Long-chain-fatty-acid--CoA ligase

Overview
NameLong-chain-fatty-acid--CoA ligase
Smed IDSMED30005508
Length (bp)2206
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Long-chain-fatty-acid--CoA ligase (SMED30005508) t-SNE clustered cells

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase (SMED30005508) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Long-chain-fatty-acid--CoA ligase (SMED30005508) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase (SMED30005508) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005508

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30005508h1SMcG0005608 SmedASXL_017227SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30005508h1SMcG0005608 SmedASXL_060880SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30005508h1SMcG0005608 dd_Smed_v4_2009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005508h1SMcG0005608 dd_Smed_v4_2009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005508h1SMcG0005608 dd_Smed_v4_2009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005508h1SMcG0005608 dd_Smed_v4_2009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005508h1SMcG0005608 dd_Smed_v4_2009_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005508h1SMcG0005608 Contig35360newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30005508h1SMcG0005608 Contig35360uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30005508h1SMcG0005608 SMED30005508smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30005508h1SMcG0005608 SMED30005508smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL5 (acyl-CoA synthetase long chain family member 5 [Source:HGNC Symbol;Acc:HGNC:16526])

HSP 1 Score: 496.123 bits (1276), Expect = 3.086e-166
Identity = 267/620 (43.06%), Postives = 384/620 (61.94%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGII-KLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNK---KEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D KT+Y++FQ GL   ++ PCLGY+  +    Y WL+Y +V + +   G+ ++ K    SP  +  VGIF +N  EW+  E  C  YSM+ VPLYDT G ++  +I+N     ++  DT +K   L+ +  K   P LK I+ ++    D  Q     G++     D    GK +   P+P   P  +D S I FTSGTTG PKG +ITH++++S+   A+ F   ++   +    ++ +S+LPL H++ER+V  +++    ++ FF G+IRLLA++MK +KPT+  AVPR+LNRIYDKV    +++PLK ++  L +++K KE+ +GIIR +S WD +IF KIQ  LGG V +I+ G+AP+S  V+ FFR+ MG  V E YGQTE TG  T TLPGD   GHVG+P+  +++KL DV +++     +  GEVC+KG      Y  D E + + +DSDGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++ENIY+ S  V QIFV G+SL+   V +V+PD D   +  AK     S E++C + V  E I  DL  +G+++ L  FE VK   L     S ENGLLTPTLK KR E SK+F  +I +LY+
Sbjct:   72 SDAKTMYEVFQRGLAVSDNGPCLGYRKPNQP--YRWLSYKQVSDRAEYLGSCLLHKGYKSSP--DQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVP---PSPEDLSVICFTSGTTGDPKGAMITHQNIVSN---AAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNE-AKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNN-EGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYE 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL5 (acyl-CoA synthetase long chain family member 5 [Source:HGNC Symbol;Acc:HGNC:16526])

HSP 1 Score: 496.123 bits (1276), Expect = 3.086e-166
Identity = 267/620 (43.06%), Postives = 384/620 (61.94%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGII-KLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNK---KEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D KT+Y++FQ GL   ++ PCLGY+  +    Y WL+Y +V + +   G+ ++ K    SP  +  VGIF +N  EW+  E  C  YSM+ VPLYDT G ++  +I+N     ++  DT +K   L+ +  K   P LK I+ ++    D  Q     G++     D    GK +   P+P   P  +D S I FTSGTTG PKG +ITH++++S+   A+ F   ++   +    ++ +S+LPL H++ER+V  +++    ++ FF G+IRLLA++MK +KPT+  AVPR+LNRIYDKV    +++PLK ++  L +++K KE+ +GIIR +S WD +IF KIQ  LGG V +I+ G+AP+S  V+ FFR+ MG  V E YGQTE TG  T TLPGD   GHVG+P+  +++KL DV +++     +  GEVC+KG      Y  D E + + +DSDGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++ENIY+ S  V QIFV G+SL+   V +V+PD D   +  AK     S E++C + V  E I  DL  +G+++ L  FE VK   L     S ENGLLTPTLK KR E SK+F  +I +LY+
Sbjct:   72 SDAKTMYEVFQRGLAVSDNGPCLGYRKPNQP--YRWLSYKQVSDRAEYLGSCLLHKGYKSSP--DQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVP---PSPEDLSVICFTSGTTGDPKGAMITHQNIVSN---AAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNE-AKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNN-EGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYE 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL5 (acyl-CoA synthetase long chain family member 5 [Source:HGNC Symbol;Acc:HGNC:16526])

HSP 1 Score: 496.123 bits (1276), Expect = 3.086e-166
Identity = 267/620 (43.06%), Postives = 384/620 (61.94%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGII-KLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNK---KEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D KT+Y++FQ GL   ++ PCLGY+  +    Y WL+Y +V + +   G+ ++ K    SP  +  VGIF +N  EW+  E  C  YSM+ VPLYDT G ++  +I+N     ++  DT +K   L+ +  K   P LK I+ ++    D  Q     G++     D    GK +   P+P   P  +D S I FTSGTTG PKG +ITH++++S+   A+ F   ++   +    ++ +S+LPL H++ER+V  +++    ++ FF G+IRLLA++MK +KPT+  AVPR+LNRIYDKV    +++PLK ++  L +++K KE+ +GIIR +S WD +IF KIQ  LGG V +I+ G+AP+S  V+ FFR+ MG  V E YGQTE TG  T TLPGD   GHVG+P+  +++KL DV +++     +  GEVC+KG      Y  D E + + +DSDGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++ENIY+ S  V QIFV G+SL+   V +V+PD D   +  AK     S E++C + V  E I  DL  +G+++ L  FE VK   L     S ENGLLTPTLK KR E SK+F  +I +LY+
Sbjct:   72 SDAKTMYEVFQRGLAVSDNGPCLGYRKPNQP--YRWLSYKQVSDRAEYLGSCLLHKGYKSSP--DQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVP---PSPEDLSVICFTSGTTGDPKGAMITHQNIVSN---AAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNE-AKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNN-EGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYE 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL5 (acyl-CoA synthetase long chain family member 5 [Source:HGNC Symbol;Acc:HGNC:16526])

HSP 1 Score: 495.738 bits (1275), Expect = 2.487e-165
Identity = 267/620 (43.06%), Postives = 384/620 (61.94%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGII-KLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNK---KEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D KT+Y++FQ GL   ++ PCLGY+  +    Y WL+Y +V + +   G+ ++ K    SP  +  VGIF +N  EW+  E  C  YSM+ VPLYDT G ++  +I+N     ++  DT +K   L+ +  K   P LK I+ ++    D  Q     G++     D    GK +   P+P   P  +D S I FTSGTTG PKG +ITH++++S+   A+ F   ++   +    ++ +S+LPL H++ER+V  +++    ++ FF G+IRLLA++MK +KPT+  AVPR+LNRIYDKV    +++PLK ++  L +++K KE+ +GIIR +S WD +IF KIQ  LGG V +I+ G+AP+S  V+ FFR+ MG  V E YGQTE TG  T TLPGD   GHVG+P+  +++KL DV +++     +  GEVC+KG      Y  D E + + +DSDGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++ENIY+ S  V QIFV G+SL+   V +V+PD D   +  AK     S E++C + V  E I  DL  +G+++ L  FE VK   L     S ENGLLTPTLK KR E SK+F  +I +LY+
Sbjct:  128 SDAKTMYEVFQRGLAVSDNGPCLGYRKPNQP--YRWLSYKQVSDRAEYLGSCLLHKGYKSSP--DQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVP---PSPEDLSVICFTSGTTGDPKGAMITHQNIVSN---AAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNE-AKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNN-EGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYE 735          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Match: ACSL6 (acyl-CoA synthetase long chain family member 6 [Source:HGNC Symbol;Acc:HGNC:16496])

HSP 1 Score: 480.715 bits (1236), Expect = 5.776e-160
Identity = 266/677 (39.29%), Postives = 384/677 (56.72%), Query Frame = 2
Query:   98 ALKLATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLN--SKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            A  L + G + A    W   +P    L    N   QS  V+     R S   + P +      D +T+Y +F+ GL    + PCLG++       Y WL+Y EV + +   G+G+++  N     +  +G+F +N  EW+ VE  C  YSM++VPLYDT G  + +YIIN      + VD  +K   LL    +   P LK I+ ++   +   +     GV       +   G+ N   P+P   P+  D S + FTSGTTG PKG ++TH ++++         + + F  + ++ +SFLPL H++ER++ ++++ + G++ FF G+IRLL+++MK + PTI   VPR+LNR+YDK+    + +PLK ++       K  EV  GIIR +SIWD + F KIQA LGG V +I+ G+AP SP V+ F R+ +G  V EGYGQTE T   T T PGD   GHVG P+P + IKL DV EL+    +   GE+CV+G      Y  D + + + +DSDGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++ENIY  S  VAQI+V GDSLK F V IV+PD   +  W        +  D+C +    + I  D+  +G+++ L  FE VK   + S   S +NGLLTPTLK KR E  ++F ++I+ LY
Sbjct:   27 ATTLVSMGALAAILAYWFTHRPKA--LQPPCNLLMQSEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFR--KPKQPYQWLSYQEVADRAEFLGSGLLQH-NCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVP---PQPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRLLSDDMKALCPTIFPVVPRLLNRMYDKIFSQ-ANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKIQASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKG-EGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELY 693          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-5 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q9XWD1])

HSP 1 Score: 448.743 bits (1153), Expect = 3.226e-148
Identity = 228/614 (37.13%), Postives = 365/614 (59.45%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGS--ASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSP-LKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY----RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            ++ TL+D+F  G       PC+G +  S  A+Y +LTY +V E ++     ++     +P   T +GI+ +N  +W+     C   SM++VPLYDT G ++  +II+  +  V+ VD+ KK + L+ ++ +MP LK I+ ++   + K   A +  ++    ++ L  G   P    LPK  D   I +TSGTTG PKG ++TH +++++I       FA      +  ++H+S+LPL+H+ E+L H  +  +  KI +F G I+ L +++K +KPT+   VPR+LNR+YD +   + Q   +   ++N   A K+  V  G + +++IWD ++F KIQ  +GG V++++ GSAP+S  V+   R  +G+ ++EGYGQTE T  AT T  GD   GH G P P + +KL DVP+L+   A+D +GE+ +KG      Y+ D E +++L D +G+L TGDIG     G ++I+DR KHIFKLAQGEY+APE++E +Y  +P+V Q++V GDSL+ + +A+V+P+ D  K  + K     R +E+ICND  A E +  +L A+G+ NKL   E VK+  L S   + ENGLLTPTLK KR +    +   +  +Y+
Sbjct:   71 EVATLHDVFVKGKTESNGGPCVGTR-SSGDADYEFLTYDDVHEQAKNLSMTLVHEFGLTPANTTNIGIYARNSPQWLVSAVACVEQSMVVVPLYDTLGAEAATFIISQAEISVVIVDSFKKAESLIKNRENMPTLKNIIVIDSADELKDGTAIIDTIRVESLTNALNLGSRYPFTNNLPKPDDNYIICYTSGTTGTPKGVMLTHSNIVANISGFLKILFAFQPSMIDATQVHISYLPLSHMMEQLTHWTLLGFGSKIGYFRGSIQGLTDDIKTLKPTVFPVVPRLLNRLYDAITSKVQQQGFMAKLVYNFAFARKLSLVKAGKVGRDTIWDRLVFNKIQQQIGGKVDLMVTGSAPISSTVLETCRVTLGTTIVEGYGQTECTALATFTWMGDPSTGHCGAPAPCALVKLGDVPDLNY-FAKDGKGEIRIKGPCVTKGYYKDPERTAELFDEEGFLQTGDIGEMLPNGTIRIIDRKKHIFKLAQGEYVAPEKIEQVYIRTPVVQQVYVDGDSLERWLIAVVVPEPDVLKEWNDKQGSGSRKIEEICNDEKAKEFVLSELHAIGKANKLNSIEQVKKVILTSDTFTVENGLLTPTLKAKRPQLRLKYKDGMAKVYK 682          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 421.779 bits (1083), Expect = 7.336e-138
Identity = 237/615 (38.54%), Postives = 361/615 (58.70%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAAN--YHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPI-PLQLPKA-QDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGN--KKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D +TLY   + G     + P LG +V  S  +  Y W +Y+ + E +        + L    G    +GI+ KN  EW+  E     YS ++VP+Y+T G ++  +I+N  + +++  D   K   LL  K   P L  +V +  +  +    AS  GV+   F D+   GKN    P  +P   +D ++I +TSGTTG PKG ++TH ++++         D  K       +  +SFLPL H+ ER++ ++ F    K+ F+ G+IR+LAE++K +KPT++  VPR+LNR+YDKVM  +++S LK  +F+  ++ K +++    IR +  +D ++F+KI+   GG V +++ GSAP+S +V+ F R+ MG +V+EGYGQTE     T+++ GDS  GHVG+ +P   IKL DVPEL+   A+D  GEVCVKG +    Y+ + + + + ID DGWLHTGDIG WT +G LKIVDR KHIFKL+QGEY+APE++ENIY  S  VAQ FV G+SLK   +AIV+PD +      A      + E++CN+    + I  D+ AVG++  L  FE V+   L +   S EN LLTPTLK KR +    +++++  +Y
Sbjct:   64 DARTLYQGVRRGARLSNNGPMLGRRVKQSDGSIPYVWESYNTILERADNVSVAF-RELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLVVMEPVTDELKTTASSLGVEVLTFEDLEKIGKNAKTRPAHIPPTPEDLATICYTSGTTGTPKGVMLTHANVIAD----GVCMDFFKHSGIAATDSMISFLPLAHMLERVIESVCFCVGAKVGFYRGDIRVLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFAISYKARDMANFNIRNDGFFDNLVFKKIREGFGGRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNY-YAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIENIYVRSKYVAQSFVHGESLKTCLIAIVVPDAEVLVPAMADQGIKGTFEELCNNDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMY 672          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 422.55 bits (1085), Expect = 1.331e-137
Identity = 237/615 (38.54%), Postives = 361/615 (58.70%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAAN--YHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPI-PLQLPKA-QDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGN--KKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D +TLY   + G     + P LG +V  S  +  Y W +Y+ + E +        + L    G    +GI+ KN  EW+  E     YS ++VP+Y+T G ++  +I+N  + +++  D   K   LL  K   P L  +V +  +  +    AS  GV+   F D+   GKN    P  +P   +D ++I +TSGTTG PKG ++TH ++++         D  K       +  +SFLPL H+ ER++ ++ F    K+ F+ G+IR+LAE++K +KPT++  VPR+LNR+YDKVM  +++S LK  +F+  ++ K +++    IR +  +D ++F+KI+   GG V +++ GSAP+S +V+ F R+ MG +V+EGYGQTE     T+++ GDS  GHVG+ +P   IKL DVPEL+   A+D  GEVCVKG +    Y+ + + + + ID DGWLHTGDIG WT +G LKIVDR KHIFKL+QGEY+APE++ENIY  S  VAQ FV G+SLK   +AIV+PD +      A      + E++CN+    + I  D+ AVG++  L  FE V+   L +   S EN LLTPTLK KR +    +++++  +Y
Sbjct:  107 DARTLYQGVRRGARLSNNGPMLGRRVKQSDGSIPYVWESYNTILERADNVSVAF-RELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLVVMEPVTDELKTTASSLGVEVLTFEDLEKIGKNAKTRPAHIPPTPEDLATICYTSGTTGTPKGVMLTHANVIAD----GVCMDFFKHSGIAATDSMISFLPLAHMLERVIESVCFCVGAKVGFYRGDIRVLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFAISYKARDMANFNIRNDGFFDNLVFKKIREGFGGRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNY-YAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIENIYVRSKYVAQSFVHGESLKTCLIAIVVPDAEVLVPAMADQGIKGTFEELCNNDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMY 715          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 421.394 bits (1082), Expect = 3.941e-137
Identity = 237/615 (38.54%), Postives = 361/615 (58.70%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAAN--YHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPI-PLQLPKA-QDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGN--KKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D +TLY   + G     + P LG +V  S  +  Y W +Y+ + E +        + L    G    +GI+ KN  EW+  E     YS ++VP+Y+T G ++  +I+N  + +++  D   K   LL  K   P L  +V +  +  +    AS  GV+   F D+   GKN    P  +P   +D ++I +TSGTTG PKG ++TH ++++         D  K       +  +SFLPL H+ ER++ ++ F    K+ F+ G+IR+LAE++K +KPT++  VPR+LNR+YDKVM  +++S LK  +F+  ++ K +++    IR +  +D ++F+KI+   GG V +++ GSAP+S +V+ F R+ MG +V+EGYGQTE     T+++ GDS  GHVG+ +P   IKL DVPEL+   A+D  GEVCVKG +    Y+ + + + + ID DGWLHTGDIG WT +G LKIVDR KHIFKL+QGEY+APE++ENIY  S  VAQ FV G+SLK   +AIV+PD +      A      + E++CN+    + I  D+ AVG++  L  FE V+   L +   S EN LLTPTLK KR +    +++++  +Y
Sbjct:  114 DARTLYQGVRRGARLSNNGPMLGRRVKQSDGSIPYVWESYNTILERADNVSVAF-RELGVPTGNAENIGIYSKNRAEWIITEFATYNYSNVIVPIYETLGSEASIFILNQAEIKIVVCDDISKATGLLKFKEQCPSLSTLVVMEPVTDELKTTASSLGVEVLTFEDLEKIGKNAKTRPAHIPPTPEDLATICYTSGTTGTPKGVMLTHANVIAD----GVCMDFFKHSGIAATDSMISFLPLAHMLERVIESVCFCVGAKVGFYRGDIRVLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFAISYKARDMANFNIRNDGFFDNLVFKKIREGFGGRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNY-YAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIENIYVRSKYVAQSFVHGESLKTCLIAIVVPDAEVLVPAMADQGIKGTFEELCNNDAVKKAILDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMY 722          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Match: acs-3 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:O44560])

