGSMDSDDFRALLISTGYSLGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYKSFSTALYGESDL 932          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn1 (actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:2137706])

HSP 1 Score: 1044.26 bits (2699), Expect = 0.000e+0
Identity = 496/898 (55.23%), Postives = 658/898 (73.27%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAE+ LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE +EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE  RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q S L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+DH+  L P EFKACL+SLGY++  D                 GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YITE+ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQ---------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn4 (actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773])

HSP 1 Score: 1043.11 bits (2696), Expect = 0.000e+0
Identity = 495/882 (56.12%), Postives = 656/882 (74.38%), Query Frame = 2
Query:  125 PLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            P WEKQQ+ TFTAWCNSHLRK    IE I++DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LI+Y+ L KD+   NLN AF+VAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  +DR    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W+ LE +EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+  DY  A L +++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  +++ R   I + WD +G L   R E ++   + LE ID LHL++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L DA  E + ++AI K+ + +AE +++  +  NPYT VT Q +  +WE++  LVPKR   L EE ++Q+ +E+LR ++A+ AN VGPW+  + E++  +S   +  +LE+Q S L + E+ ++D++P  + L+Q  Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM+EFR  FNHFDKDH   L P EFKACL+SLGY+++ D+                G+A+F+RIM  VDPN+ G VTF AFIDFM+ ET D D++DQ++ SFKVLAGDK++IT EELRRELP +QAEYCIA M PY GP       DY+SFS +LYG SDL
Sbjct:   47 PAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKQRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDNLGSLTHSRREALEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANMVGPWIQTKMEEIGRISIE-MNGTLEDQLSHLKQYERSIVDYKPSLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQ---------------GDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYKSFSTALYGESDL 912          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn1 (actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:2137706])

HSP 1 Score: 1036.56 bits (2679), Expect = 0.000e+0
Identity = 491/898 (54.68%), Postives = 657/898 (73.16%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAE+ LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE +EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE  RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q S L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+  T M++ ++F+ACL+S+GYN+                    GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YITE+ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNM--------------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL 887          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn3 (actinin alpha 3 [Source:MGI Symbol;Acc:MGI:99678])

HSP 1 Score: 1024.23 bits (2647), Expect = 0.000e+0
Identity = 484/898 (53.90%), Postives = 653/898 (72.72%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            +Y+E++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFR+GLKLM LLEVISGERLP+ DKGKMR HKIANVNK L+FIA KGVKL  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPY+NV V NFHTS+KDGLA CALIHRHRPDLIDY  L KD+   NLN AF+VAEK+LDIP+MLDAED++   KPDE ++M YVS +YHAF+GA++AETA+NRICKVL VNQENEKLM EYE L++ LL+WI + +P  ++R    S+  M  KL++FR YR   KPP+ +EK QLE  +NTLQT+LRLS+RP F+P E K + DI + W+ LE  EK +E+WL+SE++RL++L +L  +F  + + HE+W+ GK EML   DY +A+L E+RAL +R +AFESD + H+ RV  I  +A+EL +L+YH+  S+++R  +I + WD +G L  +R + ++ + +LLE ID L L+FA++     NW++ A EDLQD ++VH ++E ++LL  H QFK +L +A  E   ++ I  +I+ + + + L     NPY  ++SQ++ ++W+ +  LVP R + L+EEL RQ+ +E LR ++A  AN +GPW+  + E++  L+   +  SLEEQ + L + EQ +++++   + L+   Q L + L+F+N+HT YSME +RV WEQLL+SI +T NE++NQ+LTRD+KGLS EQ+ EFR  FNHFD+    M+EP++F+ACL+S+GY+L                    GE +F+RIM  VDPN  G VTF AFIDFMT ETA+ D+++Q++ SFK+LAGDK+YIT EELRRELP EQAEYCI  M PY G G      DY +FS++LYG SDL
Sbjct:   24 EYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRLSHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLHEAWTRGKEEMLNQHDYESASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYHEAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDGAIEDLQDVWLVHSVEETQSLLTAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRPKSGNPYITLSSQDINNKWDTVRKLVPSRDQTLQEELARQQVNERLRRQFAAQANAIGPWIQGKVEEVGRLAAG-LAGSLEEQMAGLRQQEQNIINYKSNIDRLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMMEPDDFRACLISMGYDL--------------------GEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVASFKILAGDKNYITPEELRRELPAEQAEYCIRRMAPYKGSGAPSGALDYVAFSSALYGESDL 900          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|P05094|ACTN1_CHICK (Alpha-actinin-1 OS=Gallus gallus OX=9031 GN=ACTN1 PE=1 SV=3)

HSP 1 Score: 1053.51 bits (2723), Expect = 0.000e+0
Identity = 499/898 (55.57%), Postives = 662/898 (73.72%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R+   +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W  LE +EK +EEWL++E++RLE+LD+L  +F  + + HESW++GK  MLQ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +WE +  LVP+R + L EE  RQ+Q+E LR ++   AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q++ + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+DH+  L P EFKACL+SLGY++  D               + GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PY G        DY SFS +LYG SDL
Sbjct:   12 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGKEAMLQQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGND---------------AQGEAEFARIMSIVDPNRMGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYCIARMAPYNGRDAVPGALDYMSFSTALYGESDL 893          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|Q3B7N2|ACTN1_BOVIN (Alpha-actinin-1 OS=Bos taurus OX=9913 GN=ACTN1 PE=2 SV=1)

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 496/898 (55.23%), Postives = 660/898 (73.50%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R+   ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE +EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE  RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+DH+  L P EFKACL+SLGY++  D                 GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PYTGP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQ---------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYCIARMAPYTGPDAVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|Q2PFV7|ACTN1_MACFA (Alpha-actinin-1 OS=Macaca fascicularis OX=9541 GN=ACTN1 PE=2 SV=1)

HSP 1 Score: 1046.96 bits (2706), Expect = 0.000e+0
Identity = 497/898 (55.35%), Postives = 658/898 (73.27%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE  EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE  RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q S L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+DH+  L P EFKACL+SLGY++  D                 GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PYTGP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQ---------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|P12814|ACTN1_HUMAN (Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2)

HSP 1 Score: 1046.96 bits (2706), Expect = 0.000e+0
Identity = 497/898 (55.35%), Postives = 658/898 (73.27%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE  EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE  RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q S L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+DH+  L P EFKACL+SLGY++  D                 GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PYTGP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQ---------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|Q9Z1P2|ACTN1_RAT (Alpha-actinin-1 OS=Rattus norvegicus OX=10116 GN=Actn1 PE=1 SV=1)

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 495/898 (55.12%), Postives = 660/898 (73.50%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++ + D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAE++LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN+ W  LE +EK +EEWL++E++RLE+LD+L  +F  + + HE+W++GK  ML+ +DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R E ++   +LLE ID L+L++AK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L DA  E   ++ I  ++  + + +++  A  NPYT +T Q +  +W+ +  LVP+R + L EE +RQ+ +E LR ++   AN +GPW+  + E++  +S   +  +LE+Q S L + E+ +++++PK ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQM EFR  FNHFD+DH+  L P EFKACL+SLGY++  D                 GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFK+LAGDK+YIT +ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:   11 DYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHSRQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQ---------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITGDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. TrEMBL
Match: A0A2T7NYF0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13876 PE=4 SV=1)

HSP 1 Score: 1080.09 bits (2792), Expect = 0.000e+0
Identity = 518/909 (56.99%), Postives = 676/909 (74.37%), Query Frame = 2
Query:   44 FSDMNSISNYSGYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
             S M   S   GY++ +   ++  ++DP WEKQQK TFTAWCNSHLRK    IE IE+DFR+GLKLM LLEVISGE+LPK D+GKMR HKIANVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+L+AKEGLLLWCQRKTAPYKNV V NFH S+KDGLAFCALIHRHRPDLIDY  L +DN  ENLN AFD+AEKHLDIPRMLD EDM+  AKPDE SVMAYVSSYYHAFSGAQ+AETA+NRICKVL VNQENE+LM EYE L+++LL+WI K  P  ++R+   ++     KLD FR YR   KPPK E+K +LE ++NTLQTRLRLSNRP ++P E K + DI + WK LE++EK FEEWL+SELQRLE+LD+L ++F  +C  HE WS GK EMLQS D+    L EL+A+ K+ +AFESD + H+ RV +I  IA+EL  L+YHD+ +++AR   I + WD +G+L  +R E ++   ++LE ID LHL+FAK+     NW++ AKEDL D F+VH  +EV+ L+D H QFK +L +A  EY  ++++++++  L ++  L    ENPYT + +Q++ ++W E+  LVP+R + L++E+ RQ+ +E LR ++A  AN VG W++A+ + + S+    ++ SLE+Q  +L   ++ V+ ++P  +EL++ +QE+ + +IFENR+TQY+ME +RV WEQLL+++ +  NE++NQILTRDSKG+S +QM EFR  FNHFDK+ T+ LEP EFKACL+SLGY +++D+                GEADF RIM  VDPN  GYVTFDAF+DFMT ETAD D+++Q+++SFK+LAGDK YIT + LR+ELP +QAEYCI  M PYTG        DY SFS +LYG SDL
Sbjct:    1 MSHMMGDSYNDGYMEEEEEWDREGLLDPAWEKQQKKTFTAWCNSHLRKAGTGIENIEEDFRNGLKLMLLLEVISGEQLPKPDRGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDITVEELTAKEGLLLWCQRKTAPYKNVNVQNFHLSWKDGLAFCALIHRHRPDLIDYYKLSRDNPLENLNTAFDIAEKHLDIPRMLDPEDMVNSAKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRKTRPWLENRTTDNTLPGTRRKLDEFRDYRRKHKPPKLEDKARLENSFNTLQTRLRLSNRPAYLPTEGKMVSDIANAWKGLEHAEKGFEEWLLSELQRLERLDHLAQKFRHKCEIHEEWSTGKEEMLQSGDFKRCRLNELKAMKKKHEAFESDLAAHQDRVEQIAAIAQELNALDYHDVATVNARCQRICDQWDRLGQLTVKRREGLEEAERVLERIDQLHLEFAKRAAPFNNWMDGAKEDLLDMFIVHTTEEVQGLVDAHDQFKATLGEADKEYSTIVSLAQEVVRLGQQFGLTPP-ENPYTTLHAQDITNKWAEVRDLVPRRDQTLQQEMMRQQNNERLRRQFAAKANVVGQWIEAQLDAVASIGVQ-MRGSLEDQLKKLQAFDKAVVAYKPNMDELERFNQEVQEAMIFENRYTQYTMETLRVGWEQLLTAVARNINEVENQILTRDSKGISEDQMNEFRMSFNHFDKNRTRRLEPKEFKACLISLGYKIRDDRQ---------------GEADFQRIMSIVDPNGSGYVTFDAFLDFMTRETADTDTAEQVMQSFKILAGDKPYITAQILRQELPPDQAEYCIQRMAPYTGRDAVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. TrEMBL
Match: A0A4D5RA68 (Alpha-actinin, sarcomeric OS=Scolopendra viridis OX=118503 PE=4 SV=1)

