EF-hand domain-containing protein

Overview
NameEF-hand domain-containing protein
Smed IDSMED30005521
Length (bp)903
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain-containing protein (SMED30005521) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30005521) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain-containing protein (SMED30005521) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30005521) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005521

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30005521h1SMcG0007880 Contig42198newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005521h1SMcG0007880 Contig42198uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30005521h1SMcG0007880 dd_Smed_v4_6707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005521h1SMcG0007880 dd_Smed_v4_6707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005521h1SMcG0007880 dd_Smed_v4_6707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005521h1SMcG0007880 dd_Smed_v4_6707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005521h1SMcG0007880 dd_Smed_v4_6707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005521h1SMcG0007880 dd_Smed_v4_6707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005521h1SMcG0007880 dd_Smed_v4_6707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30005521h1SMcG0007880 dd_Smed_v6_6707_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30005521h1SMcG0007906 dd_Smed_v6_6707_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30005521h1SMcG0007880 dd_Smed_v4_6707_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P14202|TEGU_SCHMA (Tegument antigen OS=Schistosoma mansoni OX=6183 GN=A12 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.299e-14
Identity = 53/185 (28.65%), Postives = 86/185 (46.49%), Query Frame = 3
Query:  384 EMIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFE-DSNEEISFEEYCLQIGEDV-------------QDYDYPRAHKQDIEIINSK---------CLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPG 869
            E I  F EID +    + K++LI +  K   + K I+ ++  F+ D + +IS EE+C   G  V             +D  +P+    +IEII +          C  F +E+V       T     D +E+A ++K  LD     +W  V++ G YW  +SHEP  SI  K+ N + + ++TP 
Sbjct:   12 EFIRAFLEIDADSNEMIDKQELIKYCQKYRLDMKLIDPWIARFDTDKDNKISIEEFCRGFGLKVSEIRREKDELKKERDGKFPKLPP-NIEIIAATMSKTKQYEICCQF-KEYVD-----NTSRTGNDMREVANKMKSLLDNTYGRVWQVVLLTGSYWMNFSHEPFLSIQFKYNNYVCLAWRTPS 189          
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P32070|SM21_SCHMA (Antigen Sm21.7 OS=Schistosoma mansoni OX=6183 GN=SM21.7 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.178e-7
Identity = 36/176 (20.45%), Postives = 76/176 (43.18%), Query Frame = 3
Query:  390 IEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFE-DSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQ--------------DKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN 872
            I+ +  +  +   +V    L     K   + K++  ++ +F+ D +++I+FEE+C  +G    +    R H + ++    + L      + + + +  Q                  D  ++ +  K  L+++   +W    V   YWA +SHEP  SI  ++ N I + ++TP N
Sbjct:    9 IQTYLTLLRDGDETVETSKLSESCRKEKLDMKQVNEWIALFDVDKDQKITFEEFCRGLGLKQNEMRIERNHIKTVQSGREQSLPEGVSIIASTMPKPKQVEVTQLFKDIYNEVKKDPDMNKVVKTFKSELERRYGRVWQVNAVTHSYWASFSHEPFQSIQFQYDNKIILAWRTPSN 184          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8J0C9 (EF-hand domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012489g1 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.965e-20
Identity = 51/167 (30.54%), Postives = 92/167 (55.09%), Query Frame = 3
Query:  393 EIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVF-EDSNEEISFEEYC-------LQIGEDVQDYDYPRAHKQDIEIINSKC-LSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTP 866
            E +  ID    GS++ +DL +++ K+++++  +  +M +F +D++  I  EEYC        QI  +V+      +  + +E I+    LS+  +   AN+        Q+ K++ + +K   D+Q N+LWH VIV GQ+W Y+ HEP  S + ++   IFI+F+TP
Sbjct:    6 EAWLAIDVQGRGSITSRDLSAYMKKQNYDDAFVNKWMRLFDQDNSGTIEVEEYCDVLGLNPKQIMSEVRSRIATGSMPEGVEYISGDMDLSWQIK--IANLTLEGLRTNQNMKDVPKWIKTQADRQFNQLWHVVIVNGQFWCYFGHEPAYSFIFRYGKQIFIIFRTP 170          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8H6V5 (Dynein light chain OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g1 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.319e-19
Identity = 48/168 (28.57%), Postives = 93/168 (55.36%), Query Frame = 3
Query:  390 IEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFE-DSNEEISFEEYCLQIGEDVQDY--DYPRAHKQ-----DIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPG 869
            I+ +F ID    G ++   L  ++ + +++E  +  ++++F+ D++  I+ +EYC  +G + +    DY    +      DI +I+S  ++   +     I+R  Q     +K++A+ +K+  D +M  LWH VI+ GQ+W +YSHEPG S + +    IF +++TPG
Sbjct:    6 IDAYFAIDTEGKGEITSAQLTRYMRQNNYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGLEAKKVKADYIAKMRSGSLPSDITVISSD-MTLELQLRIIEIVRDGQRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRTPG 172          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A267F2V4 (Dynein light chain (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g2 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.340e-19
Identity = 48/168 (28.57%), Postives = 93/168 (55.36%), Query Frame = 3
Query:  390 IEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFE-DSNEEISFEEYCLQIGEDVQDY--DYPRAHKQ-----DIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPG 869
            I+ +F ID    G ++   L  ++ + +++E  +  ++++F+ D++  I+ +EYC  +G + +    DY    +      DI +I+S  ++   +     I+R  Q     +K++A+ +K+  D +M  LWH VI+ GQ+W +YSHEPG S + +    IF +++TPG
Sbjct:   10 IDAYFAIDTEGKGEITSAQLTRYMRQNNYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGLEAKKVKADYIAKMRSGSLPSDITVISSD-MTLELQLRIIEIVRDGQRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRTPG 176          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8HXX8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028751g1 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.670e-18
Identity = 52/174 (29.89%), Postives = 94/174 (54.02%), Query Frame = 3
Query:  390 IEIFFEIDENEYGSVSKKDLISHLNKRD-FNEKEIESFMEVFEDSNE-EISFEEYCLQIGEDVQDYDYPRAHK------------QDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPG 869
            ++ FF +D++   S++  +L +++     F     E +M++F+++++  I+ +EYC  +G + +     R ++            +D+ +I S  +    +     I R  Q   +D+K++A R+K+ LD Q  +LWH V+V GQYWA YSHEPG S   K   +I + +KTPG
Sbjct:   45 LDAFFAVDKDRSESITPDELAAYMTSSSQFEANFGEKWMKLFDENDDGAITLDEYCNVLGLNPKQARIYRLNQLKAECLRSNRLPEDVTVIASS-MGLEMQVDLTEIFRDAQRRGKDEKDVAGRLKQKLDGQFGKLWHVVMVTGQYWASYSHEPGLSFFFKIGRHIVMCWKTPG 217          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8H730 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008204g1 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.948e-18
Identity = 52/174 (29.89%), Postives = 94/174 (54.02%), Query Frame = 3
Query:  390 IEIFFEIDENEYGSVSKKDLISHLNKRD-FNEKEIESFMEVFEDSNE-EISFEEYCLQIGEDVQDYDYPRAHK------------QDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPG 869
            ++ FF +D++   S++  +L +++     F     E +M++F+++++  I+ +EYC  +G + +     R ++            +D+ +I S  +    +     I R  Q   +D+K++A R+K+ LD Q  +LWH V+V GQYWA YSHEPG S   K   +I + +KTPG
Sbjct:   45 LDAFFAVDKDRSESITPDELAAYMTSSSQFEANFGEKWMKLFDENDDGAITLDEYCNVLGLNPKQARIYRLNQLKAECLRNNRLPEDVTVIASS-MGLEMQVDLTEIFRDAQRRGKDEKDVAGRLKQQLDGQFGKLWHVVMVTGQYWASYSHEPGLSFFFKIGRHIVMCWKTPG 217          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000006807.1 (SMESG000006807.1)