HSP 1 Score: 362.844 bits (930), Expect = 1.788e-115
Identity = 219/653 (33.54%), Postives = 363/653 (55.59%), Query Frame = 2
Query:  206 SIVVDAKNSIRSS-QFPTIPPVSRGKCTD--MKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSK--SSMPHLKYIVTLNDI----GKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIG---SASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSP-LKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGW------KTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            S +VD    IR S Q P   P++   C D   KT++D+         + P  G  V+     + + TY E  E +   G+GI+ ++ ++   N  +GI   +  ++++   G + + +  VPLY  S  ++   II++ K E+IF +  K+ +  L+SK    +  LK ++ L+        D V+  SL      +F +I    K NP+    PK +    I  TSGTTG PKG  ++H S+++S+    ++ T A   KFG  ++ + SFL L H+YE L+  L   + GKI  + G    L  +++ ++PTI+  VPR+LN++Y+ V   +++   +   +F+     K +++ RG++R ++ +D I+F+K++ +LGG ++++  G AP++ +V  F R   G  ++EGYGQTE +   TLTLP D+  G+VG P P + +KL DVPE +     D  GEVC +G   ++ YF D E+++K IDS+GWLHTGDIG W   G L+I+DR   +FKL+QG++++P ++E IY+ SPL+ QI+VTG + + F V IV+ DL  +      K +D K  S+E I  +      +  +L+   +QN L   E+++   L     + ENGL+T TLK +R     +FA +I  +Y+
Sbjct:   14 SRLVDGPERIRESVQVPK--PIT--GCPDGITKTVWDVLTRSAQLNPNAPLFGESVN---GRHVYTTYREAVEEATIIGSGIVAIMQKNQSTNKLIGIAGIHSRKYMHTMHGISGFDLTTVPLYHQSKLETLCDIIDNCKLEIIFCENAKRAEGFLSSKLGDRLRSLKTLIILDKTTTLQKHDDVEVMSLD-----EFKEIGKRNKRNPVK---PKPETTYVICHTSGTTGRPKGVEMSHGSLVTSVSGIFTSWTIAYKWKFG-LEDTYFSFLSLAHIYEHLIQTLTIYFGGKIGIYDGNTATLIPQIQKLEPTIVSLVPRLLNKLYEAVHDGVAKKGFIARKLFDYAKKTKARQLQRGVLRYDTFFDKIVFKKLKLMLGGKLKVLTSGGAPITKEVKTFTRYAYGCPLVEGYGQTECSAAGTLTLPWDTTYGNVGGPAPWAQVKLVDVPEKNYFSMND-EGEVCFRGNAMMTGYFQDPELTAKTIDSEGWLHTGDIGKWLPTGGLQIIDRKNEMFKLSQGDFVSPIQIEAIYANSPLITQIYVTGKTERSFLVGIVVLDLPRFKQLPLVKALDGK-ESIEMIMENKEVKNAVIAELNKYAKQNGLQTIELIRNVHLTLQEFTEENGLITSTLKNRRKILEDYFAPQIAKMYK 648          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0302322)

HSP 1 Score: 489.574 bits (1259), Expect = 2.671e-164
Identity = 244/614 (39.74%), Postives = 382/614 (62.21%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKK----EIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +++TLY  F+ G     + PCLG++ ++  + Y W+ Y E    ++  GAG++ L  +   L   +GI+ +N  EW+  EQGC  +S+++VPLYDT G  +C +II     +V+ V+ + K   LL        LK IV +  I +  ++ A  +G+Q F F D+   G     P   P A+D  ++ +TSGTTG PKG ++TH ++++ + S      +++ G+ +    ++ +SFLPL H++ER   N M+   G + F+SG+I+ L  ++K++KPT++ AVPR+LNR+YDK+   IS S LK  +FN+ + AK KE+ RG++R+N  WD ++F+K+    GGN+ +++VGSAP++ +V+ F R  +G LV+EGYGQTE TG  TLT+ GD  P HVG PV  + +KL DVPE++    ++  GEVCV+G      Y+ D E +++ IDS+GW HTGD+G+W   G L+I+DR KHIFKL+QGEY+ PE++ENIY+LS  V Q++V G+SLK   +A+V+PD D    W T +    ++  +CN+    E+I  D+   G+Q+ L  FE VK   L     S +NGLLTPT K KR +   +F  +++ +Y+
Sbjct:   50 NVRTLYQTFREGAYASNNGPCLGWR-ETLTSPYQWINYDEALLRAKNFGAGMLALGARPKQL---IGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAAMLLEKAPR--SLKIIVAIKPIRQTTLERARSRGIQIFSFIDVEKLGAKGNHPEVPPTAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSV-----ILQMGDHRIRAGDVMVSFLPLAHMFERCCENGMYYVGGCVGFYSGDIKELTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDKLVFKKVHQAFGGNLRLMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNT-GEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIENIYTLSQYVNQVYVYGESLKSCIIAVVVPDTDVLKQWATENNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMYK 651          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0333712)

HSP 1 Score: 489.189 bits (1258), Expect = 3.935e-164
Identity = 244/614 (39.74%), Postives = 382/614 (62.21%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKK----EIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +++TLY  F+ G     + PCLG++ ++  + Y W+ Y E    ++  GAG++ L  +   L   +GI+ +N  EW+  EQGC  +S+++VPLYDT G  +C +II     +V+ V+ + K   LL        LK IV +  I +  ++ A  +G+Q F F D+   G     P   P A+D  ++ +TSGTTG PKG ++TH ++++ + S      +++ G+ +    ++ +SFLPL H++ER   N M+   G + F+SG+I+ L  ++K++KPT++ AVPR+LNR+YDK+   IS S LK  +FN+ + AK KE+ RG++R+N  WD ++F+K+    GGN+ +++VGSAP++ +V+ F R  +G LV+EGYGQTE TG  TLT+ GD  P HVG PV  + +KL DVPE++    ++  GEVCV+G      Y+ D E +++ IDS+GW HTGD+G+W   G L+I+DR KHIFKL+QGEY+ PE++ENIY+LS  V Q++V G+SLK   +A+V+PD D    W T +    ++  +CN+    E+I  D+   G+Q+ L  FE VK   L     S +NGLLTPT K KR +   +F  +++ +Y+
Sbjct:   62 NVRTLYQTFREGAYASNNGPCLGWR-ETLTSPYQWINYDEALLRAKNFGAGMLALGARPKQL---IGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAAMLLEKAPR--SLKIIVAIKPIRQTTLERARSRGIQIFSFIDVEKLGAKGNHPEVPPTAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSV-----ILQMGDHRIRAGDVMVSFLPLAHMFERCCENGMYYVGGCVGFYSGDIKELTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDKLVFKKVHQAFGGNLRLMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNT-GEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIENIYTLSQYVNQVYVYGESLKSCIIAVVVPDTDVLKQWATENNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMYK 663          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0075077)

HSP 1 Score: 489.189 bits (1258), Expect = 1.746e-163
Identity = 244/614 (39.74%), Postives = 382/614 (62.21%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKK----EIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +++TLY  F+ G     + PCLG++ ++  + Y W+ Y E    ++  GAG++ L  +   L   +GI+ +N  EW+  EQGC  +S+++VPLYDT G  +C +II     +V+ V+ + K   LL        LK IV +  I +  ++ A  +G+Q F F D+   G     P   P A+D  ++ +TSGTTG PKG ++TH ++++ + S      +++ G+ +    ++ +SFLPL H++ER   N M+   G + F+SG+I+ L  ++K++KPT++ AVPR+LNR+YDK+   IS S LK  +FN+ + AK KE+ RG++R+N  WD ++F+K+    GGN+ +++VGSAP++ +V+ F R  +G LV+EGYGQTE TG  TLT+ GD  P HVG PV  + +KL DVPE++    ++  GEVCV+G      Y+ D E +++ IDS+GW HTGD+G+W   G L+I+DR KHIFKL+QGEY+ PE++ENIY+LS  V Q++V G+SLK   +A+V+PD D    W T +    ++  +CN+    E+I  D+   G+Q+ L  FE VK   L     S +NGLLTPT K KR +   +F  +++ +Y+
Sbjct:  100 NVRTLYQTFREGAYASNNGPCLGWR-ETLTSPYQWINYDEALLRAKNFGAGMLALGARPKQL---IGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAAMLLEKAPR--SLKIIVAIKPIRQTTLERARSRGIQIFSFIDVEKLGAKGNHPEVPPTAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSV-----ILQMGDHRIRAGDVMVSFLPLAHMFERCCENGMYYVGGCVGFYSGDIKELTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDKLVFKKVHQAFGGNLRLMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNT-GEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIENIYTLSQYVNQVYVYGESLKSCIIAVVVPDTDVLKQWATENNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMYK 701          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0075078)

HSP 1 Score: 489.189 bits (1258), Expect = 1.746e-163
Identity = 244/614 (39.74%), Postives = 382/614 (62.21%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKK----EIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +++TLY  F+ G     + PCLG++ ++  + Y W+ Y E    ++  GAG++ L  +   L   +GI+ +N  EW+  EQGC  +S+++VPLYDT G  +C +II     +V+ V+ + K   LL        LK IV +  I +  ++ A  +G+Q F F D+   G     P   P A+D  ++ +TSGTTG PKG ++TH ++++ + S      +++ G+ +    ++ +SFLPL H++ER   N M+   G + F+SG+I+ L  ++K++KPT++ AVPR+LNR+YDK+   IS S LK  +FN+ + AK KE+ RG++R+N  WD ++F+K+    GGN+ +++VGSAP++ +V+ F R  +G LV+EGYGQTE TG  TLT+ GD  P HVG PV  + +KL DVPE++    ++  GEVCV+G      Y+ D E +++ IDS+GW HTGD+G+W   G L+I+DR KHIFKL+QGEY+ PE++ENIY+LS  V Q++V G+SLK   +A+V+PD D    W T +    ++  +CN+    E+I  D+   G+Q+ L  FE VK   L     S +NGLLTPT K KR +   +F  +++ +Y+
Sbjct:  100 NVRTLYQTFREGAYASNNGPCLGWR-ETLTSPYQWINYDEALLRAKNFGAGMLALGARPKQL---IGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAAMLLEKAPR--SLKIIVAIKPIRQTTLERARSRGIQIFSFIDVEKLGAKGNHPEVPPTAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSV-----ILQMGDHRIRAGDVMVSFLPLAHMFERCCENGMYYVGGCVGFYSGDIKELTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDKLVFKKVHQAFGGNLRLMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNT-GEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIENIYTLSQYVNQVYVYGESLKSCIIAVVVPDTDVLKQWATENNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMYK 701          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Match: Acsl (gene:FBgn0263120 transcript:FBtr0088701)