HSP 1 Score: 1070.46 bits (2767), Expect = 0.000e+0
Identity = 510/909 (56.11%), Postives = 674/909 (74.15%), Query Frame = 2
Query:   47 SDMNSISNYS-GYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            + +NS++ Y+ GY++P+   E+  ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFR+GLKLM LLEVISGE LPK D+GKMR HKIANVNK L+FIA KGVKL  IG+EEIVDGNVKMTLGMIWTIILRFAIQDI +E+++AKEGLLLWCQRKTAPYKNV V NFH SFKDGLAFCALIHRHRPDLIDY+ L KDN  ENLN AFDVAEK+LDIPRMLD ED+I   KPDE ++M YVS YYHAF GAQ+AETA+NRIC+VL VNQENE+LM EYE L+++LL+WI +  P  ++R+   S+  +  KL+ FR YR   KPP+ E+K +LET +NTLQT+LRLSNRP ++P E K + DI++ WK LE +EK FEEWL+SE+ RLE+LD+L ++F  + + HE W+ GK EMLQS+D+    L EL+AL K+ +AFESD S H+ RV +I  IA+EL  LEYHD  S++AR   I + WD +G L  +R   +    +LLE ID LHL+FAK+     NW++ A+EDL D F+VH +DE++ L+D H QFK++L +A  EY  ++++ ++++S+A+++N+   VENPYT +T+ ++  +W E+  LVPKR + L++EL RQ+ +E LR  +A  AN VGPW++ + + + ++    +Q  LE+Q ++L   +Q V+ +RP  +EL++  QE+ + +IFENR+TQY+ME +RV WEQLL+SI +  NE++NQILTRDSKG++ EQ+ EFR  FNHFDK+ T  L P EFK+CLVS+GY++ +D+                GE+DF RIM  VDPN+  YV FDAF+DFMT E+ D D+++Q++ SF++LAGDK YIT EELRRELP +QAEYCI  M PY G        DY SFS +LYG SDL
Sbjct:    4 TQLNSMNPYADGYMEPEEEWEREGLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYSRLSKDNPLENLNTAFDVAEKYLDIPRMLDPEDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICRVLKVNQENERLMEEYERLASDLLEWIRRTTPWLENRTVDNSLIAVQKKLEEFRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKMVSDISNAWKGLELAEKGFEEWLLSEMMRLERLDHLAQKFKHKADIHEEWTKGKEEMLQSQDFRKCRLNELKALKKKHEAFESDLSAHQDRVEQIAAIAQELNALEYHDAASVNARCQRICDQWDRLGTLTQKRRSALDEAEKLLEKIDQLHLEFAKRAAPFNNWLDGAREDLVDMFIVHTMDEIQGLIDAHEQFKQTLGEADKEYKAIVSLVQEVQSIAQKYNIPGGVENPYTTLTATDISTKWSEVRQLVPKRDQVLQQELMRQQNNERLRRLFAEKANVVGPWIERQMDAVATIGMG-LQGVLEDQLTKLKTFQQAVVTYRPHMDELEKYHQEVQESMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSIGYSISKDRQ---------------GESDFQRIMAIVDPNSTSYVHFDAFLDFMTRESTDTDTAEQVIESFRILAGDKPYITAEELRRELPPDQAEYCIQRMAPYKGLNAVPGALDYMSFSTALYGESDL 896          
BLAST of Alpha-actinin vs. TrEMBL
Match: A0A1S3HNG4 (alpha-actinin, sarcomeric isoform X4 OS=Lingula unguis OX=7574 GN=LOC106156043 PE=4 SV=1)

HSP 1 Score: 1070.07 bits (2766), Expect = 0.000e+0
Identity = 512/898 (57.02%), Postives = 669/898 (74.50%), Query Frame = 2
Query:   77 GYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            GY++ +   E+  ++DP WEKQQ+ TFTAWCNSHLRKV   IE IE+DFR+GLKLM LLEVISGE+LPK D+GKMR HKIANVNK L+FI  KGV+L  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+L+AKEGLLLWCQRKTAPYKNV V NFH SFKDGLAFCALIHRHRP+L+DY+ L KDN  +NLNLAFDVAEKHLDIP+MLDAEDM+  AKPDE SVMAYVSSYYHAFSGAQ+AETA+NRICKVL VNQENE+LM EYE ++++LL+WI +  P  ++R    ++     KL+ FR YR   KPPK EEK +LET +NTLQTRLRLSNRP ++P E K + DI + WK LE +EK FEEWL+SELQRLE+LD+L ++F  +C+ HE W+ GK +MLQS+D+    L EL+A+ K+ +AFESD + H+ RV +I  IA EL  L+YHD  S++AR   I + WD +G L   R   ++   ++LE ID+LHL+FAK+     NW++ AKEDL D F+VH  +E++ L+D H QFK++L +A  E++ +I +  ++  + ++++L    ENPYT ++++++  +WEE+  LVP+R + L +E+ RQ  ++ LR ++AN AN VGPW++   + + S+  N  + SLE+Q   L   E+ V+ FRP  +EL++ +QE+ + +IF+NR TQY+ME +RV WEQL++SI +  NE++NQI+TRDSKG+S EQMEEFR+ FNHFDK+ T+ LE  EFKACL+SLGYN+++D+                GEADF RIM  VDPN  G VTFDAF+DFMT ET D D+++Q+++SFK+LAGDK YIT E LR ELP +QAEYCI  M PY+G        DY SFS +LYG SDL
Sbjct:   12 GYMEQEEEWEREGLLDPAWEKQQRKTFTAWCNSHLRKVGTQIENIEEDFRNGLKLMLLLEVISGEQLPKPDRGKMRFHKIANVNKALDFIESKGVRLVNIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEELTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPELLDYDTLSKDNPLDNLNLAFDVAEKHLDIPKMLDAEDMVNSAKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKVNQENERLMEEYERMASDLLEWIRRTTPWLENRHTDNTLPGTQKKLEEFRDYRRKYKPPKLEEKARLETTFNTLQTRLRLSNRPAYLPTEGKMVSDIANAWKGLEGAEKGFEEWLLSELQRLERLDHLAQKFKHKCDIHEEWAFGKEDMLQSQDFKKCRLNELKAMKKKHEAFESDLAAHQDRVEQIAAIASELNTLDYHDSPSVNARCQRICDQWDALGTLTQRRRSALEEAERILERIDTLHLEFAKRAAPFNNWMDGAKEDLVDMFIVHTTEEIQGLIDAHEQFKQTLGEADKEFNSIIGLVTEVTRMCQQYDL-VLPENPYTTLSAKDIASKWEEVKLLVPQRDQTLHQEMLRQRNNDRLRNQFANKANVVGPWIEKHLDAVASVGMNT-KESLEQQMQRLKSYEENVLAFRPNMDELERYNQEVQEAMIFDNRFTQYTMETLRVGWEQLVTSIARNINEVENQIMTRDSKGISQEQMEEFRKSFNHFDKNRTRSLEGKEFKACLISLGYNIRDDRQ---------------GEADFQRIMSIVDPNGTGRVTFDAFLDFMTRETTDTDTAEQVMQSFKILAGDKPYITAEILRTELPPDQAEYCIQRMAPYSGVDSTKGALDYTSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. TrEMBL
Match: A0A087U8H1 (Alpha-actinin, sarcomeric (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_21742 PE=4 SV=1)