HSP 1 Score: 346.28 bits (887), Expect = 7.878e-122
Identity = 167/167 (100.00%), Postives = 167/167 (100.00%), Query Frame = 3
Query:  372 MDNSEMIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN 872
            MDNSEMIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN
Sbjct:    1 MDNSEMIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN 167          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000006807.1 (SMESG000006807.1)

HSP 1 Score: 335.88 bits (860), Expect = 7.694e-118
Identity = 162/162 (100.00%), Postives = 162/162 (100.00%), Query Frame = 3
Query:  387 MIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN 872
            MIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN
Sbjct:    1 MIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN 162          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000020829.1 (SMESG000020829.1)

HSP 1 Score: 168.318 bits (425), Expect = 8.701e-52
Identity = 78/167 (46.71%), Postives = 119/167 (71.26%), Query Frame = 3
Query:  372 MDNSEMIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN 872
            M + + IE+F EID +  G ++K ++ ++L  R+F+ ++IE F+ +FE   EEI++ E+C  +G D  +  YP  H  D+EIINS+   FH++W   NIIRR  ++ ++KKE+A  +KK++DKQM+ +WHCVIV GQYWA+YSHE   SI++K+++ IFILFKTP N
Sbjct:    1 MIDIDFIELFLEIDASRNGVITKNEMKNYLIGREFSNEDIEEFLSLFEHF-EEINYSEFCAILGRDECELQYPTEHDSDVEIINSRITDFHQQWKVTNIIRRAFASAKEKKEMAAIIKKSMDKQMDPMWHCVIVSGQYWAFYSHEEEASIIIKYKDLIFILFKTPSN 166          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000011992.1 (SMESG000011992.1)