HSP 1 Score: 242.276 bits (617), Expect = 1.760e-69
Identity = 175/600 (29.17%), Postives = 298/600 (49.67%), Query Frame = 2
Query:  377 ANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSM---PHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKI----------IKPTILFAVPRILNRIYDKVMPII-SQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDC--RGEVCVKGRMCISE--YFGDREMSSKLIDSDG--WLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY----RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
             +Y W T++E +  +   G G+ + L Q P  N  + IF +   EW+    GC + +M +V +Y T G+      + H   E          D L   K+ +   P +K I+ + D  +        +GV+   F+ ++  G+++      PK  D + I++TSG+TG PKG L++H++ ++++     F D++      ++ + FLPL HV+E +  ++  M TG    +S  + L+    KI          +KPT + +VP IL+RI   +   + S S  K  +F      K+K V RG   K  + D ++F+K+  ++GG V IIM G AP+S D     ++ +   +I+GYG TETT  AT+    D   G  G P+    I+L +  E +  V      +GEV + G  C+S+  Y    + +    + DG  W  TGDIG     G LKI+DR K + KL  GEY++  ++E+      ++  I V GD  K + VA+V+P+ +  + +  K+    +S E++C+ P+  + I ++++   R+ KL  +E+     LC    SP+ GL+T   KLKR +    +  +I  +Y
Sbjct:  121 GDYKWKTFTEAERTAANFGRGL-RELGQKPREN--IVIFAETRAEWMIAAHGCFKQAMPIVTVYATLGDDG----VAHCITETEVTTVITSHDLLPKFKTLLDKCPLVKTIIYIEDQLQKTETTGFKEGVKILPFNQVVKTGQDSKFEHVPPKGDDIAIIMYTSGSTGTPKGVLLSHKNCIATMKG---FVDMVPI-YPDDVLIGFLPLAHVFELVAESVCLM-TGVPIGYSTPLTLIDTSSKIKRGCKGDATVLKPTCMTSVPLILDRISKGINDKVNSGSAFKKSLFKFLYQYKVKWVQRGY--KTPLIDKLVFKKVAKLMGGKVRIIMSGGAPLSADTHEQIKTCLCLELIQGYGLTETTSGATVMDYRDMTYGRTGGPLTVCDIRLVNWEEGNYRVTNKPYPQGEVLIGGE-CVSQGYYKLPGKTNEDFFEEDGQRWFKTGDIGEIQADGVLKIIDRKKDLVKLQAGEYVSLGKVESELKTCGIIENICVYGDPTKQYTVALVVPNQNHLEELAQKHGLGDKSFEELCSSPIIEKAILKEIAEHARKCKLQKYEVPAAITLCKEVWSPDMGLVTAAFKLKRKDIQDRYQHDINRMY 705          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 499.59 bits (1285), Expect = 9.595e-168
Identity = 264/615 (42.93%), Postives = 377/615 (61.30%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLS-SIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D KTLY++FQ GL    + PCLG++       Y WL Y +V + +   G+G+I    Q P  +T +GIF +N  EW+  E  C  YSM+ VPLYDT G ++  +IIN      +  D   K + LL++  K   P LK I+ ++       +  S  G+      D+   GKNN   P+P   PK +D S I FTSGTTG PKG ++THE++++ + G   TF  V       ++ +SFLPL H++ER+V  +++   G++ FF G+IRLL ++MK ++PT+   VPR+LNR+YDKV    +++P K ++ N  +  K  EV +GIIR +S+WD +IF K+Q  LGG V +++ G+AP+SP V+ F R+ +G  + E YGQTE T   + T+PGD   GHVG P+P + IKL DV E+D   A +  GE+CVKG      Y GD E +++ +D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+Y  S  VAQ+FV G+SL+   VAIV+PD   L G+        S+E++C +    + I  DL+ +GR+  L  FE VK   L     + ENGLLTPTLK KRA+ +K+F  +I++LY
Sbjct:   73 DGKTLYEVFQRGLRVSGNGPCLGFR--KKGQPYQWLKYKQVSDRAEFLGSGLIHR-GQKPSQDTFIGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGLDVLSLKDVEALGKNNHHRPVP---PKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVF-VPVPSDVSISFLPLAHMFERVVQTVLYGVGGRVGFFQGDIRLLPDDMKALQPTVFPVVPRLLNRVYDKVQSG-AKTPFKKWLLNFAIEKKCAEVKQGIIRNDSMWDKLIFHKVQESLGGRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYF-ASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAPVAQVFVHGESLQSSLVAIVVPDPEVLPGFAEKLGLKGSLEELCRNQELKKAIISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 499.59 bits (1285), Expect = 9.595e-168
Identity = 264/615 (42.93%), Postives = 377/615 (61.30%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLS-SIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D KTLY++FQ GL    + PCLG++       Y WL Y +V + +   G+G+I    Q P  +T +GIF +N  EW+  E  C  YSM+ VPLYDT G ++  +IIN      +  D   K + LL++  K   P LK I+ ++       +  S  G+      D+   GKNN   P+P   PK +D S I FTSGTTG PKG ++THE++++ + G   TF  V       ++ +SFLPL H++ER+V  +++   G++ FF G+IRLL ++MK ++PT+   VPR+LNR+YDKV    +++P K ++ N  +  K  EV +GIIR +S+WD +IF K+Q  LGG V +++ G+AP+SP V+ F R+ +G  + E YGQTE T   + T+PGD   GHVG P+P + IKL DV E+D   A +  GE+CVKG      Y GD E +++ +D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+Y  S  VAQ+FV G+SL+   VAIV+PD   L G+        S+E++C +    + I  DL+ +GR+  L  FE VK   L     + ENGLLTPTLK KRA+ +K+F  +I++LY
Sbjct:   73 DGKTLYEVFQRGLRVSGNGPCLGFR--KKGQPYQWLKYKQVSDRAEFLGSGLIHR-GQKPSQDTFIGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGLDVLSLKDVEALGKNNHHRPVP---PKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVF-VPVPSDVSISFLPLAHMFERVVQTVLYGVGGRVGFFQGDIRLLPDDMKALQPTVFPVVPRLLNRVYDKVQSG-AKTPFKKWLLNFAIEKKCAEVKQGIIRNDSMWDKLIFHKVQESLGGRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYF-ASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAPVAQVFVHGESLQSSLVAIVVPDPEVLPGFAEKLGLKGSLEELCRNQELKKAIISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 499.59 bits (1285), Expect = 9.595e-168
Identity = 264/615 (42.93%), Postives = 377/615 (61.30%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLS-SIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D KTLY++FQ GL    + PCLG++       Y WL Y +V + +   G+G+I    Q P  +T +GIF +N  EW+  E  C  YSM+ VPLYDT G ++  +IIN      +  D   K + LL++  K   P LK I+ ++       +  S  G+      D+   GKNN   P+P   PK +D S I FTSGTTG PKG ++THE++++ + G   TF  V       ++ +SFLPL H++ER+V  +++   G++ FF G+IRLL ++MK ++PT+   VPR+LNR+YDKV    +++P K ++ N  +  K  EV +GIIR +S+WD +IF K+Q  LGG V +++ G+AP+SP V+ F R+ +G  + E YGQTE T   + T+PGD   GHVG P+P + IKL DV E+D   A +  GE+CVKG      Y GD E +++ +D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+Y  S  VAQ+FV G+SL+   VAIV+PD   L G+        S+E++C +    + I  DL+ +GR+  L  FE VK   L     + ENGLLTPTLK KRA+ +K+F  +I++LY
Sbjct:   73 DGKTLYEVFQRGLRVSGNGPCLGFR--KKGQPYQWLKYKQVSDRAEFLGSGLIHR-GQKPSQDTFIGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGLDVLSLKDVEALGKNNHHRPVP---PKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVF-VPVPSDVSISFLPLAHMFERVVQTVLYGVGGRVGFFQGDIRLLPDDMKALQPTVFPVVPRLLNRVYDKVQSG-AKTPFKKWLLNFAIEKKCAEVKQGIIRNDSMWDKLIFHKVQESLGGRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYF-ASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAPVAQVFVHGESLQSSLVAIVVPDPEVLPGFAEKLGLKGSLEELCRNQELKKAIISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 499.59 bits (1285), Expect = 9.595e-168
Identity = 264/615 (42.93%), Postives = 377/615 (61.30%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLS-SIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D KTLY++FQ GL    + PCLG++       Y WL Y +V + +   G+G+I    Q P  +T +GIF +N  EW+  E  C  YSM+ VPLYDT G ++  +IIN      +  D   K + LL++  K   P LK I+ ++       +  S  G+      D+   GKNN   P+P   PK +D S I FTSGTTG PKG ++THE++++ + G   TF  V       ++ +SFLPL H++ER+V  +++   G++ FF G+IRLL ++MK ++PT+   VPR+LNR+YDKV    +++P K ++ N  +  K  EV +GIIR +S+WD +IF K+Q  LGG V +++ G+AP+SP V+ F R+ +G  + E YGQTE T   + T+PGD   GHVG P+P + IKL DV E+D   A +  GE+CVKG      Y GD E +++ +D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+Y  S  VAQ+FV G+SL+   VAIV+PD   L G+        S+E++C +    + I  DL+ +GR+  L  FE VK   L     + ENGLLTPTLK KRA+ +K+F  +I++LY
Sbjct:   73 DGKTLYEVFQRGLRVSGNGPCLGFR--KKGQPYQWLKYKQVSDRAEFLGSGLIHR-GQKPSQDTFIGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGLDVLSLKDVEALGKNNHHRPVP---PKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVF-VPVPSDVSISFLPLAHMFERVVQTVLYGVGGRVGFFQGDIRLLPDDMKALQPTVFPVVPRLLNRVYDKVQSG-AKTPFKKWLLNFAIEKKCAEVKQGIIRNDSMWDKLIFHKVQESLGGRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYF-ASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAPVAQVFVHGESLQSSLVAIVVPDPEVLPGFAEKLGLKGSLEELCRNQELKKAIISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Match: acsl1a (acyl-CoA synthetase long chain family member 1a [Source:ZFIN;Acc:ZDB-GENE-050809-115])

HSP 1 Score: 473.781 bits (1218), Expect = 1.399e-157
Identity = 270/696 (38.79%), Postives = 386/696 (55.46%), Query Frame = 2
Query:   65 QMFDINDCQSLALKLATTGLIVAGG-----VMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPH-LKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVE----DICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            +M +++D +     L T  L+  G        W  T+P    L    +   QS+ V  K   R S              D  TLY+ F  GL    + PCLG +   +   Y WL+Y EV + +   G+ ++   +   G +  +GIF +N  EW   E  C  YS++ VPLYDT G ++  Y+I+      I  D   K   +L+  S   H +  IV +     +   +A   G+      ++   GK N   PIP   PK +D + I FTSGTTG PKG ++TH +++S+  +     +V    N+ +IH+S+LPL H++ER+V  ++  +  KI +F G+IRLL +++K +KPTI   VPR+LNR++DK+    + +PLK ++ +   + K  E+  G++RK+S+WD +IF K+QA LGG V +++ G+APVSP V+ F R+ +G    EGYGQTE T   T++LPGD   GHVG P+P +F+KL DV E++   A +  GEVCVKG      Y  D E +S  +D  GWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++ENIY  S  VAQ+FV GDSL+   V +V+PD D   GW    AK R +E    D+C        I  D+  +G++  L  FE V+   L     S +NGLLTPTLK KR E    F ++I  LY
Sbjct:   11 RMPELDDLRQYVRSLPTNTLMGMGAFAAITTYWLATRPKA--LKPPCDLTMQSVEVPGKEYARRSILMDNDTHMTYYYKDALTLYEFFLRGLRVSNNGPCLGSR--KAGQPYKWLSYKEVADRAEFAGSALLHRGHSQSG-DKYIGIFAQNRPEWTISELACYTYSLVAVPLYDTLGTEAISYVIDKASITTIICDIADKARLILDCVSGRKHSVTTIVIMESFDSELTAQAQNCGIDIISLKELEAIGKANHKTPIP---PKPEDLALICFTSGTTGNPKGAMLTHGNVVSNCSAFIKITEVHCMLNQTDIHISYLPLAHMFERVVEGVLLCHGAKIGYFQGDIRLLMDDLKNLKPTIFPVVPRLLNRMFDKIFGQ-ANTPLKRWLLDFATSRKEAELKSGVVRKDSMWDKLIFSKVQASLGGRVRLMITGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCTMSLPGDWTAGHVGAPLPCNFVKLVDVAEMNYFAA-NGEGEVCVKGPNVFQGYLKDPEQTSGAVDKAGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYIRSDPVAQVFVHGDSLQACLVGVVVPDPDFLPGW----AKNRGIEGSFNDLCKSKEVKNAILEDMIQLGKEAGLKSFEQVRDIALHLEMFSVQNGLLTPTLKAKRTELKSRFREQIDQLY 692          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:Xenbase;Acc:XB-GENE-1007716])