HSP 1 Score: 1070.07 bits (2766), Expect = 0.000e+0
Identity = 501/885 (56.61%), Postives = 663/885 (74.92%), Query Frame = 2
Query:  116 VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFR+GLKLM LLEVIS E LPK D+GKMR H IANVNK L+FIA KGVKL  IG+EEIVDGNVKMTLG+IWTIILRFAIQDI +E+++AKEGLLLWCQRKT PYKNV V NFH S+KDGLAFCALIHRHRPDL+DY+ L KDN   NLNLAFDVAEK+L+IPRMLD EDM+   KPDE +VM YVS +YHAF GAQ+AETA+NRICKVL VNQENE+LM EYE L+++LL+WI +  P  ++R+   ++  +H KLD FR YR   KPP+ E+K +LET +NTLQT+LRLSNRP ++P E K + DI + WK LE +EK FEEWL+SE+ RLE+LD+L ++F  + + HE W++GK EMLQS+D+ N  L EL+AL K+ +AFESD + H+ RV +I  IA+EL  L+YHD  S++AR   I + WD +G L  +R   ++   ++LE ID+LHL+FAK+     NW++ A+EDL D F+VH ++E++ L+D H QFK++L +A  E+  +IA+S++++++A +  +   +ENPYT +T+ ++  +W ++  ++PKR + L+ EL RQ+ +E LR K+A+ AN VGPW++ + + + ++    +Q SLE+Q ++L + E  V+ +RP  +EL++C QE+ + +IFENR+TQY+ME +RV WEQLL+SI +  NE++NQILTRDSKG++ EQ+ EFR  FNHFDK+ T  L P EFK+CLVSLGYN++ D+                GEADF RIM  VDPNN GYV FDAF+DFMT E+ D D+++Q++ SF++LAGDK YIT EELRRELP +QAEYCI  M PY GPG      DY SFS +LYG SDL
Sbjct:   20 LLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISSETLPKPDRGKMRFHHIANVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTQPYKNVNVQNFHLSWKDGLAFCALIHRHRPDLLDYSKLTKDNPIHNLNLAFDVAEKYLNIPRMLDPEDMVNTPKPDERAVMTYVSCFYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTTPWLENRTTDNTLVGVHKKLDEFRNYRRVHKPPRVEQKARLETNFNTLQTKLRLSNRPAYLPSEGKMVSDIANAWKGLEMAEKGFEEWLLSEMMRLERLDHLAQKFKHKADIHEDWTHGKEEMLQSQDFRNCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNALDYHDAASVNARCQRICDQWDRLGTLTQKRRSALEEAERVLEKIDTLHLEFAKRAAPFNNWLDGAREDLVDMFIVHTMEEIQGLIDAHEQFKQTLGEADKEHKSIIALSQEVQTIATQCQIPGGIENPYTTLTAIDITTKWSDVKQMIPKRDQVLQTELMRQQSNERLRRKFADKANAVGPWIERQMDSVAAIGMG-MQGSLEDQLNKLRQFETGVVQYRPHMDELEKCHQEIQEAMIFENRYTQYTMETLRVGWEQLLTSIHRNINEVENQILTRDSKGITGEQLNEFRMSFNHFDKNRTGRLAPEEFKSCLVSLGYNIRNDRQ---------------GEADFRRIMSVVDPNNTGYVHFDAFLDFMTRESTDSDTAEQIIDSFRILAGDKPYITAEELRRELPPDQAEYCIQRMGPYKGPGAIPGALDYMSFSTALYGESDL 888          
BLAST of Alpha-actinin vs. TrEMBL
Match: A0A2L2Y0V9 (Putative alpha actinin OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 1070.07 bits (2766), Expect = 0.000e+0
Identity = 503/885 (56.84%), Postives = 659/885 (74.46%), Query Frame = 2
Query:  116 VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFR+GLKLM LLEVIS E LPK D+GKMR H IANVNK L+FIA KGVKL  IG+EEIVDGN KMTLG+IWTIILRFAIQDI +E+++AKEGLLLWCQRKTAPYKNV V NFH S+KDGLAFCALIHRHRPDL+DY+ L KDN   NLNLAFDVAEK+L+IPRMLD EDM+   KPDE +VM YVS YYHAF GA +AETA+NRICKVL VNQENE+LM EYE L+++LL WI K  P  ++R+   ++  +H KLD FR YR   KPP+ E+K +LET +NTLQT+LRLSNRP ++P E K + DI + WK LE +EK FEEWL+SE+ RLE+LD+L ++F  + + HE W+ GK EMLQS+D+ N  L EL+AL K+ +AFESD + H+ RV +I  IA+EL  L+YHD  S++AR   I + WD +G L  +R   ++   ++LE ID+LHL+FAK+     NW++ A+EDL D F+VH ++E++ L+D H QFK++L +A  E+  +IA+S++++++A +  +   +ENPYT +T+ N+  +W ++  +VPKR + L+ EL RQ+ +E LR K+A  AN VGPW++ + + + ++    +Q SLE+Q ++L + E  V+ +RP  +EL++C QE+ + +IFENR+TQY+ME +RV WEQLL+SI +  NE++NQILTRDSKG++ EQ+ EFR  FNHFDK+ T  L P EFK+CLVSLGYN++ D+                GEADF RIM  VDPNN GYV FDAF+DFMT E+ D D+++Q++ SF++LAGDK YIT EELRRELP +QAEYCI  M P+ GPG      DY SFS +LYG SDL
Sbjct:   20 LLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISSETLPKPDRGKMRFHHIANVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGLIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSWKDGLAFCALIHRHRPDLLDYSKLTKDNPIHNLNLAFDVAEKYLNIPRMLDPEDMVNTPKPDERAVMTYVSCYYHAFQGAMQAETAANRICKVLKVNQENERLMEEYEKLASDLLDWIRKTTPWLENRTTDNTLVGVHKKLDEFRNYRRIHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPSEGKMVSDIANAWKGLEMAEKGFEEWLLSEMMRLERLDHLAQKFKHKADIHEDWTQGKEEMLQSQDFRNCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNALDYHDAASVNARCQRICDQWDRLGTLTQKRRSALEEAERVLEKIDTLHLEFAKRAAPFNNWLDGAREDLVDMFIVHTMEEIQGLIDAHEQFKQTLGEADKEHKSIIALSQEVQTIATQCQIPGGIENPYTTLTAINITSKWNDVKQMVPKRDQVLQTELMRQQSNERLRRKFAEKANAVGPWIERQMDSVAAIGMG-MQGSLEDQLNKLKQFEVGVVQYRPHMDELEKCHQEIQEAMIFENRYTQYTMETLRVGWEQLLTSIHRNINEVENQILTRDSKGITGEQLNEFRMSFNHFDKNRTGRLAPEEFKSCLVSLGYNIRNDRQ---------------GEADFRRIMSVVDPNNTGYVHFDAFLDFMTRESTDSDTAEQIIDSFRILAGDKPYITAEELRRELPPDQAEYCIQRMGPFKGPGTVPGALDYMSFSTALYGESDL 888          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 1041.18 bits (2691), Expect = 0.000e+0
Identity = 494/905 (54.59%), Postives = 663/905 (73.26%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSD-KDNQHGRRA------SVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK LNFI  KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R   ++++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DI++ W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W+ GK  ML  +DY    L E++AL K+ +AFESD + H+ RV +I  IA+EL +LEY+D  S++AR   I + WD +G L  +R+E ++   +LLE ID L+L+FAK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  A  NPYT +    +  +W+++  LVP+R + L EE  RQ+ +E LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q++ + LIF+N+HT Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQ+ EFR  FNHFD+DH+  L   EFKACL+SLG+++  D    +   D +  R        ++GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFKVLAGDK+YI  +ELRRELP +QA+YCI+ M PYTGP       DY SFS +LYG SDL
Sbjct:   20 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFITSKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE-LHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQKRTGLMDGEDFRTCLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 923          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 492/898 (54.79%), Postives = 658/898 (73.27%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK LNFI  KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R   ++++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DI++ W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W+ GK  ML  +DY    L E++AL K+ +AFESD + H+ RV +I  IA+EL +LEY+D  S++AR   I + WD +G L  +R+E ++   +LLE ID L+L+FAK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  A  NPYT +    +  +W+++  LVP+R + L EE  RQ+ +E LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q++ + LIF+N+HT Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQ+ EFR  FNHFD+DH+  L   EFKACL+SLG+++  D               + GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFKVLAGDK+YI  +ELRRELP +QA+YCI+ M PYTGP       DY SFS +LYG SDL
Sbjct:   20 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFITSKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE-LHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGND---------------AQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 901          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 491/905 (54.25%), Postives = 659/905 (72.82%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSD-KDNQHGRRA------SVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK LNFI  KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++   + DE ++M YVS YYHAFSG QKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R   ++++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DI++ W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W+ GK  ML  +DY    L E++AL K+ +AFESD + H+ RV +I  IA+EL +LEY+D  S++AR   I + WD +G L  +R+E ++   +LLE ID L+L+FAK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  A  NPYT +    +  +W+++  LVP+R + L EE  RQ+ +E LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q++ + LIF+N+HT Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQ+ EFR  FNHFD+DH+  L   EFKACL+SLG+++  D    +   D +  R        ++GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFKVLAGDK+YI  +ELRRELP +QA+YCI+ M PYTGP       DY SFS +LYG SDL
Sbjct:   20 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFITSKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVSTLRSDEKAIMTYVSCYYHAFSGKQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE-LHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQKRTGLMDGEDFRTCLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 923          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 487/898 (54.23%), Postives = 655/898 (72.94%), Query Frame = 2
Query:   92 DYLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            DY++++ D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK LNFI  KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R   ++++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DI++ W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W+ GK  ML  +DY    L E++AL K+ +AFESD + H+ RV +I  IA+EL +LEY+D  S++AR   I + WD +G L  +R+E ++   +LLE ID L+L+FAK+     NW+E A EDLQD+F+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  A  NPYT +    +  +W+++  LVP+R + L EE  RQ+ +E LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q++ + LIF+N+HT Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQ+ EFR  FNHFD+  T +++  +F+ CL+S+GYN+                    GEA+F+RIM  VDPN  G VTF AFIDFM+ ETAD D++DQ++ SFKVLAGDK+YI  +ELRRELP +QA+YCI+ M PYTGP       DY SFS +LYG SDL
Sbjct:   20 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFITSKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE-LHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRKRTGLMDGEDFRTCLISMGYNM--------------------GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 896          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn4 (actinin alpha 4 [Source:NCBI gene;Acc:103022122])