HSP 1 Score: 167.933 bits (424), Expect = 9.284e-52
Identity = 79/167 (47.31%), Postives = 118/167 (70.66%), Query Frame = 3
Query:  372 MDNSEMIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDSNEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPGN 872
            M + + IE+F EID +  G ++K ++ ++L  R+F+ ++IE F+ +FE   EEI++ E+C  +G D  +  YP  H  D+EIINS+   FH++W   NIIRR  ++ ++KKE+A  +KK++DKQM+ +WHCVIV GQYWA+YSHE   SI +K++N IFILFKTP N
Sbjct:    1 MIDIDFIELFLEIDASRNGVITKNEMKNYLIGREFSNEDIEEFLSLFEHF-EEINYSEFCAILGRDECELQYPTEHDSDVEIINSRITDFHQQWKVTNIIRRAFASAKEKKEMAAIIKKSMDKQMDPMWHCVIVSGQYWAFYSHEEEGSIAIKYKNLIFILFKTPSN 166          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000081370.1 (SMESG000081370.1)

HSP 1 Score: 153.295 bits (386), Expect = 6.731e-46
Identity = 76/165 (46.06%), Postives = 117/165 (70.91%), Query Frame = 3
Query:  387 MIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFE-DSNEEISFEEYC--LQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRT-QSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPG 869
            ++E+F+EID N    +S+K+L  ++ KR +++ ++E +M+ F+ D + +IS EE+   L+I +D   YD P  H+ D+EII++    FHR++V  NI+RR  +S  ++KKEIA+ VK+ LD Q+ +LWHCV+VKGQYW +YSHEP  S+V K +N +FILFKTP 
Sbjct:   13 LVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFVSRLEISDDF--YDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 175          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P14202|TEGU_SCHMA1.299e-1428.65Tegument antigen OS=Schistosoma mansoni OX=6183 GN... [more]
sp|P32070|SM21_SCHMA1.178e-720.45Antigen Sm21.7 OS=Schistosoma mansoni OX=6183 GN=S... [more]
back to top
BLAST of EF-hand domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J0C92.965e-2030.54EF-hand domain-containing protein OS=Macrostomum l... [more]
A0A1I8H6V51.319e-1928.57Dynein light chain OS=Macrostomum lignano OX=28230... [more]
A0A267F2V41.340e-1928.57Dynein light chain (Fragment) OS=Macrostomum ligna... [more]
A0A1I8HXX81.670e-1829.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H7301.948e-1829.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006807.17.878e-122100.00SMESG000006807.1[more]
SMESG000006807.17.694e-118100.00SMESG000006807.1[more]
SMESG000020829.18.701e-5246.71SMESG000020829.1[more]
SMESG000011992.19.284e-5247.31SMESG000011992.1[more]
SMESG000081370.16.731e-4646.06SMESG000081370.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005521 ID=SMED30005521|Name=EF-hand domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=903bp
TAAAATGAAGAATTTCGAGCATTTGAGAATTTCACCGCCGTCACTTTCAT
TTTTAGACATTTATAGACATTGTACATTATCGGTGTTCATTAAATCGTGA
GAAGTTTCCAAATTGATTGATCGATTTTACACATTTTGACAACTCTCTGC
ACACAGATATCGACACAAAATACAATTATTGATTCATGATCACACCGAAC
AAGCGATTAGAGCACACTTTCTATGCTTGTAAATGATGATTTGTTGACGA
ATATTGAAAAAATTATAATGTCGGTCCTGAATGAATTGTTATATAAAATC
GTTTTCAATAAAAATAAATTCATTTGAAAGTGTTTGAACTTATCGAAATC
AACATCAAGTTTGTGGGGAAAATGGATAATTCGGAAATGATTGAGATCTT
TTTTGAAATAGATGAAAACGAATACGGTTCGGTGAGTAAAAAGGATTTGA
TTTCCCATTTGAATAAACGAGATTTCAATGAGAAAGAAATTGAAAGTTTC
ATGGAGGTCTTTGAGGATTCAAATGAAGAAATTTCTTTCGAAGAGTACTG
CTTGCAAATTGGCGAAGATGTGCAAGATTATGACTACCCTCGTGCCCATA
AACAAGACATTGAAATAATTAATTCGAAATGTCTATCATTTCACCGAGAA
TGGGTTACGGCCAATATTATAAGACGTACTCAAAGTGCATACCAAGATAA
GAAAGAAATTGCCGAGCGCGTCAAAAAAGCTTTGGATAAGCAAATGAACG
AACTGTGGCATTGTGTGATTGTAAAAGGACAATATTGGGCATATTATTCT
CATGAGCCCGGCTGCAGCATTGTTCTCAAACACCAAAATAATATTTTCAT
TCTATTCAAAACTCCTGGAAATTAGATTTGGCCGATTTCTTGTTGATTCA
ACA
back to top

protein sequence of SMED30005521-orf-1

>SMED30005521-orf-1 ID=SMED30005521-orf-1|Name=SMED30005521-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
MDNSEMIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFEDS
NEEISFEEYCLQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANII
RRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSI
VLKHQNNIFILFKTPGN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR001372Dynein_light_chain_typ-1/2
IPR011992EF-hand-dom_pair
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
GO:0005578proteinaceous extracellular matrix
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 107..127
IPR001372Dynein light chain, type 1/2SMARTSM01375Dynein_light_2coord: 75..164
e-value: 3.8E-6
score: 36.4
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 97..164
e-value: 4.7E-15
score: 55.7
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 71..165
e-value: 4.2E-13
score: 51.1
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 86..165
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 5..71