HSP 1 Score: 493.041 bits (1268), Expect = 1.703e-164
Identity = 270/673 (40.12%), Postives = 387/673 (57.50%), Query Frame = 2
Query:  119 GLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNP---IP---LQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            G   A    W  T+P    L    +   QS+        R S       V      D+KT+YD+FQ G     + PCLG++  +    Y W++Y EV E +   G+ ++      P  +  VGIF +N  EW  VE GC  YSM+ VPLYDT G ++  YIIN     V+F D+ +K   LL++  K   P L+ IV +N    D V+     GV+     DI V+ K      IP   LQ PK  D + + FTSGTTG PKG +++H++++S+        + + F + +++ +SFLPL H++ER+V  ++  +  +I FF G+IRLL +++K+++PTI   VPR+LNR++D++    + +P+K ++ +     K  E+  GI+R +S WD IIF K+QA LGG V +++ G+APVSP V+ F R+ +G    EGYGQTE T   +LT+PGD   GHVG P+P + +KL DV E++   ++   GEVC+KG      Y  D E +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++EN+Y+ S  V Q+FV G+SL+ F V IV+PD D    W        S E++C +      +  DL  +G++  L  FE VK   L S   + ENGLLTPTLK KR E  K+F  EI  LY
Sbjct:   54 GAFAALTTYWYATRPKA--LKPPCDLAMQSVETQGGEHARRSTILDSDEVITYYYDDVKTIYDIFQRGRRVSNNGPCLGHRKPNQP--YEWISYKEVAERAEYVGSALLHR-GFKPSPDQFVGIFAQNRPEWTIVELGCYTYSMVAVPLYDTLGAEAITYIINKADLSVVFCDSPEKAKLLLSNVEKGETPVLRTIVLMNPFDNDLVERGKKCGVELVSLKDIEVSPKLIALLVIPCHFLQPPKPDDLAVVCFTSGTTGNPKGAMLSHKNIVSNSAGFMKVTEDLMFPSTQDVLISFLPLAHMFERVVECVVLCHGARIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQ-ANTPVKRWMLDFASKRKEAELRSGIVRNDSFWDKIIFHKVQASLGGKVRLMVTGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCSLTIPGDWTAGHVGAPMPCNHVKLVDVEEMNYFASKG-EGEVCIKGSNVFQGYLKDDEKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYTRSEPVVQVFVHGESLQAFLVGIVVPDPDNVMNWAKKRKFEGSYEELCKNKDFKNAVLEDLLKLGKEAGLKTFEQVKDIALHSEMFAIENGLLTPTLKAKRPELRKYFKDEIDELY 719          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:Xenbase;Acc:XB-GENE-1007716])

HSP 1 Score: 489.96 bits (1260), Expect = 4.114e-164
Identity = 256/611 (41.90%), Postives = 366/611 (59.90%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D+KT+YD+FQ G     + PCLG++  +    Y W++Y EV E +   G+ ++      P  +  VGIF +N  EW  VE GC  YSM+ VPLYDT G ++  YIIN     V+F D+ +K   LL++  K   P L+ IV +N    D V+     GV+     DI           + PK  D + + FTSGTTG PKG +++H++++S+        + +   N  +IH+S+LPL H++ERLV  ++  +  +I FF G+IRLL +++K+++PTI   VPR+LNR++D+V    + +P+K ++ +     K  E+  GI+R +S WD IIF K+QA LGG V +++ G+APVSP V+ F R+ +G    EGYGQTE T   +LT+PGD   GHVG P+P + +KL DV E++   ++   GEVC+KG      Y  D E +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++EN+Y+ S  V Q+FV G+SL+ F V IV+PD D    W        S E++C +      +  DL  +G++  L  FE VK   L S   + ENGLLTPTLK KR E  K+F  EI  LY
Sbjct:   70 DVKTIYDIFQRGRRVSNNGPCLGHRKPNQP--YEWISYKEVAERAEYVGSALLHR-GFKPSPDQFVGIFAQNRPEWTIVELGCYTYSMVAVPLYDTLGAEAITYIINKADLSVVFCDSPEKAKLLLSNVEKGETPVLRTIVLMNPFDNDLVERGKKCGVELVSLKDI-----------EPPKPDDLAVVCFTSGTTGNPKGAMLSHKNIVSNSAGFMKVTENMLTMNANDIHISYLPLAHMFERLVQCVVLCHGARIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRV----TNTPVKRWMLDFASKRKEAELRSGIVRNDSFWDKIIFHKVQASLGGKVRLMVTGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCSLTIPGDWTAGHVGAPMPCNHVKLVDVEEMNYFASKG-EGEVCIKGSNVFQGYLKDDEKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYTRSEPVVQVFVHGESLQAFLVGIVVPDPDNVMNWAKKRKFEGSYEELCKNKDFKNAVLEDLLKLGKEAGLKTFEQVKDIALHSEMFAIENGLLTPTLKAKRPELRKYFKDEIDELY 661          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:Xenbase;Acc:XB-GENE-1007716])

HSP 1 Score: 489.574 bits (1259), Expect = 1.318e-163
Identity = 264/667 (39.58%), Postives = 381/667 (57.12%), Query Frame = 2
Query:  119 GLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            G   A    W  T+P    L    +   QS+        R S       V      D+KT+YD+FQ G     + PCLG++  +    Y W++Y EV E +   G+ ++      P  +  VGIF +N  EW  VE GC  YSM+ VPLYDT G ++  YIIN     V+F D+ +K   LL++  K   P L+ IV +N    D V+     GV+     DI           + PK  D + + FTSGTTG PKG +++H++++S+        + + F + +++ +SFLPL H++ER+V  ++  +  +I FF G+IRLL +++K+++PTI   VPR+LNR++D++    + +P+K ++ +     K  E+  GI+R +S WD IIF K+QA LGG V +++ G+APVSP V+ F R+ +G    EGYGQTE T   +LT+PGD   GHVG P+P + +KL DV E++   ++   GEVC+KG      Y  D E +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++EN+Y+ S  V Q+FV G+SL+ F V IV+PD D    W        S E++C +      +  DL  +G++  L  FE VK   L S   + ENGLLTPTLK KR E  K+F  EI  LY
Sbjct:   39 GAFAALTTYWYATRPKA--LKPPCDLAMQSVETQGGEHARRSTILDSDEVITYYYDDVKTIYDIFQRGRRVSNNGPCLGHRKPNQP--YEWISYKEVAERAEYVGSALLHR-GFKPSPDQFVGIFAQNRPEWTIVELGCYTYSMVAVPLYDTLGAEAITYIINKADLSVVFCDSPEKAKLLLSNVEKGETPVLRTIVLMNPFDNDLVERGKKCGVELVSLKDI-----------EPPKPDDLAVVCFTSGTTGNPKGAMLSHKNIVSNSAGFMKVTEDLMFPSTQDVLISFLPLAHMFERVVECVVLCHGARIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQ-ANTPVKRWMLDFASKRKEAELRSGIVRNDSFWDKIIFHKVQASLGGKVRLMVTGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCSLTIPGDWTAGHVGAPMPCNHVKLVDVEEMNYFASKG-EGEVCIKGSNVFQGYLKDDEKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYTRSEPVVQVFVHGESLQAFLVGIVVPDPDNVMNWAKKRKFEGSYEELCKNKDFKNAVLEDLLKLGKEAGLKTFEQVKDIALHSEMFAIENGLLTPTLKAKRPELRKYFKDEIDELY 687          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:Xenbase;Acc:XB-GENE-1007716])

HSP 1 Score: 487.649 bits (1254), Expect = 1.939e-162
Identity = 266/669 (39.76%), Postives = 381/669 (56.95%), Query Frame = 2
Query:  119 GLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKF--GNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            G   A    W  T+P    L    +   QS+        R S       V      D+KT+YD+FQ G     + PCLG++  +    Y W++Y EV E +   G+ ++      P  +  VGIF +N  EW  VE GC  YSM+ VPLYDT G ++  YIIN     V+F D+ +K   LL++  K   P L+ IV +N    D V+     G+   +   ++         LQ PK  D + + FTSGTTG PKG +++H++++S+        +V      N  +IH+S+LPL H++ERLV  ++  +  +I FF G+IRLL +++K+++PTI   VPR+LNR++D++    + +P+K ++ +     K  E+  GI+R +S WD IIF K+QA LGG V +++ G+APVSP V+ F R+ +G    EGYGQTE T   +LT+PGD   GHVG P+P + +KL DV E++   ++   GEVC+KG      Y  D E +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++EN+Y+ S  V Q+FV G+SL+ F V IV+PD D    W        S E++C +      +  DL  +G++  L  FE VK   L S   + ENGLLTPTLK KR E  K+F  EI  LY
Sbjct:   54 GAFAALTTYWYATRPKA--LKPPCDLAMQSVETQGGEHARRSTILDSDEVITYYYDDVKTIYDIFQRGRRVSNNGPCLGHRKPNQP--YEWISYKEVAERAEYVGSALLHR-GFKPSPDQFVGIFAQNRPEWTIVELGCYTYSMVAVPLYDTLGAEAITYIINKADLSVVFCDSPEKAKLLLSNVEKGETPVLRTIVLMNPFDNDLVERGKKCGLHCLRIRKLIALLVIPCHFLQPPKPDDLAVVCFTSGTTGNPKGAMLSHKNIVSNSAGFMKVTEVSNMLTMNANDIHISYLPLAHMFERLVQCVVLCHGARIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQ-ANTPVKRWMLDFASKRKEAELRSGIVRNDSFWDKIIFHKVQASLGGKVRLMVTGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCSLTIPGDWTAGHVGAPMPCNHVKLVDVEEMNYFASKG-EGEVCIKGSNVFQGYLKDDEKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYTRSEPVVQVFVHGESLQAFLVGIVVPDPDNVMNWAKKRKFEGSYEELCKNKDFKNAVLEDLLKLGKEAGLKTFEQVKDIALHSEMFAIENGLLTPTLKAKRPELRKYFKDEIDELY 715          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:Xenbase;Acc:XB-GENE-1007716])

HSP 1 Score: 487.649 bits (1254), Expect = 2.619e-162
Identity = 270/700 (38.57%), Postives = 384/700 (54.86%), Query Frame = 2
Query:  119 GLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFG---------------------------------NKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            G   A    W  T+P    L    +   QS+        R S       V      D+KT+YD+FQ G     + PCLG++  +    Y W++Y EV E +   G+ ++      P  +  VGIF +N  EW  VE GC  YSM+ VPLYDT G ++  YIIN     V+F D+ +K   LL++  K   P L+ IV +N    D V+     GV+     DI   GK N    + PK  D + + FTSGTTG PKG +++H++++S+        + + F                                  N  +IH+S+LPL H++ERLV  ++  +  +I FF G+IRLL +++K+++PTI   VPR+LNR++D++    + +P+K ++ +     K  E+  GI+R +S WD IIF K+QA LGG V +++ G+APVSP V+ F R+ +G    EGYGQTE T   +LT+PGD   GHVG P+P + +KL DV E++   ++   GEVC+KG      Y  D E +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++EN+Y+ S  V Q+FV G+SL+ F V IV+PD D    W        S E++C +      +  DL  +G++  L  FE VK   L S   + ENGLLTPTLK KR E  K+F  EI  LY
Sbjct:   34 GAFAALTTYWYATRPKA--LKPPCDLAMQSVETQGGEHARRSTILDSDEVITYYYDDVKTIYDIFQRGRRVSNNGPCLGHRKPNQP--YEWISYKEVAERAEYVGSALLHR-GFKPSPDQFVGIFAQNRPEWTIVELGCYTYSMVAVPLYDTLGAEAITYIINKADLSVVFCDSPEKAKLLLSNVEKGETPVLRTIVLMNPFDNDLVERGKKCGVELVSLKDIEEEGKANREKPKPPKPDDLAVVCFTSGTTGNPKGAMLSHKNIVSNSAGFMKVTEDLMFPSTQDVLISFLPLACTLFYMLRNVYYIFQNMLTMNANDIHISYLPLAHMFERLVQCVVLCHGARIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQ-ANTPVKRWMLDFASKRKEAELRSGIVRNDSFWDKIIFHKVQASLGGKVRLMVTGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCSLTIPGDWTAGHVGAPMPCNHVKLVDVEEMNYFASKG-EGEVCIKGSNVFQGYLKDDEKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYTRSEPVVQVFVHGESLQAFLVGIVVPDPDNVMNWAKKRKFEGSYEELCKNKDFKNAVLEDLLKLGKEAGLKTFEQVKDIALHSEMFAIENGLLTPTLKAKRPELRKYFKDEIDELY 726          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl5 (acyl-CoA synthetase long-chain family member 5 [Source:MGI Symbol;Acc:MGI:1919129])

HSP 1 Score: 506.138 bits (1302), Expect = 3.044e-170
Identity = 266/616 (43.18%), Postives = 381/616 (61.85%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D KTLY+ FQ GL   ++ PCLGY+  +    Y W++Y +V + +   G+ ++    +S   +  VGIF +N  EWV  E  C  YSM+ VPLYDT G ++  ++IN     V+  DT +K   L+ +  K   P LK I+ ++    D ++     GV+     D    GK N   P+P   PK +D S I FTSGTTG PKG ++THE+++S++ +   F + I      ++ +S+LPL H++ERLV  ++F   GKI FF G+IRLL ++MK +KPT+   VPR+LNR+YDKV    +++PLK ++ NL + +K  EV  GIIR++S+WD ++F KIQ  LGG V +++ G+AP+S  V+ FFR+ MG  V E YGQTE TG  ++T PGD   GHVG PV  +F+KL DV +++     +  GE+C+KG      Y  D E + +++D DGWLHTGDIG W   G LKIVDR K+IFKLAQGEY+APE++EN+YS S  V Q+FV G+SL+ F + +V+PD D   +  AK     S E++C +    E I  DL  +G++  L  FE VK   +     + ENGLLTPTLK KR E +KFF  +IK+LY+
Sbjct:   72 SDAKTLYENFQRGLAVSDNGPCLGYRKPNQP--YKWISYKQVSDRAEYLGSCLLHKGYKS-SQDQFVGIFAQNRPEWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADIPVVICDTPQKATMLVENVEKGLTPGLKTIILMDPFDDDLMKRGEKCGVEMLSLHDAENIGKENFKKPVP---PKPEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLEPIFQPTSDDVTISYLPLAHMFERLVQGILFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYDKVQNE-AKTPLKKFLLNLAIISKFNEVKNGIIRRDSLWDKLVFSKIQGSLGGKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTGGCSITSPGDWTAGHVGTPVACNFVKLEDVADMNYFSVNN-EGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIVDRKKNIFKLAQGEYIAPEKIENVYSRSRPVLQVFVHGESLRSFLIGVVVPDPDSLPSFAAKIGVKGSFEELCKNQCVKEAILEDLQKIGKEGGLKSFEQVKSIFVHPEPFTIENGLLTPTLKAKRVELAKFFQTQIKSLYE 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl1 (acyl-CoA synthetase long-chain family member 1 [Source:MGI Symbol;Acc:MGI:102797])