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 496/905 (54.81%), Postives = 662/905 (73.15%), Query Frame = 2
Query:   59 SISNYSGYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPD-ELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            S S  + Y++P+   ++  ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRP+LIDY+ L KD+   NLN AF+VAEK+LDIP+MLDAED    AK   E ++M YVS +YHAFSGAQKAETA+NRICKVL VNQENE LM +YE L+++LL+WI + IP  ++R+   ++  M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E + + DIN  W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HESW++GK  ML  +DY  A+L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I E WD +G L   R E+++   + LE+ID L+L++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L +A  E + + AI  +++ +A+ + +  A  NPYT +T  ++  +W+++  LVP+R + L+EEL RQ+ +++LR ++AN AN VGPW+  + E++  +S   +  +LE+Q + L + EQ ++D++P  ++L+   Q + + LIF+N++T Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQ+ E+R  FNHFDKDH   L+  EFKACL+SLGY+++ +K                G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D D++DQ++ SFK+LAGDK+YIT EELRRELP +QAEYCI  M PY GP       DY SFS +LYG SDL
Sbjct:   11 SSSGQTSYMEPESDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIDYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDTWYAAKERYEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRAPEKTMAEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINGAWHKLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKATIHESWTDGKEAMLTQKDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICEQWDVLGSLTQSRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIEEIQGLITAHEQFKATLPEANKEREAIQAIQAEVQKIAQYNGIKLAGTNPYTTITPSSIDSKWDKVQKLVPQRDQALQEELARQQSNDHLRRQFANQANIVGPWIQNKMEEIGRISIE-MNGTLEDQLTHLRQYEQSIIDYKPNIDQLEGNHQLIQEALIFDNKYTAYTMEHLRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLHEYRTSFNHFDKDHGGALQAEEFKACLISLGYDVENNKQ---------------GDAEFARIMGIVDPNNSGAVTFQAFIDFMSRETTDTDTADQVIASFKILAGDKNYITAEELRRELPPDQAEYCIGRMAPYAGPDAVPGALDYMSFSTALYGESDL 899          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1002.28 bits (2590), Expect = 0.000e+0
Identity = 477/873 (54.64%), Postives = 634/873 (72.62%), Query Frame = 2
Query:  152 TFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            TFTAWCNSHLRK    IE I++DFR+GLKLM LLEVISGERL K ++GKMRVHKI+NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRPDLIDY  L KD+   NLN AF+VAEK+LDIP+MLDAED++  A+PDE ++M YVS YYHAFSGAQKAETA+NRICKVL VNQENEKLM +YE ++++LL WI +  P  ++R    +++ M  KL+ FR YR   KPPK +EK QLE ++NTLQT+LRL NRP F+P E K + DI + W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W+ GK  ML+  DY + +L EL+AL ++ +AFESD + H+ RV +I  IA+EL +L+YHD+ S++AR   I   WD +G L   R + ++   ++LE ID L+L+FAK+      W++ A EDLQD F+VH IDE++ L+  H QFK++L +A  E   ++ +  +I+ +A+ +N+  A  NPY+ +T  ++  +WE +   VP R   L++ L RQ+ +E LR ++A  AN VGPW+  + E++  +S   +  +LE+Q ++L + EQ +++++P  ++L+   Q + + LIF+N+HT Y+ME +RV WEQLL++I +T NE++ QILTRD+KG+S EQM EFR  FNHFDKDH+  L   EFKACL+SLGY++  D+                GEA+F+RIM  VDPNN G VTF +FIDFMT ET D D++DQ++ SFK+LAGDK++IT +ELRRELP +QAEYCIA M PY GP       DY SFS +LYG SDL
Sbjct:    1 TFTAWCNSHLRKAGTGIENIDEDFRNGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNQENEKLMEDYEHMASDLLDWIRR-TPWLENRVPENTMQAMQGKLEGFRDYRRVHKPPKAQEKCQLEISFNTLQTKLRLMNRPAFMPSEGKMVSDIANGWSMLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHEAWTAGKEAMLEKRDYDSVSLTELKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRKDTLERTEKVLETIDQLYLEFAKRAAPFNTWMDGAVEDLQDMFIVHTIDEIQGLISAHEQFKDTLPEAEKEKSAILGVHNEIQKVAQTYNVKLAGPNPYSAITPHDISSKWERMTQQVPLRDDSLRDLLARQQANETLRRQFAASANIVGPWIQTKMEEIGHISIE-MHGTLEDQLNQLRRYEQNIINYKPNIDKLESEYQLVQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVETQILTRDAKGISQEQMHEFRASFNHFDKDHSGKLGAEEFKACLISLGYDVGNDQQ---------------GEAEFARIMTVVDPNNTGLVTFQSFIDFMTRETTDTDTADQVIASFKILAGDKNFITADELRRELPPDQAEYCIARMAPYRGPDAVPGALDYMSFSTALYGESDL 856          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 302/507 (59.57%), Postives = 378/507 (74.56%), Query Frame = 2
Query:  152 TFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYID 1672
            TFTAWCNSHLRK    I+ I++DFRDGLKLM LLEVIS ERLPK +KGKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFHTS+KDGLAF ALIHRHRPDLIDY+ L KD+   NLN AF+VAEK+LDIP+MLDAED++  A+PDE ++M YVS YYHAFSGAQKAETA+NRICKVL VN E   L          LL+WI + IP+ +DR+   ++  M  KL++FR YR   KPPK  +K QLE  +NTLQT+LRL NRP F+P E K + DI + W  LE +EK +EEWL++E++RLE+LD+L  +F  +   H+SW+ GK +MLQ +DY + +L EL+AL K+ +AFESD + H+ RV +I  IA+EL  L YHD+ S++ +   I + WD +G+    R +++    ++LE ID L+L+FAK+      W++ A EDLQD F+VH ID
Sbjct:    5 TFTAWCNSHLRKAGTQIDSIDEDFRDGLKLMLLLEVISSERLPKPEKGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISIENTSAKEGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNHERVDLSCACVRARLQLLEWINRTIPVLEDRNTQNNMPAMQGKLEDFRDYRRVHKPPKAGDKCQLEINFNTLQTKLRLMNRPAFMPSEGKLVSDIGNAWSHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHKSWTEGKQQMLQQKDYESVSLAELKALLKKHEAFESDLAAHQDRVEQIAAIAQELNDLNYHDVASVNTKCKEICDEWDDLGEWTQTRKDSLSRTEKVLETIDHLYLEFAKRAAPFNTWMDGAAEDLQDMFIVHTID 511          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004049.1 (pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1 gene:ENSPMAG00000003699.1 transcript:ENSPMAT00000004049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 397.897 bits (1021), Expect = 1.060e-123
Identity = 214/490 (43.67%), Postives = 306/490 (62.45%), Query Frame = 2
Query:  134 EKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMED------LSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENI-DSLHL 1582
            E+ QK TFT W NSHL +V+  I  +  D RDG  L++LLEV+SGERLPK  KGKMR+H + NV K L F+ ++ V L  +GS +IVDGN ++TLG+IWTIILRF IQDI +E        SAK+ LLLWCQ KTA Y NV+V NF TS++DGLAF ALIH+HRPDLID++ L   +   N+  AF+VAE+ L + ++LDAED I    PDE SV+ YV +YYH FS  +       RI KVL    E ++++ +Y++L+++LL WIE+ I I  +R+ + S+  +  +L  F  YR  EKP K  EKG LE    T+Q+R+R +N+  F+P E K I +IN  W+ LE +E + E  L  EL R E+L+ L RRF  +    ESW     + L  +D   ++L  + A  K+ +A E+D + +E RV  +  +A+EL+   YHD+  + AR ++++  W Y+ +L   R   ++  + L   + + LHL
Sbjct:    5 EEVQKKTFTKWVNSHLSRVSCRIGDLYADLRDGRMLIKLLEVLSGERLPKPTKGKMRIHCLENVEKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDSREVKSAKDALLLWCQMKTAGYPNVRVHNFTTSWRDGLAFNALIHKHRPDLIDFDALDPADPYGNMQTAFNVAEQKLGLTQLLDAED-IAVEHPDEKSVITYVVTYYHYFSKMKALAVEGKRIGKVLESAMETDQMIEKYDSLASDLLDWIEQTIAILNNRTFANSLTGVQQQLQAFSSYRTVEKPAKFTEKGNLEVLLFTIQSRMRANNQKVFLPGEGKLISEINKAWERLEKAEHERELALREELIRQEKLEQLARRFDRKAAMRESWLTEN-QCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHL 492          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 405.216 bits (1040), Expect = 1.087e-120
Identity = 226/597 (37.86%), Postives = 357/597 (59.80%), Query Frame = 2
Query:  134 EKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMED------LSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKE 1906
            E  QK TFT W NSHL +V+  I  +  D RDG  L++LLEV+SGE+LPK  +GKMR+H + NV+K L F+ ++ V L  +GS +IVDGN ++ LG+IWTIILRF IQDI +E        SAK+ LLLWCQ KTA Y+NV + NF TS++DGLAF A++H+HRPDLI+++ L K NA  NL  AF++AE+ L + ++LD ED I   +PDE S++ YV +YYH FS  +       RI KVL    E ++++++YETL++ LL+WIE+ I I  +R  + S+  +  +L  F  YR  EKP K  EKG LE    T+Q+++R +N+  + P E K + +IN  W+ LE +E + E  L +EL R E+L+ L RRF  +    E+W +   + L ++D    +LP + A  K+ +A E+D + +E RV  +  +A EL   +YH+++ + +R ++++  W+Y+ +L A R   ++  L L            +++ +I +W+++ K  L       ++  V+ LL +H   +    D T + D + A++   +  + E +  K  ++      + +L + + EL SL  +R  +L+E
Sbjct:   56 EAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGEKLPKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPED-ISVDQPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLESAIETDQMIDKYETLASELLEWIEQTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVNEINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSEN-QRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQR--------VFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVE---ADITVQADRVKAVNAAAQRFSSEDDAYKPCDSHVVSERATHLEERYAELCSLAAERRSKLEE 639          

HSP 2 Score: 58.5362 bits (140), Expect = 7.578e-9
Identity = 48/222 (21.62%), Postives = 97/222 (43.69%), Query Frame = 2
Query: 1232 VRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLR---DEWEELNSLVPKR 1888
            ++ FHL CN  ++W   K ++++S   L  +L  + AL ++L   E D +  + ++  +   AE L  +      +I  RL  I + WD + +    R E++    +L +        F + + +   W+ +A+  +    M + + E + LL QH   K  + +   +Y       ++++ + E   + +   +P  M   Q L+     W ELN +   R
Sbjct:  960 IQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQ--------FLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDY-------QRMRDMGE--VVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENR 1164          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001834.1 (pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1 gene:ENSPMAG00000001663.1 transcript:ENSPMAT00000001834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 343.969 bits (881), Expect = 3.732e-102
Identity = 198/551 (35.93%), Postives = 301/551 (54.63%), Query Frame = 2
Query:  278 PKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKM------EDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESW--SNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKE 1906
            PK  +GKMR+H + NV+K L F+ ++ V L  +GS +IVDGN ++ LG+IWTIILRF IQDI +      E  SAK+ LLLWCQ KTA Y NV V NF TS++DGLAF A+IH+HRPDL+D+  L K NA+ NL  AF+ AE+HL + ++LD E  +   +PDE S++ YV S+YH FS  +       RI KVL    E ++++  YE+L++ LL+WI + I     R    S+  +  +L  F  YR  EKPPK  EKG LE    T+Q+++R +N+  + P E K + +IN  W+ LE +E   E  L  EL R E+L+ L RRF  +    E+W   N ++ M   +D   A+L  + A  K+ +A E+D + +E RV  +  +A EL    YH++  +  R + +++ W  + +L A R   ++  L L      +    A        W+++ K  L       ++  V+ LL +H   +    D  ++ D + A++      AEE +  +  +       +  L   + EL +L   R   L+E
Sbjct:    1 PKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVQTEDSKETRSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAVIHKHRPDLVDFEKLKKSNAQHNLQHAFNAAEQHLGVTKLLDPEADVSVDQPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDSAIEADRMVERYESLASELLEWIGRTITALNSRDFPNSLVGVQQQLHAFSSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVAEINRAWERLEKAEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVM---QDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGA--------WMDEMKLRLLSQECGKHLLGVEDLLQKHALVE---ADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEE 537          

HSP 2 Score: 50.0618 bits (118), Expect = 2.661e-6
Identity = 64/284 (22.54%), Postives = 127/284 (44.72%), Query Frame = 2
Query: 1046 LETAYNTLQTRLRLSNR--PNFIPPESKTIGDINHRWKDLENSE-KDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYM-GKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLR---DEWEELNSL 1876
            LE   N L +R+ + N+     +  E  +  DI  + +DL N+   +F E   S+ + L Q    ++ F L C+  ++W   K  +++S   L  +L  + AL ++L   E D +  E +V  +   AE L +       ++  +L    + W  + G L A R +++    +L +        F + V +   W+ + ++ +    +   + E + LL QH    E++K+  S Y E     ++++ + EE  + +   +P  +   Q L+     W EL+S+
Sbjct:  794 LEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAK-QDLLNARWSEFRELAESKKEAL-QAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRA-REDSLGEASKLQK--------FLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQH----EAIKNEISNYSE---DHRRMREMGEE--VTRDQSDPQHVFLRQRLQALHTGWAELHSM 1057          
BLAST of Alpha-actinin vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 56.9954 bits (136), Expect = 9.978e-9
Identity = 54/204 (26.47%), Postives = 89/204 (43.63%), Query Frame = 2
Query:  137 KQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLE-VISGE-------RLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAK------EGLLLWCQRK-TAPYKNVKVSNFH-TSFKDGLAFCALIHRHRPDLIDYNNLHKDNARE----NLNLAFDVAEK 688
            +++   FT W NS    V+  +  +  D +DGL L+Q  E V+ G        + P +     R   + N N  ++    KG  L  I   +IVDGN  +TLG++W ++ R     I M+ LS+         +L W Q + T   KN  + +F   +  +      +++   P  +DY+ +   N  E    N  LA  +A K
Sbjct:  411 EREARVFTLWLNS--LDVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNI--SITMKTLSSSGRDMSDSQILKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIARK 610          
BLAST of Alpha-actinin vs. Ensembl Yeast
Match: CMD1 (Calmodulin; Ca2+ binding protein that regulates Ca2+ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca2+ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin; binds to the Hog1p MAPK in response to hyperosmotic stress; potentiates membrane tubulation and constriction mediated by the Rvs161p-Rvs167p complex; human CALM1 or CALM2 functionally complement repression induced inviability [Source:SGD;Acc:S000000313])

HSP 1 Score: 47.7506 bits (112), Expect = 6.980e-7
Identity = 34/130 (26.15%), Postives = 58/130 (44.62%), Query Frame = 2
Query: 2267 SKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKD-YITEEELRRELP 2653
            S  L+ EQ+ EF+  F  FDKD+   +  +E    + SLG                     S  EA+ + +M ++D + +  + F  F+  M+ +    DS  ++L +FKV   + D  I+  EL+  L 
Sbjct:    2 SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGL--------------------SPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLT 111          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 489/915 (53.44%), Postives = 655/915 (71.58%), Query Frame = 2
Query:   71 YSGYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQ---------------NLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            Y GY    Y EE   ++DP WE+QQK TFTAWCNSHLRK  + I  IE+D RDG+ L+QLLE+ISGERLP  ++GK+R H+IANVNK L+F+A KGVKL  +G+EEIVDGN+KMTLGMIWTIILRFAIQDI +ED  AK+GLLLWCQRKTAPYKNV V NF TSFKDGLAFCALIHRHRPDLIDY++L K++   NLN AFDVAE++LDIPRMLD EDM++  +PDE +VM YVSSYYHAF+ +Q+A+TA+ RI KVL +N++NE++M +YE L+++LL WI K +P    R    ++++M  KLD  R YR  EKPPK EEKGQLET +NTLQT+LRLSNRP ++P E K I DIN  W  LE +EKDFE+WL+ E++R+E+LD+L  +F  +CN HESW+NGK  +L  +DY +A L ++ AL K+ +AFESD + H+ RV +I  IA+EL  LEY  +  ++AR  +I + W  +G+L   R + +++  Q L+++D L L+FAKK     NW+E A+EDL D F VH ++E++ LLD H  FKE++  A +EY+ ++ I+ +I+SL+ +       ENPYT ++ +               ++ + W ++  LVPKR   L++E ++Q+++E LR+++AN AN VGPW+  + EKL ++  + ++ SLE+    L  LE  +  ++P  EEL+  +QE+ + LIFEN HT+Y+ME +RV WEQLL++I +  NE++NQILTRDSKG++ EQM+EFR  FN FDKD T  LEPNEFK CLVSLGYN+KE      DK          G+ +F R++  VDPN  G VTF AF+DFMT ETAD D+++Q++ SF++LAGDK +IT EELRRELP +QAEYCIA M PY G        DY SFS +LYG SDL
Sbjct:    8 YYGYF---YGEEDKGLLDPAWERQQKKTFTAWCNSHLRKTGKQIGEIEEDLRDGVLLLQLLEIISGERLPHPERGKLRFHRIANVNKALDFVAGKGVKLVSVGAEEIVDGNLKMTLGMIWTIILRFAIQDIAIEDSFAKDGLLLWCQRKTAPYKNVSVKNFTTSFKDGLAFCALIHRHRPDLIDYDSLRKEDPLYNLNKAFDVAEQYLDIPRMLDPEDMVETERPDERAVMTYVSSYYHAFTSSQQADTAAKRIGKVLNINRDNERMMEDYERLASDLLDWINKTMPWLTSRDTDGTLKDMQRKLDELRNYRKGEKPPKVEEKGQLETNFNTLQTKLRLSNRPAYLPSEGKMINDINDAWGGLEMAEKDFEDWLLMEMRRMERLDHLAEKFRHKCNIHESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELTMHRLQKLEDAQQRLQSLDQLRLEFAKKAAPFNNWLESAREDLMDMFSVHTVEEIQELLDAHEAFKENMPAAQAEYNSIMDIAVQIESLSGQ-------ENPYTSLSKEASPITDMLFTFVFVCDINEGWNQVVDLVPKRDILLRDERSKQDRNERLRVEFANKANVVGPWIQQQGEKLRTIGFH-MEGSLEKNLQVLQDLETFITSYKPNIEELEVINQEVQQALIFENPHTKYTMEAMRVGWEQLLTAIARNINEVENQILTRDSKGITEEQMKEFRASFNFFDKDQTGKLEPNEFKQCLVSLGYNIKE-----GDK----------GDREFERLLGIVDPNGTGKVTFQAFVDFMTRETADSDTAEQVMESFRILAGDKPFITAEELRRELPPDQAEYCIARMAPYEGKDAVPGALDYMSFSTALYGESDL 896          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 389.037 bits (998), Expect = 5.541e-115
Identity = 213/528 (40.34%), Postives = 324/528 (61.36%), Query Frame = 2
Query:  134 EKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMED-----LSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDM-IKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQH 1699
            E+ QK TFT W NSHL++V   +  +  D +DG KL+ LLEV+SGE+LPK  KG+MR+H + NV K L F+ ++ V L  +G+ +IVDGN K+TLG+IWTIILRF IQDI +E       SAK+ LLLWCQ KT  Y +V ++NF TS++DGLAF A+IHRHRPDLI++  L K +A +NL  AF+VAE  L I  +LDAED+ + F  PDE S++ YV++YYH F+  +  E + +RI KV+   +ENE+L+ +YE L+++LL+WIE  I    +R  + ++  +  ++  F +YR  EKPP+  EKG LE     L +++R +++  +IPPE + + DIN  W+ LE SE + E  L  EL R E+L+ L  +F  +    E+W N    ++  +++ N +L  + A  K+ +A E+D   +E RV  I  +AEEL +  YHD + I      I++ W+ +  L  +R   ++  +QL            +++ NI +W+++ K  L       ++  V+ LL +H
Sbjct:   23 ERVQKKTFTKWINSHLQRVGARVNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRMRIHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITIEGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDF--PDEKSILTYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYEKLASDLLEWIEIKIIQLGEREFANTLLGVQQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMIDINRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNFGN-DLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQR--------VFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKH 539          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 359.377 bits (921), Expect = 1.411e-110
Identity = 219/599 (36.56%), Postives = 332/599 (55.43%), Query Frame = 2
Query:  143 QKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMED------LSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWD-YMGKLDAERN--ENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEEL 1912
            QK TFT W NS L K   ++  + +D  DG  L+ LLE+ISGE++  A +GK RVH I NVNK L F+ QK VKL  IG+E++VDGN ++ LG+IW IILRF I DI  +D       SAKE LLLWCQR T  Y  V + NF TS+++GLAF AL+H+HRPDLIDY  L       NLN AF VA + L I R+LDAED +   +PD+ SVM YV++YY  F+  +  ET   RI K++GV  E EK+   YE++ ++LL WI   I     R    ++  +  +L  F+ +R  EKPPK+ E+  +E     LQT+ + +N+  F PPE K + DIN  W+ +E++E +  + L +EL R + L+ +  +F  + +  ESW +  ++++  E  L  +   + A  KR +A  +D    E R   +  +A+EL   +Y+    I  R + I+  WD  + KL+A RN       ++ +  ++DS H D       + +          + +  H +D V+ +LD+H   +  ++   S+++  +AI+ + +S         A ++P T V  Q  R   +   +LV + GKE +  L
Sbjct:   25 QKKTFTKWVNSFLDKSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFL-QKSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAED-VDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELA-RPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQVMESAEHERAQALRNELIRQQMLEKMAEKFQRKADLRESWLDDMVQVIDDE-LLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRS----------EDYGRHLLD-VQNMLDKHSLVESQIQ---SQHERTLAINTQAQSFV-------AAKHPETEVIKQRQRLLTQAFQALV-QLGKERRARL 597          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 304.679 bits (779), Expect = 3.364e-95
Identity = 162/345 (46.96%), Postives = 216/345 (62.61%), Query Frame = 2
Query:  143 QKTTFTAWCNSHLRKVNQNIEV--IEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMED------LSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWK 1153
            QK TFT W NS L KV   + V  + +D  DG  L+ LLE+ISGE++  A +GK RVH I NVNK L F+ QK VKL  IG+E++VDGN ++ LG+IW IILRF I DI  +D       SAKE LLLWCQR T  Y +V + NF TS+++GLAF AL+H+HRPDLIDY  L       NLN AF VAE+ L I R+LDAED +   +PD+ SVM YV++YY  F+  +  ET   RI K++GV  E EK+   YE++ ++LL WI   I     R    ++  +  +L  F+ +R  EKPPK+ E+  +E     LQT+ + +N+  F PPE K + DIN  W+
Sbjct:   25 QKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFL-QKSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAED-VDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELA-RPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQ 366          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: EDO26730 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DV03])

HSP 1 Score: 221.861 bits (564), Expect = 3.513e-64
Identity = 137/406 (33.74%), Postives = 222/406 (54.68%), Query Frame = 2
Query: 1565 IDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVI---QASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFM-THETADEDSSDQMLRSFKVL--AGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGG-DVCG-YDYQSFSNSLYG 2758
            ++ L L FAKK     +W E A+EDL D    + ++E++AL + H QF+ SL  A  +   L  + ++IKS        K   NPYT  T + L D WE L  ++ +R ++L +E  RQE ++ LR ++A  AN    WL   + +  S+   ++   Q  LE+Q +E+ + + E+ D +   E ++    ++ + LI +NR+T++S   +   W+QL     + ++ ++ QI  R + G+S E ++EF   F HFDKD T  L+  EFK+CL SLGY+L   ++  +D              +F  I+ +VDPN DG V+   ++ FM + ET +  SS ++  +FK L   G + ++TE +L + L KEQAEYCI  M PY    G ++ G YDY+SF  +L+ 
Sbjct:   16 VEDLFLLFAKKASAFNSWFENAEEDLTDPVRCNSVEEIRALQEAHAQFRLSLDQAEEDMYSLRKLDRQIKSY-------KVSINPYTWFTMEALEDTWENLQKIIEEREEDLAKEAQRQEYNDRLRQEFAQHANAFHSWL--TETRFVSMGLAIMVEGQGDLEDQLAEIKRKDTEIADCKADLEVIEGLGAQMEEALILDNRYTEHSTVDLAQQWDQLDQLAMRMKHNLEQQIQARKTTGVSEETLKEFTIMFKHFDKDKTGYLDHQEFKSCLRSLGYDLPVVEEGETD-------------PEFETILSRVDPNGDGVVSMGEYMAFMISRETENVGSSQEVENAFKALTEGGKRKFVTESDLYQSLTKEQAEYCIDRMQPYVDDKGREIPGAYDYKSFCKALFA 399          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: ENSORLT00000001153.2 (alpha-actinin-4 [Source:NCBI gene;Acc:101155449])