HSP 1 Score: 480.33 bits (1235), Expect = 5.577e-160
Identity = 268/695 (38.56%), Postives = 395/695 (56.83%), Query Frame = 2
Query:   53 FYWSQMFDINDCQSLALKLATTGLIVAGG-----VMWSMTKPPGPMLMKNANYDCQSI-VVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSS--MPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            F + +M ++ D +     L T  L+  G        W  T+P    L    +   QS+ +    + IR S       +      D++T+YD FQ G+    + PCLG +  +    Y W++Y EV E +   G+G+I+     P     +G+F +N  EWV VEQGC  YSM++VPLYDT G  +  YI+N  +  VIF D  +K   LL    +   P LK IV ++  G D V+     GV+      +   G+ N +  + P+ +D + I FTSGTTG PKG +ITH+++++         +     +  ++ +SFLPL H++E +V  +M  +  KI FF G+IRLL +++K+++PTI   VPR+LNR++D++    + S LK ++ +     K  E+  GI+R NS+WD +IF KIQ+ LGG V +++ G+APVS  V+ F R+ +G    EGYGQTE T    L+LPGD   GHVG P+P +++KL DV E++ + ++   GEVCVKG      Y  D   +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++ENIY  S  VAQ+FV G+SL+ F +A+V+PD++    W        S E++C +    + I  DL  +G++  L  FE VK   +     S +NGLLTPTLK KR E   +F  +I  LY
Sbjct:    7 FRYFRMPELIDIRQYVRTLPTNTLMGFGAFAALTTFWYATRPKA--LKPPCDLSMQSVEIAGTTDGIRRSAVLEDDKLLVYYYDDVRTMYDGFQRGIQVSNNGPCLGSRKPNQP--YEWISYKEVAELAECIGSGLIQK-GFKPCSEQFIGLFSQNRPEWVIVEQGCFSYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGKKCGVEIISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSGFIKATESAFIASTDDVLISFLPLAHMFETVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQANTS-LKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHKIQSSLGGKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTECTAGCCLSLPGDWTAGHVGAPMPCNYVKLVDVEEMNYLASKG-EGEVCVKGANVFKGYLKDPARTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEAVAQVFVHGESLQAFLIAVVVPDVESLPSWAQKRGLQGSFEELCRNKDINKAILDDLLKLGKEAGLKPFEQVKGIAVHPELFSIDNGLLTPTLKAKRPELRNYFRSQIDELY 694          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl1 (acyl-CoA synthetase long-chain family member 1 [Source:MGI Symbol;Acc:MGI:102797])

HSP 1 Score: 480.33 bits (1235), Expect = 5.577e-160
Identity = 268/695 (38.56%), Postives = 395/695 (56.83%), Query Frame = 2
Query:   53 FYWSQMFDINDCQSLALKLATTGLIVAGG-----VMWSMTKPPGPMLMKNANYDCQSI-VVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSS--MPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            F + +M ++ D +     L T  L+  G        W  T+P    L    +   QS+ +    + IR S       +      D++T+YD FQ G+    + PCLG +  +    Y W++Y EV E +   G+G+I+     P     +G+F +N  EWV VEQGC  YSM++VPLYDT G  +  YI+N  +  VIF D  +K   LL    +   P LK IV ++  G D V+     GV+      +   G+ N +  + P+ +D + I FTSGTTG PKG +ITH+++++         +     +  ++ +SFLPL H++E +V  +M  +  KI FF G+IRLL +++K+++PTI   VPR+LNR++D++    + S LK ++ +     K  E+  GI+R NS+WD +IF KIQ+ LGG V +++ G+APVS  V+ F R+ +G    EGYGQTE T    L+LPGD   GHVG P+P +++KL DV E++ + ++   GEVCVKG      Y  D   +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++ENIY  S  VAQ+FV G+SL+ F +A+V+PD++    W        S E++C +    + I  DL  +G++  L  FE VK   +     S +NGLLTPTLK KR E   +F  +I  LY
Sbjct:    7 FRYFRMPELIDIRQYVRTLPTNTLMGFGAFAALTTFWYATRPKA--LKPPCDLSMQSVEIAGTTDGIRRSAVLEDDKLLVYYYDDVRTMYDGFQRGIQVSNNGPCLGSRKPNQP--YEWISYKEVAELAECIGSGLIQK-GFKPCSEQFIGLFSQNRPEWVIVEQGCFSYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGKKCGVEIISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSGFIKATESAFIASTDDVLISFLPLAHMFETVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQANTS-LKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHKIQSSLGGKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTECTAGCCLSLPGDWTAGHVGAPMPCNYVKLVDVEEMNYLASKG-EGEVCVKGANVFKGYLKDPARTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEAVAQVFVHGESLQAFLIAVVVPDVESLPSWAQKRGLQGSFEELCRNKDINKAILDDLLKLGKEAGLKPFEQVKGIAVHPELFSIDNGLLTPTLKAKRPELRNYFRSQIDELY 694          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl1 (acyl-CoA synthetase long-chain family member 1 [Source:MGI Symbol;Acc:MGI:102797])

HSP 1 Score: 479.559 bits (1233), Expect = 9.657e-160
Identity = 268/695 (38.56%), Postives = 394/695 (56.69%), Query Frame = 2
Query:   53 FYWSQMFDINDCQSLALKLATTGLIVAGG-----VMWSMTKPPGPMLMKNANYDCQSI-VVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSS--MPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            F + +M ++ D +     L T  L+  G        W  T+P    L    +   QS+ +    + IR S       +      D++T+YD FQ G+    + PCLG +  +    Y W++Y EV E +   G+G+I+     P     +G+F +N  EWV VEQGC  YSM++VPLYDT G  +  YI+N  +  VIF D  +K   LL    +   P LK IV ++  G D V+     GV+      +   G+ N +  + P+ +D + I FTSGTTG PKG +ITH+++++         +     N  +  +S+LPL H+YE+ +  +M  +  KI FF G+IRLL +++K+++PTI   VPR+LNR++D++    + S LK ++ +     K  E+  GI+R NS+WD +IF KIQ+ LGG V +++ G+APVS  V+ F R+ +G    EGYGQTE T    L+LPGD   GHVG P+P +++KL DV E++ + ++   GEVCVKG      Y  D   +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++ENIY  S  VAQ+FV G+SL+ F +A+V+PD++    W        S E++C +    + I  DL  +G++  L  FE VK   +     S +NGLLTPTLK KR E   +F  +I  LY
Sbjct:    7 FRYFRMPELIDIRQYVRTLPTNTLMGFGAFAALTTFWYATRPKA--LKPPCDLSMQSVEIAGTTDGIRRSAVLEDDKLLVYYYDDVRTMYDGFQRGIQVSNNGPCLGSRKPNQP--YEWISYKEVAELAECIGSGLIQK-GFKPCSEQFIGLFSQNRPEWVIVEQGCFSYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGKKCGVEIISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSGFIKATESALTLNASDTQISYLPLAHMYEQQLQCVMLCHGAKIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQANTS-LKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHKIQSSLGGKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTECTAGCCLSLPGDWTAGHVGAPMPCNYVKLVDVEEMNYLASKG-EGEVCVKGANVFKGYLKDPARTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSEAVAQVFVHGESLQAFLIAVVVPDVESLPSWAQKRGLQGSFEELCRNKDINKAILDDLLKLGKEAGLKPFEQVKGIAVHPELFSIDNGLLTPTLKAKRPELRNYFRSQIDELY 694          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Match: Acsl6 (acyl-CoA synthetase long-chain family member 6 [Source:MGI Symbol;Acc:MGI:894291])

HSP 1 Score: 474.167 bits (1219), Expect = 1.385e-157
Identity = 268/678 (39.53%), Postives = 381/678 (56.19%), Query Frame = 2
Query:   98 ALKLATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLN--SKSSMPHLKYIVTLNDIGKDKVQEASLK-GVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            A  L + G + A    W   +P    L    N   QS  V+     R S       +      D +T+Y +F+ GL    + PCLG++       Y WL+Y EV + +   G+G+++  +   G    VG+F +N  EW+  E  C  YSM++VPLYDT G  S  YIIN      + VD   K   LL    +   P LK ++ +    +D ++E   K GV       I   G+ N   P+P   P+  D S + FTSGTTG PKG ++TH ++++         + + F  + ++ +SFLPL H++ER++ ++++ + G++ FF G+IRLL+++MK ++PTI   VPR+LNR+YDK+      S LK ++       K  EV  GIIR NSIWD + F KIQA LGG+V +I+ G+AP SP V+ F R+ +G  V EGYGQTE T   T T PGD   GHVG P+P + IKL D  EL+    +   GE+CVKG      Y  D + + + +DSDGWLHTGDIG W  +G LKI+DR KHIFKLAQGEY+APE++ENIY  S  VAQI+V GDSLK F V IV+PD   +  W        + +++C      + I  D+  +G+++ L  FE VK   +     S +NGLLTPTLK KR E  ++F ++I+ LY
Sbjct:   27 ATTLVSVGALAAVLAYWLTHRPKA--LQPPCNLLKQSEEVEDGGGARRSVIGGCTQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFR--KPEQPYQWLSYQEVAKRAEFLGSGLLQH-DCKVGTEQFVGVFAQNRPEWIIAELACYTYSMVVVPLYDTLGPGSISYIINTADICTVIVDKPHKATLLLEHVERKETPGLKLVILMEPF-EDALRERGKKCGVDIKSMQAIEDCGRENHHAPVP---PRPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRLLSDDMKALRPTIFPVVPRLLNRMYDKIFHQADTS-LKRWLLEFAAKRKQAEVRSGIIRNNSIWDELFFNKIQASLGGHVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDAEELNYWTCKG-EGEICVKGPNVFKGYLKDEDRTKEALDSDGWLHTGDIGKWLPEGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSEPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKKGIEGTYQELCMKKELKKAILDDMVMLGKESGLHSFEQVKAIYIHCDMFSVQNGLLTPTLKAKRPELREYFKKQIEELY 693          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|Q8JZR0|ACSL5_MOUSE (Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus OX=10090 GN=Acsl5 PE=1 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 2.129e-169
Identity = 266/616 (43.18%), Postives = 381/616 (61.85%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D KTLY+ FQ GL   ++ PCLGY+  +    Y W++Y +V + +   G+ ++    +S   +  VGIF +N  EWV  E  C  YSM+ VPLYDT G ++  ++IN     V+  DT +K   L+ +  K   P LK I+ ++    D ++     GV+     D    GK N   P+P   PK +D S I FTSGTTG PKG ++THE+++S++ +   F + I      ++ +S+LPL H++ERLV  ++F   GKI FF G+IRLL ++MK +KPT+   VPR+LNR+YDKV    +++PLK ++ NL + +K  EV  GIIR++S+WD ++F KIQ  LGG V +++ G+AP+S  V+ FFR+ MG  V E YGQTE TG  ++T PGD   GHVG PV  +F+KL DV +++     +  GE+C+KG      Y  D E + +++D DGWLHTGDIG W   G LKIVDR K+IFKLAQGEY+APE++EN+YS S  V Q+FV G+SL+ F + +V+PD D   +  AK     S E++C +    E I  DL  +G++  L  FE VK   +     + ENGLLTPTLK KR E +KFF  +IK+LY+
Sbjct:   72 SDAKTLYENFQRGLAVSDNGPCLGYRKPNQP--YKWISYKQVSDRAEYLGSCLLHKGYKS-SQDQFVGIFAQNRPEWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADIPVVICDTPQKATMLVENVEKGLTPGLKTIILMDPFDDDLMKRGEKCGVEMLSLHDAENIGKENFKKPVP---PKPEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLEPIFQPTSDDVTISYLPLAHMFERLVQGILFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYDKVQNE-AKTPLKKFLLNLAIISKFNEVKNGIIRRDSLWDKLVFSKIQGSLGGKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTGGCSITSPGDWTAGHVGTPVACNFVKLEDVADMNYFSVNN-EGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIVDRKKNIFKLAQGEYIAPEKIENVYSRSRPVLQVFVHGESLRSFLIGVVVPDPDSLPSFAAKIGVKGSFEELCKNQCVKEAILEDLQKIGKEGGLKSFEQVKSIFVHPEPFTIENGLLTPTLKAKRVELAKFFQTQIKSLYE 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|O88813|ACSL5_RAT (Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus OX=10116 GN=Acsl5 PE=1 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 1.348e-168
Identity = 260/616 (42.21%), Postives = 381/616 (61.85%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D KTLY++FQ GL   ++ PCLGY+  +    Y W++Y +V + +   G+ ++      P  +  +GIF +N  EWV  E  C  YSM+ VPLYDT G ++  Y+IN     V+  DT +K   L+ +  K   P LK ++ ++    D ++     G++     D    GK N   P+P   P  +D S I FTSGTTG PKG ++TH++++S++ +   F + I     +++ +S+LPL H++ERLV  ++F   GKI FF G+IRLL ++MK +KPT+   VPR+LNR+YDKV    +++PLK ++ NL + +K  EV  GIIR+NS+WD ++F KIQ+ LGG V +++ G+AP+S  V+ FFR+ MG  V E YGQTE T   ++T PGD   GHVG PV  +F+KL DV +++     +  GE+C+KG      Y  D E + +++D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+YS S  + Q+FV G+SL+ F + +V+PD +   +  AK     S E++C +    + I  DL  VG++  L  FE VK   +     S ENGLLTPTLK KR E +KFF  +IK+LY+
Sbjct:   72 SDAKTLYEVFQRGLAVSDNGPCLGYRKPNQP--YKWISYKQVSDRAEYLGSCLLHK-GYKPSQDQFIGIFAQNRPEWVISELACYTYSMVAVPLYDTLGAEAIIYVINRADISVVICDTPQKATMLIENVEKDLTPGLKTVILMDPFDDDLMKRGEKCGIEMLSLHDAENLGKENFKKPMP---PNPEDLSVICFTSGTTGDPKGAMLTHQNIVSNMAAFLKFLEPIFQPTPEDVTISYLPLAHMFERLVQGVIFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYDKVQN-EAKTPLKKFLLNLAIISKFNEVRNGIIRRNSLWDKLVFSKIQSSLGGKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTAGCSITSPGDWTAGHVGTPVSCNFVKLEDVADMNYFSVNN-EGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENVYSRSRPILQVFVHGESLRSFLIGVVVPDPESLPSFAAKIGVKGSFEELCQNQCVKKAILEDLQKVGKEGGLKSFEQVKSIFVHPEPFSIENGLLTPTLKAKRVELAKFFQTQIKSLYE 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|Q9ULC5|ACSL5_HUMAN (Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens OX=9606 GN=ACSL5 PE=1 SV=1)