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 498/904 (55.09%), Postives = 670/904 (74.12%), Query Frame = 2
Query:   95 YLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRA-------SVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            Y+E+++D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRPDLIDY +L KD+   NLN AF+VAEKHLDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE++M +YE L++NLL+WI + IP  +DR++  +V +M  K ++FR YR   KPPK +EK QLE ++NTLQT+LRLSNRP F+P E + + DIN  W  LE +EK +EEW++SE++RLE+L++L  +FH +   HESW+NGK  ML  +DY  + L E++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++ R   I + WD +G L   R ++++   + LE+ID L+L++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L +A  E + + AI  +++ +A+ + +  +  NPYT +T +++ D+WE+  ++VP+R K L+ EL +Q  ++ LR  +A  AN VG ++ A+ E++  +S   +  +LE+Q + L + +Q ++ F P+   L+   Q + + LIF+N++T Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQ+ E+R  FNHFDKDHT  L   EFKACL+SLGY+++ +K   S +      RA       S+G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D+DS+DQ++ SFK+LAGDK+YI  +ELRRELP +QAEYCIA M PYTGP G     DY SFS +LYG SDL
Sbjct:   18 YMEQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNIKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYESLRKDDPVTNLNNAFEVAEKHLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQMMEDYEKLASNLLEWIRRTIPWLEDRTQQKTVNDMQAKQEDFRDYRTVHKPPKVQEKCQLEISFNTLQTKLRLSNRPAFMPSEGRMVSDINSAWHTLEGAEKGYEEWILSEIRRLERLEHLAEKFHQKAAIHESWTNGKEAMLTQKDYETSTLSEVKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSASVNNRCQKICDQWDTLGTLTHSRKDSLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIEEIQGLIAAHEQFKSTLPEANKEREAIQAIQAEVQKIAQSNGIKLSGANPYTTITPRSIDDKWEQAMAMVPQRDKALQGELNKQNSNDTLRATFAKQANVVGGYIQAKMEEIGRISIE-MNGTLEDQLTHLREYQQTILFFMPEINTLEGYHQHIQEALIFDNQYTSYTMEHLRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLYEYRASFNHFDKDHTGSLIAEEFKACLISLGYDVENEKQKRSGQMASDDFRALLISTGTSLGDAEFTRIMSIVDPNNSGAVTFQAFIDFMSSETTDKDSADQVIASFKILAGDKNYIMADELRRELPPDQAEYCIARMAPYTGPDGVPGALDYMSFSTALYGESDL 920          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:101169077])

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 499/904 (55.20%), Postives = 659/904 (72.90%), Query Frame = 2
Query:   80 YVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDK-------DSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            Y  P+   ++  ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK LNFIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W+ GK EMLQ  DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R+E ++   +LLE ID L+L+FAK+     NW+E A EDLQDSF+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  A  NPYT +  Q +  +W+++  LVP R + L EE  RQ+ +E LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q +   LIF+N+HT Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQ+ EFR  FNHFD+DH+  L   EFKACL+SLG+++  D        D+   K        ++GE +FSRIM  VDPN  G VTF  FIDFM+ ETAD D++DQ++ SFK+LAGDK+YI  +ELRRELP +QAEYCIA M PY+GP G     DY SFS +LYG SDL
Sbjct:   10 YRHPEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRMPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEEMLQRRDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRICDQWDALGALSQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDSFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGSNPYTTINPQEVNAKWDKVRQLVPLRDQSLIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLTHLRQYEKSIINYKPKIDQLEGDHQLIQAALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQKRTGIMDAEDFKTCLISMGYNLGENEFSRIMSVVDPNRMGVVTFQGFIDFMSRETADTDTADQVMASFKILAGDKNYILADELRRELPPDQAEYCIARMAPYSGPDGVPGALDYMSFSTALYGESDL 912          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: ENSORLT00000027622.1 (alpha-actinin-4 [Source:NCBI gene;Acc:101155449])

HSP 1 Score: 1041.18 bits (2691), Expect = 0.000e+0
Identity = 496/904 (54.87%), Postives = 668/904 (73.89%), Query Frame = 2
Query:   95 YLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRA-------SVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            Y+E+++D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRPDLIDY +L KD+   NLN AF+VAEKHLDIP+MLDAED++   +PDE ++M YVS +YHAFSGAQKAETA+NRICKVL VNQENE++M +YE L++NLL+WI + IP  +DR++  +V +M  K ++FR YR   KPPK +EK QLE ++NTLQT+LRLSNRP F+P E + + DIN  W  LE +EK +EEW++SE++RLE+L++L  +FH +   HESW+NGK  ML  +DY  + L E++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++ R   I + WD +G L   R ++++   + LE+ID L+L++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L +A  E + + AI  +++ +A+ + +  +  NPYT +T +++ D+WE+  ++VP+R K L+ EL +Q  ++ LR  +A  AN VG ++ A+ E++  +S   +  +LE+Q + L + +Q ++ F P+   L+   Q + + LIF+N++T Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQ+ E+R  FNHFDKDHT  L   EFKACL+SLGY+++ +K   S +      RA       S+G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D+DS+DQ++ SFK+LAGDK+YI  +ELRRELP +QAEYCIA M PYTGP G     DY SFS +LYG SDL
Sbjct:   18 YMEQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNIKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYESLRKDDPVTNLNNAFEVAEKHLDIPKMLDAEDIVGTLRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEQMMEDYEKLASNLLEWIRRTIPWLEDRTQQKTVNDMQAKQEDFRDYRTVHKPPKVQEKCQLEISFNTLQTKLRLSNRPAFMPSEGRMVSDINSAWHTLEGAEKGYEEWILSEIRRLERLEHLAEKFHQKAAIHESWTNGKEAMLTQKDYETSTLSEVKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSASVNNRCQKICDQWDTLGTLTHSRKDSLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIEEIQGLIAAHEQFKSTLPEANKEREAIQAIQAEVQKIAQSNGIKLSGANPYTTITPRSIDDKWEQAMAMVPQRDKALQGELNKQNSNDTLRATFAKQANVVGGYIQAKMEEIGRISIE-MNGTLEDQLTHLREYQQTILFFMPEINTLEGYHQHIQEALIFDNQYTSYTMEHLRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLYEYRASFNHFDKDHTGSLIAEEFKACLISLGYDVENEKQKRSGQMASDDFRALLISTGTSLGDAEFTRIMSIVDPNNSGAVTFQAFIDFMSSETTDKDSADQVIASFKILAGDKNYIMADELRRELPPDQAEYCIARMAPYTGPDGVPGALDYMSFSTALYGESDL 920          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:101169077])

HSP 1 Score: 1041.18 bits (2691), Expect = 0.000e+0
Identity = 497/897 (55.41%), Postives = 655/897 (73.02%), Query Frame = 2
Query:   80 YVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            Y  P+   ++  ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERL K ++GKMRVHKI+NVNK LNFIA KGVKL  IG+EEIVDGN KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV + NFH S+KDGL FCALIHRHRP+LIDY  L KD+   NLN AFDVAEK+LDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE+LM +YE L+++LL+WI + IP  ++R    +++ M  KL++FR YR   KPPK +EK QLE  +NTLQT+LRLSNRP F+P E K + DIN+ W  LE +EK +EEWL++E++RLE+LD+L  +F  +   HE+W+ GK EMLQ  DY  A L E++AL K+ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++AR   I + WD +G L  +R+E ++   +LLE ID L+L+FAK+     NW+E A EDLQDSF+VH I+E++ L   H QFK +L +A  E   ++ I  +I  + + +++  A  NPYT +  Q +  +W+++  LVP R + L EE  RQ+ +E LR ++AN AN +GPW+  + E++  +S   +  +LE+Q + L + E+ +++++PK ++L+   Q +   LIF+N+HT Y+ME +RV WEQLL++I +T NEI+NQILTRD+KG+S EQ+ EFR  FNHFD+DH+  L   EFKACL+SLG+++  D               + GE +FSRIM  VDPN  G VTF  FIDFM+ ETAD D++DQ++ SFK+LAGDK+YI  +ELRRELP +QAEYCIA M PY+GP G     DY SFS +LYG SDL
Sbjct:   10 YRHPEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRMPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEEMLQRRDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRICDQWDALGALSQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDSFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGSNPYTTINPQEVNAKWDKVRQLVPLRDQSLIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIE-MHGTLEDQLTHLRQYEKSIINYKPKIDQLEGDHQLIQAALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGND---------------AQGENEFSRIMSVVDPNRMGVVTFQGFIDFMSRETADTDTADQVMASFKILAGDKNYILADELRRELPPDQAEYCIARMAPYSGPDGVPGALDYMSFSTALYGESDL 890          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: ENSORLT00000001151.2 (alpha-actinin-4 [Source:NCBI gene;Acc:101155449])

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 494/908 (54.41%), Postives = 664/908 (73.13%), Query Frame = 2
Query:   95 YLEEQHD-----VIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDK-----------DHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            Y+E+++D     ++DP WEKQQ+ TFTAWCNSHLRK    IE IE+DFRDGLKLM LLEVISGERLPK ++GKMRVHKI NVNK L+FIA KGVKL  IG+EEIVDGN+KMTLGMIWTIILRFAIQDI +E+ SAKEGLLLWCQRKTAPYKNV V NFH S+KDGLAF ALIHRHRPDLIDY +L KD+   NLN AF+VAEKHLDIP+MLDAED++  A+PDE ++M YVSS+YHAFSGAQKAETA+NRICKVL VNQENE++M +YE L++NLL+WI + IP  +DR++  +V +M  K ++FR YR   KPPK +EK QLE ++NTLQT+LRLSNRP F+P E + + DIN  W  LE +EK +EEW++SE++RLE+L++L  +FH +   HESW+NGK  ML  +DY  + L E++AL ++ +AFESD + H+ RV +I  IA+EL +L+Y+D  S++ R   I + WD +G L   R ++++   + LE+ID L+L++AK+     NW+E A EDLQD F+VH I+E++ L+  H QFK +L +A  E + + AI  +++ +A+ + +  +  NPYT +T +++ D+WE+  ++VP+R K L+ EL +Q  ++ LR  +A  AN VG ++ A+ E++  +S   +  +LE+Q + L + +Q ++ F P+   L+   Q + + LIF+N++T Y+ME +RV WEQLL++I +T NE++NQILTRD+KG+S EQ+ E+R  FNHFDK           DHT  L   EFKACL+SLGY+++ +K                G+A+F+RIM  VDPNN G VTF AFIDFM+ ET D+DS+DQ++ SFK+LAGDK+YI  +ELRRELP +QAEYCIA M PYTGP G     DY SFS +LYG SDL
Sbjct:   18 YMEQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNIKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYESLRKDDPVTNLNNAFEVAEKHLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQMMEDYEKLASNLLEWIRRTIPWLEDRTQQKTVNDMQAKQEDFRDYRTVHKPPKVQEKCQLEISFNTLQTKLRLSNRPAFMPSEGRMVSDINSAWHTLEGAEKGYEEWILSEIRRLERLEHLAEKFHQKAAIHESWTNGKEAMLTQKDYETSTLSEVKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSASVNNRCQKICDQWDTLGTLTHSRKDSLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIEEIQGLIAAHEQFKSTLPEANKEREAIQAIQAEVQKIAQSNGIKLSGANPYTTITPRSIDDKWEQAMAMVPQRDKALQGELNKQNSNDTLRATFAKQANVVGGYIQAKMEEIGRISIE-MNGTLEDQLTHLREYQQTILFFMPEINTLEGYHQHIQEALIFDNQYTSYTMEHLRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLYEYRASFNHFDKSTSGAEKGGRCDHTGSLIAEEFKACLISLGYDVENEKQ---------------GDAEFTRIMSIVDPNNSGAVTFQAFIDFMSSETTDKDSADQVIASFKILAGDKNYIMADELRRELPPDQAEYCIARMAPYTGPDGVPGALDYMSFSTALYGESDL 909          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 1876.68 bits (4860), Expect = 0.000e+0
Identity = 904/906 (99.78%), Postives = 905/906 (99.89%), Query Frame = 2
Query:   53 MNSISNYSGYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            MNSISNYSGYVDPDYLEEQHDVID LWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAY+GSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL
Sbjct:    1 MNSISNYSGYVDPDYLEEQHDVIDLLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYVGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 906          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 1857.8 bits (4811), Expect = 0.000e+0
Identity = 898/906 (99.12%), Postives = 899/906 (99.23%), Query Frame = 2
Query:   53 MNSISNYSGYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            MNSISNYSGYVDPDYLEEQHDVID LWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAY+GSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKE      DKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL
Sbjct:    1 MNSISNYSGYVDPDYLEEQHDVIDLLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYVGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKE------DKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 900          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 1847.4 bits (4784), Expect = 0.000e+0
Identity = 894/906 (98.68%), Postives = 895/906 (98.79%), Query Frame = 2
Query:   53 MNSISNYSGYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            MNSISNYSGYVDPDYLEEQHDVID LWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAY+GSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDK          GEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL
Sbjct:    1 MNSISNYSGYVDPDYLEEQHDVIDLLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYVGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDK----------GEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 896          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 1833.92 bits (4749), Expect = 0.000e+0
Identity = 888/906 (98.01%), Postives = 889/906 (98.12%), Query Frame = 2
Query:   53 MNSISNYSGYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            MNSISNYSGYVDPDYLEEQHDVID LWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAY+GSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDK                GEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL
Sbjct:    1 MNSISNYSGYVDPDYLEEQHDVIDLLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYVGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDK----------------GEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 890          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000047739.1 (SMESG000047739.1)

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 538/907 (59.32%), Postives = 691/907 (76.19%), Query Frame = 2
Query:   59 SISNYSGYVD---PDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 2770
            SI ++ G+VD    D   E+ + I+ LWEKQQK+TFTAWCNSHLRKVN  I VI +DFRDGL LM+LLEVISGE LPK DKGKMRVHKIANVNKCL FI +KGVKL  + +EEIVDGNVKMTLGMIWTIILRFAIQDIK++D+SAKEGLLLWCQRKT+PY+NV+V+NFH SFKDGLAFCALIHRHRP+LIDY +L K+N   NLN AF++AEK+LDIPRML+ EDM+   KPDELSVMAYVSSYYHAF+GA KAETASNRICKV+ VN+ENE L+N Y+ L+++L+ WI+  +   Q+++   SV  M N  DNFRKYR  +KPP+ EEKG+LE+ YNTLQTRLRLSNRP F+P E   I DIN+ WKDLE +EKD+EEWLMSE++R+EQLD+LV+ F +RC THE+WS GK+EML+S+ Y  ANL ELRA+ K+ +AFESDF  H  RV RI  IA EL++L YHDM SI++RL+ I   W+ M  L  ++  +I+ I +LLE ID + LD+AKK+   +NWIEQAKEDLQDS ++HYIDEVK L+++  +FK+S+++A  E++ L  I  KI+  A +++L +  +NPYT++  + L  EW +L++L+P R + L++EL++Q  +E LR K+ +LANK+GPWLD +Q+ +N L                 +LE ++ ++R  A E+D+CSQEL + +IFE  + ++SME +RVSWEQL SS+R+++ EI+NQILTRDSKG+S  QM+EFRRCFNHFDK+ T+ LEP EFKACLVSLG NLKE+K                GEA+F +IM +VDP+  G VTF AFID+M  ET ++D+ +Q+L+SFKVL  D+DYIT EELRRELP E+AEYCIANM PY  P G     DY+ F++SLYG SDL
Sbjct:    2 SIVDFEGFVDRAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQISNEQLREKFGSLANKLGPWLDEKQQLVNHLK----------------QLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK----------------GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 874          
The following BLAST results are available for this feature:
BLAST of Alpha-actinin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTN10.000e+055.14actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163][more]
ACTN10.000e+055.35actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163][more]
ACTN40.000e+056.35actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166][more]
ACTN40.000e+056.35actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166][more]
ACTN10.000e+054.79actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163][more]
back to top
BLAST of Alpha-actinin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atn-10.000e+051.75AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+050.00AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+051.01AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+048.96AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
unc-702.568e-12146.00Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actn0.000e+054.90gene:FBgn0000667 transcript:FBtr0070344[more]
Actn0.000e+054.68gene:FBgn0000667 transcript:FBtr0333801[more]
Actn0.000e+054.68gene:FBgn0000667 transcript:FBtr0070343[more]
Actn0.000e+054.68gene:FBgn0000667 transcript:FBtr0303048[more]
Actn0.000e+054.78gene:FBgn0000667 transcript:FBtr0310657[more]
back to top
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn40.000e+054.92actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
actn40.000e+054.61actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
actn40.000e+054.70actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
actn10.000e+055.46actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-... [more]
actn10.000e+055.46actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn40.000e+055.44actinin alpha 4 [Source:NCBI gene;Acc:448522][more]
actn40.000e+055.13actinin alpha 4 [Source:NCBI gene;Acc:448522][more]
actn10.000e+054.88actinin alpha 1 [Source:NCBI gene;Acc:780123][more]
actn40.000e+055.13actinin alpha 4 [Source:NCBI gene;Acc:448522][more]
actn40.000e+055.22actinin alpha 4 [Source:NCBI gene;Acc:448522][more]
back to top
BLAST of Alpha-actinin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actn40.000e+056.26actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773... [more]
Actn10.000e+055.23actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:213770... [more]
Actn40.000e+056.12actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773... [more]
Actn10.000e+054.68actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:213770... [more]
Actn30.000e+053.90actinin alpha 3 [Source:MGI Symbol;Acc:MGI:99678][more]
back to top
BLAST of Alpha-actinin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P05094|ACTN1_CHICK0.000e+055.57Alpha-actinin-1 OS=Gallus gallus OX=9031 GN=ACTN1 ... [more]
sp|Q3B7N2|ACTN1_BOVIN0.000e+055.23Alpha-actinin-1 OS=Bos taurus OX=9913 GN=ACTN1 PE=... [more]
sp|Q2PFV7|ACTN1_MACFA0.000e+055.35Alpha-actinin-1 OS=Macaca fascicularis OX=9541 GN=... [more]
sp|P12814|ACTN1_HUMAN0.000e+055.35Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 P... [more]
sp|Q9Z1P2|ACTN1_RAT0.000e+055.12Alpha-actinin-1 OS=Rattus norvegicus OX=10116 GN=A... [more]
back to top
BLAST of Alpha-actinin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NYF00.000e+056.99Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4D5RA680.000e+056.11Alpha-actinin, sarcomeric OS=Scolopendra viridis O... [more]
A0A1S3HNG40.000e+057.02alpha-actinin, sarcomeric isoform X4 OS=Lingula un... [more]
A0A087U8H10.000e+056.61Alpha-actinin, sarcomeric (Fragment) OS=Stegodyphu... [more]
A0A2L2Y0V90.000e+056.84Putative alpha actinin OS=Parasteatoda tepidarioru... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn10.000e+054.59actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn10.000e+054.79actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn10.000e+054.25actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn10.000e+054.23actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn40.000e+054.81actinin alpha 4 [Source:NCBI gene;Acc:103022122][more]
back to top
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009295.10.000e+054.64pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
ENSPMAT00000000684.10.000e+059.57pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000004049.11.060e-12343.67pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1... [more]
ENSPMAT00000008111.11.087e-12037.86pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
ENSPMAT00000001834.13.732e-10235.93pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SAC69.978e-926.47Fimbrin, actin-bundling protein; cooperates with S... [more]
CMD16.980e-726.15Calmodulin; Ca2+ binding protein that regulates Ca... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
ALPHA-ACTININ0.000e+053.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424315.541e-11540.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495761.411e-11036.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291013.364e-9546.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267303.513e-6433.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001153.20.000e+055.09alpha-actinin-4 [Source:NCBI gene;Acc:101155449][more]
actn10.000e+055.20actinin alpha 1 [Source:NCBI gene;Acc:101169077][more]
ENSORLT00000027622.10.000e+054.87alpha-actinin-4 [Source:NCBI gene;Acc:101155449][more]
actn10.000e+055.41actinin alpha 1 [Source:NCBI gene;Acc:101169077][more]
ENSORLT00000001151.20.000e+054.41alpha-actinin-4 [Source:NCBI gene;Acc:101155449][more]
back to top
BLAST of Alpha-actinin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026000.10.000e+099.78SMESG000026000.1[more]
SMESG000026000.10.000e+099.12SMESG000026000.1[more]
SMESG000026000.10.000e+098.68SMESG000026000.1[more]
SMESG000026000.10.000e+098.01SMESG000026000.1[more]
SMESG000047739.10.000e+059.32SMESG000047739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005523 ID=SMED30005523|Name=Alpha-actinin|organism=Schmidtea mediterranea sexual|type=transcript|length=2850bp
GTTAATATAAGTATATTAATTTACAAAATCTTATTTTAAATTATTCAGCG
ACATGAATTCAATAAGCAATTACTCTGGATACGTCGATCCTGATTACTTA
GAAGAACAACATGATGTTATTGATCCGCTGTGGGAAAAACAACAAAAGAC
AACATTTACAGCTTGGTGCAATTCTCACCTGAGAAAAGTCAATCAAAACA
TAGAAGTAATTGAGCAAGACTTTCGAGATGGACTTAAACTAATGCAACTT
CTTGAAGTGATTAGTGGTGAACGATTACCAAAAGCTGACAAAGGAAAAAT
GAGAGTTCATAAAATTGCAAATGTTAACAAATGCTTGAATTTTATTGCCC
AGAAAGGAGTGAAGTTAGCATATATTGGCAGTGAAGAAATCGTCGACGGA
AATGTTAAAATGACTCTGGGAATGATTTGGACCATTATATTAAGATTCGC
TATTCAGGATATTAAAATGGAAGATCTTTCCGCCAAAGAGGGTCTTTTGC
TTTGGTGCCAACGAAAAACAGCACCATATAAAAATGTGAAAGTGTCTAAT
TTTCACACAAGCTTCAAGGATGGTCTAGCGTTCTGCGCTCTAATTCACCG
TCATAGACCAGACCTGATTGATTATAATAACTTACACAAGGATAATGCTC
GTGAAAATCTGAATCTGGCTTTTGATGTCGCAGAAAAGCATCTCGACATT
CCTCGAATGTTGGATGCAGAAGACATGATAAAGTTTGCGAAGCCAGATGA
GCTGTCGGTGATGGCCTACGTGTCATCCTATTATCATGCCTTTTCAGGCG
CTCAAAAGGCCGAAACAGCTTCCAATAGAATTTGCAAAGTATTAGGAGTC
AACCAAGAAAACGAGAAATTGATGAATGAATATGAAACATTATCTACAAA
TTTATTGAAATGGATAGAAAAAATGATTCCTATTTTTCAAGATCGGTCAG
AAAGCACTTCAGTTGAAAACATGCACAACAAGCTTGATAATTTCCGTAAA
TACAGAATTACTGAAAAACCACCGAAGCACGAAGAAAAAGGCCAACTGGA
AACCGCATATAACACTTTACAAACCAGATTGAGACTCAGCAATCGACCTA
ATTTTATTCCACCCGAAAGCAAAACGATTGGTGATATCAATCACCGATGG
AAAGATTTGGAAAACTCCGAAAAAGATTTCGAAGAATGGCTCATGTCGGA
ATTACAACGACTTGAGCAACTTGATTATTTGGTACGTCGCTTCCATTTAC
GCTGTAACACTCACGAATCATGGTCGAATGGAAAAATCGAAATGCTCCAG
TCGGAAGATTATTTGAATGCGAATCTACCGGAATTGAGAGCACTTTACAA
ACGATTGCAAGCTTTTGAATCTGATTTTAGTGGACATGAACCGAGAGTTG
TTCGTATCAATGTTATTGCGGAAGAACTCAGGAAATTGGAATACCACGAC
ATGAAATCAATCGATGCCAGATTGAATTCCATTGTGGAAACATGGGATTA
TATGGGCAAATTGGATGCTGAACGAAATGAAAACATTAAAAATATCTTGC
AGCTTCTTGAAAATATCGATTCTTTACATCTCGACTTCGCTAAAAAGGTT
CCAAATATTTACAACTGGATCGAGCAGGCCAAAGAAGATTTACAAGATTC
ATTTATGGTGCATTATATTGACGAAGTCAAGGCGCTATTAGATCAGCACT
ATCAATTCAAAGAATCACTCAAAGATGCTACTTCTGAATACGATGAATTA
ATTGCAATTTCTAAAAAAATCAAAAGCCTGGCCGAAGAACATAATCTAGG
AAAAGCCGTGGAGAATCCATATACAATGGTAACATCTCAGAATTTACGTG
ATGAATGGGAAGAATTAAACAGTCTGGTACCAAAACGTGGAAAAGAATTA
AAAGAAGAATTGACTCGCCAGGAACAACATGAAAATCTCAGACTCAAATA
CGCTAATTTGGCCAATAAAGTCGGGCCGTGGTTGGATGCACGTCAAGAAA
AATTGAACTCATTAAGTAATAATGTCATTCAAGCAAGTTTAGAAGAACAG
AAATCGGAATTGTATAAATTAGAGCAAGAAGTTATGGATTTCCGGCCGAA
AGCGGAAGAGCTTGATCAATGCAGCCAGGAATTGCACAAATATCTAATAT
TTGAAAACCGACACACTCAATATTCCATGGAAATAGTCCGTGTCAGTTGG
GAGCAATTGTTATCTTCAATTAGAAAGACAAGAAATGAAATCGATAATCA
AATTTTAACTCGCGACTCAAAAGGATTAAGCAGCGAACAAATGGAAGAAT
TCCGAAGATGTTTCAATCATTTCGATAAAGATCACACAAAAATGCTCGAA
CCGAATGAATTTAAAGCCTGTCTAGTTTCTTTGGGCTATAATTTAAAGGA
AGACAAGGATTCACATTCTGATAAAGATAATCAGCACGGCCGTAGAGCAT
CTGTGGGTGAGGCTGACTTCTCGAGAATCATGCTTCAAGTTGATCCAAAT
AATGATGGCTATGTAACATTTGATGCGTTCATTGATTTCATGACTCACGA
AACAGCCGACGAAGACAGTTCAGATCAAATGTTGAGATCATTTAAAGTGT
TGGCTGGAGATAAGGATTACATTACCGAGGAAGAACTTCGCCGCGAATTG
CCGAAGGAACAAGCAGAATACTGCATTGCAAATATGCTACCTTATACCGG
TCCCGGTGGAGATGTATGTGGATATGATTACCAATCGTTCTCCAATTCTC
TGTACGGACTCTCTGATTTATAAATGCTTAATCTGTGTTCTGTGTAACGG
CTCAAATGTTATGTTTCGTTGACTTTCTAGCAGAAGCCTGCTCAAGTCTG
back to top