HSP 1 Score: 496.123 bits (1276), Expect = 1.482e-165
Identity = 267/620 (43.06%), Postives = 384/620 (61.94%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGII-KLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNK---KEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D KT+Y++FQ GL   ++ PCLGY+  +    Y WL+Y +V + +   G+ ++ K    SP  +  VGIF +N  EW+  E  C  YSM+ VPLYDT G ++  +I+N     ++  DT +K   L+ +  K   P LK I+ ++    D  Q     G++     D    GK +   P+P   P  +D S I FTSGTTG PKG +ITH++++S+   A+ F   ++   +    ++ +S+LPL H++ER+V  +++    ++ FF G+IRLLA++MK +KPT+  AVPR+LNRIYDKV    +++PLK ++  L +++K KE+ +GIIR +S WD +IF KIQ  LGG V +I+ G+AP+S  V+ FFR+ MG  V E YGQTE TG  T TLPGD   GHVG+P+  +++KL DV +++     +  GEVC+KG      Y  D E + + +DSDGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++ENIY+ S  V QIFV G+SL+   V +V+PD D   +  AK     S E++C + V  E I  DL  +G+++ L  FE VK   L     S ENGLLTPTLK KR E SK+F  +I +LY+
Sbjct:   72 SDAKTMYEVFQRGLAVSDNGPCLGYRKPNQP--YRWLSYKQVSDRAEYLGSCLLHKGYKSSP--DQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVP---PSPEDLSVICFTSGTTGDPKGAMITHQNIVSN---AAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNE-AKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNN-EGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYE 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|Q9JID6|ACSL1_CAVPO (Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus OX=10141 GN=ACSL1 PE=2 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 2.389e-162
Identity = 269/668 (40.27%), Postives = 384/668 (57.49%), Query Frame = 2
Query:  119 GLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGII-KLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSS--MPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            G   A    W  T+P    L    +   QS+ V   +  R S              D++TLYD+FQ G+    + PCLG +       Y WL+Y +V++ S   G+ ++ K    SP  +  +GIF +N  EWV +EQ C  YSM++VPLYDT G  +  YI+N  +  VIF D  +K   LL S  +   P LK IV ++  G + V++    GV+      +   G+ N    + P+  D + I FTSGTTG PKG +ITH++++S   +     +     N  +IH+SFLPL H+YE+L+  +M  +  KI FF G+IRLL +++K ++PTI   VPR+LNR++D++    + + +K ++ +     K  E+  GIIR NS+WD +IF KIQ+ LGG V +++ G+APVS  V+ F R+ +G    EGYGQTE T   +L++PGD   GHVG P+P +FIKL DV E++ + A    GEVCVKG      Y  D   +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++ENIY  S  VAQ+FV G+SL+ F +AIV+PD   L  W        S E++C +    + I  D+  +G+ + L  FE V+   L     S +NGLLTPT+K KR E   +F  +I  LY
Sbjct:   34 GAFAALTTFWYATRPKA--LKPPCDLSMQSVEVAGSDGARRSTLLDSDEPLVYFYDDVRTLYDVFQRGIQVSNNGPCLGSRKPDQP--YEWLSYKQVEDLSECIGSALLQKGFQASP--DQFIGIFAQNRPEWVIIEQACFAYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKARILLESVENKLTPGLKIIVVMDSYGSELVEQGKKCGVEVISLKAMEGLGRANRRKPKPPEPDDLAVICFTSGTTGNPKGAMITHKNVVSDCSAFVKATEKALVLNASDIHISFLPLAHMYEQLLQCVMLCHGAKIGFFQGDIRLLMDDLKALQPTIFPVVPRLLNRMFDRIFAQ-ANTTVKRWLLDFASKRKEAELRSGIIRNNSVWDKLIFHKIQSSLGGKVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCSLSVPGDWTAGHVGAPMPCNFIKLVDVEEMNYMAAMG-EGEVCVKGPNVFKGYLKDPAKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYVRSEPVAQVFVHGESLQAFLIAIVVPDAESLASWARKRGFEGSFEELCRNKDVKKAILEDMVRIGKDSGLKSFEQVRGIALHPELFSVDNGLLTPTMKAKRPELRNYFRSQIDELY 693          
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Match: sp|Q9UKU0|ACSL6_HUMAN (Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens OX=9606 GN=ACSL6 PE=1 SV=4)

HSP 1 Score: 480.715 bits (1236), Expect = 2.774e-159
Identity = 266/677 (39.29%), Postives = 384/677 (56.72%), Query Frame = 2
Query:   98 ALKLATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLN--SKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            A  L + G + A    W   +P    L    N   QS  V+     R S   + P +      D +T+Y +F+ GL    + PCLG++       Y WL+Y EV + +   G+G+++  N     +  +G+F +N  EW+ VE  C  YSM++VPLYDT G  + +YIIN      + VD  +K   LL    +   P LK I+ ++   +   +     GV       +   G+ N   P+P   P+  D S + FTSGTTG PKG ++TH ++++         + + F  + ++ +SFLPL H++ER++ ++++ + G++ FF G+IRLL+++MK + PTI   VPR+LNR+YDK+    + +PLK ++       K  EV  GIIR +SIWD + F KIQA LGG V +I+ G+AP SP V+ F R+ +G  V EGYGQTE T   T T PGD   GHVG P+P + IKL DV EL+    +   GE+CV+G      Y  D + + + +DSDGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++ENIY  S  VAQI+V GDSLK F V IV+PD   +  W        +  D+C +    + I  D+  +G+++ L  FE VK   + S   S +NGLLTPTLK KR E  ++F ++I+ LY
Sbjct:   27 ATTLVSMGALAAILAYWFTHRPKA--LQPPCNLLMQSEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFR--KPKQPYQWLSYQEVADRAEFLGSGLLQH-NCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVP---PQPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRLLSDDMKALCPTIFPVVPRLLNRMYDKIFSQ-ANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKIQASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKG-EGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELY 693          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A2C9LHV8 (AMP-binding domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106070835 PE=4 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 1.307e-174
Identity = 263/624 (42.15%), Postives = 389/624 (62.34%), Query Frame = 2
Query:  281 CTDMK----------TLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNK---KEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY---RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            CTD K          T+YD FQ GL     +PCLGYK  S    Y W+TY EV +     G+G+++L    P   T VG++ +N  E++ ++Q   R+SM  VPLYDT G  +C +IIN  +   IF D N KV  LL+ +   P LK I+ ++ + +    +A+ +GV+  +  D+   GK NP+    PK  D   I +TSGTTG PKG +++H ++++   +A  F  +   G+K    ++ +S+LPL H YER++  L+     +I FF G+I+ L +++K ++PT+   VPR+LNR YDKV+  ++ S +K ++FN+ L +K K++ RGIIR ++IWD  IFR +Q  LGG V II  GSAP+S  V++F R ++G  ++EGYGQTE    +TLT+ GD +PGHVG P+P + +KLCDVPE++   ARD +GE+C+KG      Y  D+E + + +D + WLHTGDIG WT  G LK++DR K+IFKL+QGEY+APE++ENI++ SP VAQ++V GDSL+ F V I++PD +    +  K     S +++   P   + I +DL  +G+Q  L   E+VK   L     S ENGLLTPT K KR +  KFFA+EI+++Y
Sbjct:    5 CTDNKLISIYDDNIATVYDAFQNGLKESGDKPCLGYK-PSPDKPYTWITYREVSQRVAHLGSGLVQL-GLEPQNKTCVGVYSQNRPEYIIIDQAIIRHSMTGVPLYDTLGVDACNFIINQAELTTIFCDNNDKVSSLLDRRKQFPCLKTIIIIDQMNEKNRNKAAEEGVRLLQLEDVENLGKENPVAPTPPKPNDLYMICYTSGTTGTPKGAMLSHRNIIAVFAAAQEF--LKNCGSKIYQDDVLISYLPLAHSYERVIEALILAVGARIGFFQGDIKKLMDDLKELQPTLFPTVPRLLNRFYDKVLTGVNSSKVKKFLFNMALKSKTKDLKRGIIRNDTIWDKFIFRSVQQALGGRVRIITTGSAPISSTVLSFLRCIVGCPILEGYGQTENAAVSTLTVLGDPEPGHVGPPLPCNMVKLCDVPEMNY-FARDNKGEICIKGPNVFLGYLKDKEKTREALDEEDWLHTGDIGAWTPNGTLKVIDRKKNIFKLSQGEYIAPEKIENIFAQSPYVAQVYVHGDSLQAFLVGIIVPDAETLPNLCTKLGVSGSPKELAQSPAVKDAILKDLIELGKQQGLSSLEMVKDIYLHPDLFSVENGLLTPTFKTKRQDVQKFFAKEIESMY 623          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A4D5RU11 (Putative long chain fatty acid coa ligase (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 524.242 bits (1349), Expect = 5.446e-174
Identity = 264/644 (40.99%), Postives = 402/644 (62.42%), Query Frame = 2
Query:  197 DCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSAS-TFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            D QS +V     IR+S+             D +TL+D+   G     + PC+G++V  S   Y W+ Y++V E  +    G++KL  + PG  T +G++ +NC+EW+  EQ C  +SM++VPLYDT G  +C +I+N    E +  DT +KV+ LL   S  P LK IV + D+ +D  Q+A    +   KFS++   G+ N   P+P   P   D +++ +TSGTTG PKG ++TH +++S + +      D+   G+  ++ +SFLPL H+ ER     ++M  G++ FFSG+I+ L E+MK ++PTI   VPR+LNRI+DKV+   S S +K  + N+ L +K  E+   I+R+NSIWD ++F+ +   +GG + +++VGSAP++P+V+ F R  +G++++EGYGQTE T P TLT PGD + GHVG P+    +KL DVP+++   A +  GE+CVKG      Y  D + +S+++D DGWLHTGDIG W + G L+++DR KHIFKL+QGEY+APE+LENI+  S  VAQIFV G+SLK   VA+VIPD   L  W   +    + +++C + +  + I  DLS +G+ + L  FE++K   +   A+S ENGLLTPTLK KR E  K+F  +I+T+Y+
Sbjct:   44 DNQSRLVSGLERIRTSRLCHDGKHLEYLYEDCRTLFDVMYRGARVSNNGPCMGWRVPGSG-EYKWIHYNQVLERIKCIACGLVKL-GEKPGQQTFIGLYTQNCVEWIITEQACYYFSMIIVPLYDTLGAPACAFIMNQADIETVVCDTQEKVECLLKQASQTPKLKRIVVIKDVSEDVKQKAQEANIMLMKFSELEELGEKNFRHPLP---PHTSDLATVCYTSGTTGNPKGVMLTHLNIISDLSAVMYQLGDLAPKGD--DVMMSFLPLAHMLERCCEMAIYMIGGRVGFFSGDIKELGEDMKALRPTISPTVPRLLNRIHDKVISACSGSLMKRTLLNMALKSKAAELENCIVRQNSIWDSLVFKSVHESMGGRLRLMVVGSAPLAPNVITFVRCALGAVIVEGYGQTECTAPCTLTFPGDYNAGHVGPPIAACSVKLVDVPDMEY-YANNNEGEICVKGPTVFQGYLKDNKKTSEVLDKDGWLHTGDIGKWLDNGCLRVIDRKKHIFKLSQGEYIAPEKLENIFIRSLFVAQIFVHGESLKSCLVAVVIPDQEYLMHWARENCISGTYKELCRNNIVKKSILDDLSRLGKVSGLKSFELLKDIHVHHEALSVENGLLTPTLKTKRPECRKYFLSQIETMYR 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A1Z5L608 (Sodium-solute symporter (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 1.335e-173
Identity = 264/644 (40.99%), Postives = 399/644 (61.96%), Query Frame = 2
Query:  197 DCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSAS-TFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            D QS  V     IR+S+             D +TL+D+   G     +  C+G++   S   Y W+ Y++V E  +    G++ L  Q PG  T +G+F +NC+EW+  EQ C  +SM++VPLYDT G  +C +I+N    E +  DT +KV+ LL   S  P LK IV + DI +D  ++A    +   KFS++   G+ N   P+P   P   D +++ +TSGTTG PKG ++TH +++S++ +      D+   GN  ++ +SFLPL H+ ER     ++M  G + F+SG+I+ LAE+MK + PTI   VPR+LNRI+DKVM + S S LK  + NL L +K  ++ R ++ +++IWD ++F+ +Q  +GG + +++VGSAP++P+V++  R  +G +++EGYGQTE T P TLT+PGD D GHVG P+P   +KL DVP+++   A +  GE+CVKG      Y  D EM+ +++D DGWLHTGDIG W E G L+++DR KHIFKL+QGEY+APE+LENI+  S  VAQIFV G+SLK   VA+++PD D    W   ++   +  ++C + V  + I  DL  +G+++ L  FE++K   + S   S ENGLLTPTLK KR E  K+F  +I+ +Y+
Sbjct:   44 DNQSREVSGLEKIRTSRLCPNGKYIEYLYEDCRTLFDVMYRGARVSNNGRCMGWRSPGSG-EYKWIHYNQVLERIKCVACGLVALGEQ-PGQQTYIGLFTQNCVEWIITEQACYYFSMVIVPLYDTLGAAACTFIMNQADIETVVCDTQEKVECLLRQVSDCPKLKRIVVIKDITEDVKRKAGQMNIALLKFSELEELGEKNFRHPLP---PHTTDLATVCYTSGTTGNPKGVMLTHRNIVSNLSAVMYQLGDIAPTGN--DVMMSFLPLAHMLERCCEMALYMVGGAVGFYSGDIKELAEDMKALSPTISPTVPRLLNRIHDKVMSVCSSSFLKKTLLNLALRSKEADLKRFVVNQSTIWDKLVFKAVQETMGGRLRLMVVGSAPLAPNVISLVRCALGCVIVEGYGQTECTAPCTLTIPGDYDAGHVGPPIPACNVKLVDVPDMEYYAANN-EGEICVKGPTVFQGYLKDPEMTEEVLDKDGWLHTGDIGKWLENGCLRVIDRKKHIFKLSQGEYIAPEKLENIFIRSLYVAQIFVHGESLKSCLVAVIVPDEDYLLNWARANSISGTFAELCKNNVVKKSILDDLCTLGKRSGLKSFELLKDIYVHSEHFSVENGLLTPTLKTKRPECRKYFMPQIERMYR 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A2R5L9Z6 (Putative long chain fatty acid coa ligase (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 2.470e-173
Identity = 263/644 (40.84%), Postives = 401/644 (62.27%), Query Frame = 2
Query:  197 DCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSAS-TFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            D QS  V     IRSS+             D +TL+D+   G     +  C+G++ +  +  Y W+ Y++V E  +    G++ L  Q PG  T +G+F +NC+EW+  EQ C  +SM++VPLYDT G  +C +IIN    E +  DT +KV+ LL   S  P LK+IV + D+ +D  ++A    +   K+S++   G+ N   P+P   P   D +++ +TSGTTG PKG ++TH +++S++ +      ++   GN  ++ +SFLPL H+ ER     ++M  G + F+SG+I+ LAE+MK + PTI   VPR+LNRI+DKVM + + S +K  + +L L +K  ++ R ++ +NSIWD ++FR +Q  +GG + +++VGSAP++P+V++  R  +G +++EGYGQTE T P TLT+PGD D GHVG P+P   IKL DVP+++   A +  GE+CVKG      Y  D EM+ +++D DGWLHTGDIG W E G L++ DR KHIFKL+QGEY+APE+LENI+  S  VAQIFV G+SLK   VA+++PD D    W   ++   +  ++C + V  + I  DL  +G+++ L  FE++K   + S  +S ENGLLTPTLK KR E  K+F  +I+ +Y+
Sbjct:   46 DNQSREVSGLEKIRSSRLCPNGKYIEYLYEDCRTLFDVMYRGARVSNNGRCMGWR-NPGSGEYKWIHYNQVLERIKCVACGLVALGEQ-PGQQTYIGLFTQNCVEWIITEQACYYFSMVIVPLYDTLGSAACTFIINQADIETVVCDTQEKVECLLKQVSECPKLKHIVVIKDVTEDVKKKAEQLKITLLKYSELEELGEKNFRHPLP---PHTTDLATVCYTSGTTGNPKGVMLTHRNIVSNLSAVMYQLGELAPAGN--DVMMSFLPLAHMLERCCEMALYMVGGAVGFYSGDIKELAEDMKALSPTISPTVPRLLNRIHDKVMSVCNASFIKKTLLHLALRSKEADLKRFVVNQNSIWDKLVFRAVQETMGGRLRLMVVGSAPLAPNVISLVRCALGCVIVEGYGQTECTAPCTLTIPGDYDAGHVGPPIPACNIKLVDVPDMEYYAANN-EGEICVKGPTVFQGYLKDPEMTEEVLDKDGWLHTGDIGKWLENGCLRVTDRKKHIFKLSQGEYIAPEKLENIFIRSLYVAQIFVHGESLKSCLVAVIVPDEDYLLHWARANSISGTFAELCKNNVVKKSILDDLCTLGKRSGLKSFELLKDIYVHSEPLSVENGLLTPTLKTKRPECRKYFMPQIERMYR 681          
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Match: A0A1Z5L377 (30S ribosomal protein S12 (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 3.103e-173
Identity = 263/644 (40.84%), Postives = 399/644 (61.96%), Query Frame = 2
Query:  197 DCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSAS-TFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            D QS  V     IR+S+             D +TL+D+   G     +  C+G++   S   Y W+ Y++V E  +    G++ L  Q PG  T +G+F +NC+EW+  EQ C  +SM++VPLYDT G  +C +I+N    E +  DT +KV+ LL   S  P LK IV + DI +D  ++A    +   KFS++   G+ N   P+P   P   D +++ +TSGTTG PKG ++TH +++S++ +      D+   GN  ++ +SFLPL H+ ER     ++M  G + F+SG+I+ LAE+MK + PTI   VPR+LNRI+DKVM + S S LK  + NL L +K  ++ R ++ +++IWD ++F+ +Q  +GG + +++VGSAP++P+V++  R  +G +++EGYGQTE T P TLT+PGD D GHVG P+P   +KL DVP+++   A +  GE+CVKG      Y  D EM+ +++D DGWLHTGDIG W E G L+++DR KHIFKL+QGEY+APE+LENI+  S  VAQIFV G+SLK   VA+++PD D    W   ++   +  ++C + V  + I  DL  +G+++ L  FE++K   + +   S ENGLLTPTLK KR E  K+F  +I+ +Y+
Sbjct:   44 DNQSREVSGLEKIRTSRLCPNGKYIEYLYEDCRTLFDVMYRGARVSNNGRCMGWRSPGSG-EYKWIHYNQVLERIKCVACGLVALGEQ-PGQQTYIGLFTQNCVEWIITEQACYYFSMVIVPLYDTLGAAACTFIMNQADIETVVCDTQEKVECLLRQVSDCPKLKRIVVIKDITEDVKRKAGQMNIALLKFSELEELGEKNFRHPLP---PHTTDLATVCYTSGTTGNPKGVMLTHRNIVSNLSAVMYQLGDIAPTGN--DVMMSFLPLAHMLERCCEMALYMVGGAVGFYSGDIKELAEDMKALSPTISPTVPRLLNRIHDKVMSVCSSSFLKKTLLNLALRSKEADLKRFVVNQSTIWDKLVFKAVQETMGGRLRLMVVGSAPLAPNVISLVRCALGCVIVEGYGQTECTAPCTLTIPGDYDAGHVGPPIPACNVKLVDVPDMEYYAANN-EGEICVKGPTVFQGYLKDPEMTEEVLDKDGWLHTGDIGKWLENGCLRVIDRKKHIFKLSQGEYIAPEKLENIFIRSLYVAQIFVHGESLKSCLVAVIVPDEDYLLNWARANSISGTFAELCKNNVVKKSILDDLCTLGKRSGLKSFELLKDIYVHNEHFSVENGLLTPTLKTKRPECRKYFMPQIERMYR 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:103039859])