protein sequence of SMED30005523-orf-1

>SMED30005523-orf-1 ID=SMED30005523-orf-1|Name=SMED30005523-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=907bp
MNSISNYSGYVDPDYLEEQHDVIDPLWEKQQKTTFTAWCNSHLRKVNQNI
EVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQ
KGVKLAYIGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLL
WCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNAR
ENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGA
QKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSE
STSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPN
FIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLR
CNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVV
RINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQ
LLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHY
QFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRD
EWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEK
LNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIF
ENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEF
RRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRAS
VGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVL
AGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSL
YGLSDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0019863IgE binding
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0003779actin binding
GO:0017166vinculin binding
GO:0030274LIM domain binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0051015actin filament binding
GO:0051219phosphoprotein binding
GO:0051393alpha-actinin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR001024PLAT/LH2_dom
IPR018159Spectrin/alpha-actinin
IPR001715CH-domain
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR002017Spectrin_repeat
IPR014837EF-hand_Ca_insen
IPR001589Actinin_actin-bd_CS
IPR018247EF_Hand_1_Ca_BS
Vocabulary: cellular component
TermDefinition
GO:0001725stress fiber
GO:0001726ruffle
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005915zonula adherens
GO:0005923bicellular tight junction
GO:0005925focal adhesion
GO:0016020membrane
GO:0016328lateral plasma membrane
GO:0030018Z disc
GO:0030027lamellipodium
GO:0030054cell junction
GO:0030486smooth muscle dense body
GO:0031252cell leading edge
GO:0042383sarcolemma
GO:0042995cell projection
GO:0090636outer dense plaque of desmosome
GO:0090637inner dense plaque of desmosome
GO:0097433dense body
GO:1990357terminal web
Vocabulary: biological process
TermDefinition
GO:0045214sarcomere organization
GO:0048741skeletal muscle fiber development
GO:0051017actin filament bundle assembly
GO:0051764actin crosslink formation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 656..676
NoneNo IPR availableCOILSCoilCoilcoord: 263..290
NoneNo IPR availableSMARTSM01184efhand_Ca_insen_2coord: 836..902
e-value: 2.0E-32
score: 123.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 625..738
e-value: 2.1E-31
score: 110.5
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 388..500
e-value: 3.5E-23
score: 83.9
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 739..837
e-value: 1.2E-17
score: 65.8
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 263..387
e-value: 8.6E-44
score: 150.4
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 501..624
e-value: 7.6E-38
score: 131.5
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 838..906
e-value: 5.8E-25
score: 89.3
NoneNo IPR availablePANTHERPTHR11915SPECTRIN/FILAMIN RELATED CYTOSKELETAL PROTEINcoord: 10..905
NoneNo IPR availablePANTHERPTHR11915:SF425ALPHA-ACTININ-4coord: 10..905
NoneNo IPR availableCDDcd00176SPECcoord: 284..491
e-value: 2.49906E-11
score: 62.078
NoneNo IPR availableCDDcd00176SPECcoord: 521..734
e-value: 1.18469E-12
score: 65.93
NoneNo IPR availableCDDcd00176SPECcoord: 393..620
e-value: 1.12882E-21
score: 92.1235
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 265..387
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 333..494
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 625..738
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 500..622
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 144..243
e-value: 3.6E-28
score: 109.6
coord: 31..131
e-value: 1.3E-22
score: 91.2
IPR001715Calponin homology domainPFAMPF00307CHcoord: 30..133
e-value: 6.8E-21
score: 74.5
coord: 143..248
e-value: 1.3E-27
score: 96.1
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 29..133
score: 23.755
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 142..248
score: 26.094
IPR001715Calponin homology domainCDDcd00014CHcoord: 143..247
e-value: 7.86023E-27
score: 103.545
IPR001715Calponin homology domainCDDcd00014CHcoord: 31..133
e-value: 1.97726E-20
score: 85.0551
IPR018159Spectrin/alpha-actininSMARTSM00150SPEC_4coord: 275..381
e-value: 6.6
score: 1.3
coord: 510..617
e-value: 0.0038
score: 26.5
coord: 395..496
e-value: 9.8E-13
score: 58.3
IPR002048EF-hand domainSMARTSM00054efh_1coord: 749..777
e-value: 9.2E-4
score: 28.5
coord: 805..833
e-value: 0.028
score: 23.6
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 801..836
score: 10.943
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 745..780
score: 13.091
IPR002048EF-hand domainCDDcd00051EFhcoord: 749..831
e-value: 9.30083E-11
score: 56.0169
IPR002017Spectrin repeatPFAMPF00435Spectrincoord: 510..618
e-value: 1.1E-11
score: 45.2
coord: 273..380
e-value: 4.4E-6
score: 27.1
coord: 393..495
e-value: 1.7E-15
score: 57.4
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 15..139
e-value: 2.4E-42
score: 145.7
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 140..257
e-value: 1.4E-50
score: 172.0
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 3..245
IPR014837EF-hand, Ca insensitivePFAMPF08726EFhand_Ca_insencoord: 836..902
e-value: 1.3E-23
score: 82.9
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00019ACTININ_1coord: 31..40
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 758..770
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 733..872