HSP 1 Score: 500.745 bits (1288), Expect = 2.479e-168
Identity = 264/615 (42.93%), Postives = 379/615 (61.63%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGII-KLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D KTLY++FQ GL    + PCLGY+   +   Y WL Y +V + +   G+G++ + L  SP  ++ +GIF +N  EW+  E  C  YSM+ VPLYDT G ++  +IIN      +  D   K + LL+S  K  +P L  I+ ++         AS  GV+     D+   GK+N   P+P   PK +D S + FTSGTTG PKG ++THE++++   S     +        ++ +SFLPL H++ER+V  +++   G++ FF G+IRLL ++MK +KPT+   VPR+LNR+YD+V    +Q+P K ++ N  +  K  EV  GIIR +SIWD  IF K+Q  LGG V +++ G+AP+SP V++F R+ +G  + E YGQTE T   T++LPGD   GHVG+PVP + +KL DV E++   + D  GEVC+KG+     Y  D E +++ +D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+Y  S LVAQ+FV GDSL+   VAIV+PD   L G+    +   S+E++C +    + I  DL+ +GR+  L  FE VK   L +   + ENGLLTPTLK KR E  K+F  +I +LY
Sbjct:   73 DAKTLYEVFQRGLHVSGNGPCLGYR--KAGKPYQWLKYKQVSDRAEYLGSGLLHRGLKPSP--DSFIGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEALIFIINRGSISTVICDKQNKAETLLDSCEKKLIPVLNTIIIMDPFDAAVGDRASKCGVEILNLKDVEALGKDNIKKPVP---PKPEDLSIVCFTSGTTGDPKGAMLTHENVVADAASFVKSFESAFTPLPTDVTISFLPLAHMFERVVQTVLYGAGGRVGFFQGDIRLLPDDMKTLKPTVFPVVPRLLNRVYDRVQSG-AQTPFKKWLLNFAIERKHAEVKEGIIRNDSIWDKFIFHKVQESLGGRVRVMVTGAAPISPSVLSFLRACLGCQIFEAYGQTECTAGCTISLPGDWTAGHVGVPVPCNVVKLVDVEEMNYFASND-EGEVCIKGKNVFRGYLNDPERTAEALDQDGWLHTGDIGKWLSSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSALVAQVFVHGDSLQSSLVAIVVPDPEVLPGYAEKLSLKGSMEELCKNQQIKKAIITDLTKLGREAGLKSFEQVKDLYLHADQFTIENGLLTPTLKAKRPELCKYFKTQIDSLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:103039859])

HSP 1 Score: 494.197 bits (1271), Expect = 1.033e-165
Identity = 262/612 (42.81%), Postives = 376/612 (61.44%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGII-KLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D KTLY++FQ GL    + PCLGY+   +   Y WL Y +V + +   G+G++ + L  SP  ++ +GIF +N  EW+  E  C  YSM+ VPLYDT G ++  +IIN      +  D   K + LL+S  K  +P L  I+ ++         AS  GV+     D+ V   +N I    PK +D S + FTSGTTG PKG ++THE++++   S     +        ++ +SFLPL H++ER+V  +++   G++ FF G+IRLL ++MK +KPT+   VPR+LNR+YD+V    +Q+P K ++ N  +  K  EV  GIIR +SIWD  IF K+Q  LGG V +++ G+AP+SP V++F R+ +G  + E YGQTE T   T++LPGD   GHVG+PVP + +KL DV E++   + D  GEVC+KG+     Y  D E +++ +D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+Y  S LVAQ+FV GDSL+   VAIV+PD   L G+    +   S+E++C +    + I  DL+ +GR+  L  FE VK   L +   + ENGLLTPTLK KR E  K+F  +I +LY
Sbjct:   73 DAKTLYEVFQRGLHVSGNGPCLGYR--KAGKPYQWLKYKQVSDRAEYLGSGLLHRGLKPSP--DSFIGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEALIFIINRGSISTVICDKQNKAETLLDSCEKKLIPVLNTIIIMDPFDAAVGDRASKCGVEILNLKDVEV--HSNSIYRFPPKPEDLSIVCFTSGTTGDPKGAMLTHENVVADAASFVKSFESAFTPLPTDVTISFLPLAHMFERVVQTVLYGAGGRVGFFQGDIRLLPDDMKTLKPTVFPVVPRLLNRVYDRVQSG-AQTPFKKWLLNFAIERKHAEVKEGIIRNDSIWDKFIFHKVQESLGGRVRVMVTGAAPISPSVLSFLRACLGCQIFEAYGQTECTAGCTISLPGDWTAGHVGVPVPCNVVKLVDVEEMNYFASND-EGEVCIKGKNVFRGYLNDPERTAEALDQDGWLHTGDIGKWLSSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSALVAQVFVHGDSLQSSLVAIVVPDPEVLPGYAEKLSLKGSMEELCKNQQIKKAIITDLTKLGREAGLKSFEQVKDLYLHADQFTIENGLLTPTLKAKRPELCKYFKTQIDSLY 676          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: ENSAMXT00000010887.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29078343:29143528:-1 gene:ENSAMXG00000010601.2 transcript:ENSAMXT00000010887.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 488.419 bits (1256), Expect = 8.132e-163
Identity = 277/686 (40.38%), Postives = 390/686 (56.85%), Query Frame = 2
Query:   80 NDCQSLALKLATTGLIVAGGVM-----WSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +D   L   L T+ L+  G +      W  T+P G  +    +   QS  V+     R S     P +      D  TLY++FQ GL      PCLG ++ +    Y WL+Y EV   +   G+G++    Q P  +  VG+F +N  EW+  E  C  YSM++VPLYDT G  + +YIIN  +   +  D  +K   LL +  +   P LK I+ ++    + V++ +  GV      D+           + P+  D S + FTSGTTG PKG ++TH ++++         D +   NK ++ +SFLPL H++ERL+  +++ + G+I FF G+IRLL+E+MK+++PTI   VPR+LNR+YDK+    + S +K +I N     K  EV+RG+IR +SIWD I F KIQA LGG + +I+ G+AP SP V+ F R+ +G  V E YGQTE T   T T PGD   GHVG P+P + IKL DVPE +   ++   GEVCVKG      Y  D   +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY++PE++ENIY  S  V+Q++V GDSL+   VAIV+PD   +  W        S ED+C +    + I  DL  +G+ + L  FE VK   + S   S ENGLLTPTLK KR E  ++F QEI+ LYQ
Sbjct:   64 DDLGQLFRSLPTSTLVGLGALTAVLAYWLATRPRG--IAPPCDLSNQSEEVEGGG--RRSMLGDSPELLTHYFEDATTLYEVFQRGLHVSGDGPCLGSRLPNQP--YKWLSYKEVMTRAEHLGSGLLYQGCQ-PNSDQLVGVFAQNRPEWIIAELACYTYSMVVVPLYDTLGPDAIRYIINIAEISTVICDKPEKAKVLLGNVERQETPGLKRIILMDLFDPELVEQGNNSGVHIQSLKDV-----------EPPRPDDLSIVCFTSGTTGNPKGVMLTHGNVVADFAGFLKVTDKVIRPNKDDVLISFLPLAHMFERLIEAVVYCHGGRIGFFQGDIRLLSEDMKVLRPTIFPVVPRLLNRMYDKIFSQANNS-VKRWILNFAAKRKAAEVSRGVIRSDSIWDKIFFSKIQASLGGRLRMIITGAAPTSPTVLGFLRAALGCQVYEAYGQTECTAGCTYTTPGDWTSGHVGAPLPCNLIKLVDVPEKNYFSSKG-EGEVCVKGPNVFKGYLKDPVKTAETLDPDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYISPEKIENIYIRSEPVSQLYVHGDSLQACLVAIVVPDPEVMPSWARKKGLDGSYEDLCKNGELKKAILEDLVRLGKASGLHSFEQVKNIYVHSDMFSIENGLLTPTLKAKRPELRQYFKQEIEELYQ 729          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: acsl2 (long-chain-fatty-acid--CoA ligase 6 [Source:NCBI gene;Acc:103038184])

HSP 1 Score: 486.493 bits (1251), Expect = 2.226e-162
Identity = 257/670 (38.36%), Postives = 388/670 (57.91%), Query Frame = 2
Query:  119 GLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLL--NSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            G + +    W +T+P    +    +   QS+ V    S R S       +      D KT+Y++FQ GL      PCLG++       Y W+ Y+EV E ++  G+G++      P     VGIF +N  EWV  E  C  +SM +VPLYDT G ++  +I+N  +  ++  D  +K + LL    K   P L  +V  N +    V+     GV+    S+I+  G+ N   P+P   PK QD + + FTSGTTG PKG +ITH ++ S+  S     +      ++++ +S+LPL H++ER++   MF +  ++ F+ G+I LL +++K +KPT    VPR+LNRIYDK++  ++ SPLK  I +  +  K  E++ GI+R NS WD ++  KIQA LGGNV  I+  SAP+SP V++F R+ +G L+ EGYGQTE T   T ++PGD   GHVG P+P + +KL D+P+++   A    GE+C++G      Y  D+E + + +DSDGWLHTGD+G W   G L+I+DR K+IFKL+QGEY+APE++EN+YS    V Q+FV GDSL+ F + IV+PD +    W        S E++C +P   + +  D++AVG++  L  FE VK   L S   S  NGLLTPTLK +R +  + F+++I  +Y
Sbjct:   50 GALASLTAYWLVTRPRS--IQPPCDLQAQSVPVKGDPSCRRSALLKDDNLLDFYYEDTKTVYEVFQRGLRIAGDRPCLGFR--KPGEPYQWIPYTEVAERAQVLGSGLLAK-GCKPNPKQFVGIFAQNRPEWVIAELACYTFSMAVVPLYDTLGLEAMVHILNLAEISLVICDKEEKAESLLLNKEKGVTPALSCLVLFNPVSAALVERGKACGVEIMHLSEIMDLGRENLKTPVP---PKPQDLAVVCFTSGTTGKPKGAMITHGNIASNTSSVIKILEGFFVIRQEDVSISYLPLAHMFERMIQVSMFCHGARVGFYQGDISLLMDDIKTLKPTFFPVVPRLLNRIYDKIISSVT-SPLKRAILHYAVRRKQAELSCGIVRNNSFWDKLVLNKIQANLGGNVRFILTASAPISPTVLSFLRATLGCLIFEGYGQTECTAGCTFSMPGDWTAGHVGAPLPCARVKLTDIPDMNYY-ASSGEGEICIQGPSVFQGYLNDKERTDEALDSDGWLHTGDVGQWQPNGTLQIIDRKKNIFKLSQGEYIAPEKIENVYSRCVPVLQVFVHGDSLQSFLIGIVVPDPEVFVNWNKDRGIVGSYEELCQNPDVKKAVLEDMTAVGKKAGLKSFEQVKDVYLHSELFSISNGLLTPTLKSRRVDLRRVFSEQINQMY 709          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Match: acsl1a (long-chain-fatty-acid--CoA ligase 1 [Source:NCBI gene;Acc:103038692])

HSP 1 Score: 469.159 bits (1206), Expect = 8.863e-156
Identity = 258/689 (37.45%), Postives = 383/689 (55.59%), Query Frame = 2
Query:   74 DINDCQSLALKLATTGLIVAGG-----VMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPH-LKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D+ D +     L T  L+  GG       W  T+P    L    +   QS+ ++     R S       +      D +T+Y++F  G+    + PCLG +       Y WL+Y EV + +   G+ ++   +   G +  +GIF +N  EW   E  C  YS++ VPLYDT G ++  YII+      +  D  +K   +L+  S   H +K IV +     +    A  +G+Q     ++   GK N   P+P   PK +D + I FTSGTTG PKG ++TH +++S+        ++    +  +IH+S+LPL H++ER+V  ++ ++  +I +F G+IR+L +++K +KPT+   VPR+LNR++DK+    + +PLK ++ +     K  E+  G++RK+S+WD +IF K+QA LGG V +++ G+APVSP V+ F R+ +G    EGYGQTE T   ++++PGD   GHVG P+P +++KL DV +++   A    GEVCVKG      Y  D E +++ ID DGWLHTGDI  W   G LKI+DR KHIFKLAQGEY+APE++EN+Y  S  VAQIFV GDSL+   V IV+PD D   GW        S  D+C        I  DL  +G++  L  FE V+   L     S +NGLLTPTLK KR E   +F + I  LY
Sbjct:   14 DLGDMRQYVQSLPTNILMGMGGFAAITTYWYATRPKA--LKPPCDLAMQSVEIEGGEYARRSILLDDDKLMTHFYNDARTMYEVFLRGIKMSNNGPCLGSR--KPKQPYEWLSYQEVADRAEMIGSALLHRGHSQAG-DKYIGIFAQNRPEWTISELACYTYSLVAVPLYDTLGAEAISYIIDKALLSTVICDVVEKARTILDCVSGREHSIKTIVLMEAFESELTARAQKEGIQIISLKELEATGKANHKRPMP---PKPEDLALICFTSGTTGNPKGAMLTHGNVISNCAGFIRITEIHCMLHHDDIHISYLPLAHMFERVVECVILVHGARIGYFQGDIRMLMDDLKTLKPTVFPVVPRLLNRMFDKIFGQ-ANTPLKRWLLDFATRRKESELRSGVVRKDSMWDKLIFSKVQASLGGCVRLMITGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCSMSMPGDWTAGHVGAPLPCNYVKLVDVTDMNYRAASG-EGEVCVKGPNVFQGYLKDPEKTAEAIDKDGWLHTGDIAKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYIQSDPVAQIFVHGDSLQACLVGIVVPDPDFLPGWAKNRGLEGSYTDLCKSKELKNAILEDLVRLGKEAGLKSFEQVRDIVLQPEMFSVQNGLLTPTLKAKRTELRNYFREHIDQLY 692          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 470.315 bits (1209), Expect = 7.558e-157
Identity = 253/617 (41.00%), Postives = 369/617 (59.81%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GW---KTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D +T Y++FQ GL    + PCLGY+  +    Y W++Y E  + +   G+G + L    P     +GIF +N  EW+  EQ C  YS+++VPLYDT G +S  YIIN  +  ++  D  +KV  LL S  + ++  +K IV ++       Q A   G+    F ++ V GK N   PIP   P+  D + I +TSGTTG PKG ++TH++M+S   +           N  ++ +SFLPL H++ERLV   +    G++ F+ G+IRLL ++MK+++PT+   VPR+LNRI+DKV+   ++S  K ++    ++ K+ E+  G++RK+SIWD +IF ++QA +GG V  ++ G+AP+S  ++ F R+++G  V EG+GQTE T   T T+P DS  GHVG P+P + IK+ DV E++   A +  GEVCV G      Y  D   +++ +D DGWLHTGDIG W   G LKIVDR KHIFKL+QGEY+APE++E +Y  S  VAQ+FV GDSL+   V IV+PD++    W   + +     SV    N  V   I+  D+  +G++  L  FE V+   L S   S ENGLLTPT K+KRAE  KFF  EI +LY
Sbjct:   90 DARTGYEVFQRGLRISNNGPCLGYRKPNHP--YEWISYKETSDRAEYLGSGFLHL-GAKPSSEQVIGIFSQNRPEWIIAEQACYTYSLVVVPLYDTLGRESIDYIINQAEISMVVCDKLEKVKGLLESIEEGAIRIVKTIVVMDPFDGVMEQRARKCGIDLILFRELEVIGKTNHREPIP---PQPDDIAIICYTSGTTGNPKGAMLTHKNMISDFSAFLAITKDTFLPNTDDVLISFLPLAHMFERLVEASILCNGGRVGFYQGDIRLLMDDMKVLQPTVFPVVPRLLNRIHDKVLSG-AKSHFKRWLLEFAVSRKIAELRCGVVRKDSIWDKLIFHRVQASMGGRVRFMVTGAAPISASILTFLRAILGCQVYEGFGQTECTAGCTFTMPSDSTAGHVGPPMPCNHIKVVDVAEMNYFAA-NGEGEVCVYGTNVFKGYLKDPTRTAEALDEDGWLHTGDIGKWLPNGTLKIVDRKKHIFKLSQGEYIAPEKIETVYVRSEPVAQVFVHGDSLQSCLVCIVVPDMEVLPSWVQKRGIKCNPNSV--FINKDVRAAILH-DMVRLGKEAGLKSFEQVRAVHLHSDLFSIENGLLTPTFKVKRAEVCKFFHSEIDSLY 695          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 398.282 bits (1022), Expect = 2.129e-132
Identity = 194/432 (44.91%), Postives = 278/432 (64.35%), Query Frame = 2
Query:  821 PKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            PK +D + + FTSGTTG PKG ++TH +++S +       + +      +I +S+LPL H++ERLV   +F +   I FF G++RLL ++M+ ++PT+   VPRILNR+YDKV+   +++P +  +   G   KM E+ RG++R+NS+WD+++FR +Q  +GG V +IM G+AP+SP V+NF R VMG  + EGYGQTE T   TLTLPGD   GHVG P+P ++IKL DV +++   ++  +GEVCVKG      Y  D E +++ +D DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY+APE++EN+YS    VAQ++V GDSL+   VA+V+PD   L  W        +  ++C +    + I  D+  +G+++ L  FE VK   L +   S ENGLLTPT K KR E    F   I ++YQ
Sbjct:   16 PKPEDLAIVCFTSGTTGNPKGAMLTHRNIVSDMSGFLKVTESLFLPETSDIAISYLPLAHMFERLVQATLFCHGASIGFFQGDVRLLLDDMQALRPTVFPVVPRILNRMYDKVLGS-TRTPFRRKLLEFGARRKMAELQRGVVRRNSLWDWLVFRPMQLSVGGRVRMIMTGAAPISPGVLNFLRVVMGCQMYEGYGQTECTAGCTLTLPGDWKAGHVGAPMPCNYIKLHDVKDMEYYTSQG-KGEVCVKGPNVFKGYLKDAEKTAEAVDRDGWLHTGDIGQWMPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYSRCEPVAQVYVHGDSLQACLVAVVVPDPEILCCWIRKKGIVGTYSELCRNKEVRQAILEDMQRLGKESDLQPFEQVKDVHLHNEMFSIENGLLTPTFKAKRTELRTHFRSVISSMYQ 445          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 200.675 bits (509), Expect = 3.214e-55
Identity = 179/654 (27.37%), Postives = 297/654 (45.41%), Query Frame = 2
Query:  293 KTLYDLFQCGL-IHGEHEPCLGYKVDSSAANYHW--LTYSEVDENSRQTGAGIIKL-LNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIP-----LQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKF----GNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRL---LAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKN------------SIWDYIIFRKIQAILG-GNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLEN-IYSLSPLVAQIFVTGDSLKDFCVAIVI---PDLDGWKTVDAKYRSVEDICN----------------DPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            +T+  LF+  + ++G+H      K  +S     W  LTY E     RQ     +KL L +  G    VGI   N  EW   + G        V +Y T+  ++CQY+ ++    +I V+ +K++  +L  +S +PHLK IV      K +++E   K    + +++ + AG+  P       +   +A    S+++TSGTTG PKG +++H+++     +A+   ++ +      N +E+ +S+LPL+H+  +LV   + M  G + +F+    L   L   MK ++PT    VPR+    ++K+M  +  +  KS IF   +A   K V       N            ++ + ++F+K++  LG         G+AP++ D + FF S +   V E YG +E++GP T++ P     G  G  + G    L    E       +  GEVC  GR     Y    E + + ID DGWLH+GD+G   E+G L I  R K +   A GE + P  +E+ I    P+V+   V GD  K   V + +    + D  +  DA    V   C                 DPV    I   +  V ++      + V++  L     S   G L PT+KLKR   +K + + I+ LY+
Sbjct:   81 ETINQLFERTVKLYGDH------KALASKEGNTWKILTYKEYYAQCRQAAKSFLKLGLQRYHG----VGILGFNSAEWFISDIGAILAGGFAVGIYTTNSAEACQYVADNCLANIIVVENDKQLQKILEVQSQLPHLKAIVQY----KGELKE---KKPNVYSWAEFMRAGEEVPDAQLDAIIASQRANQCCSLIYTSGTTGSPKGVMLSHDNL---TWTATVTGELTQLRSADDNYQEVVISYLPLSHIAAQLVDIWLPMRFGGVTYFAQPDALKGSLVVTMKEVRPTGFMGVPRV----WEKMMEKMKATAAKSGIFKRKIAGWAKSVGLQTHLANMKGNPAEAPMGYTLANMLVFKKVREALGLDRCTKCYTGAAPITRDTLEFFLS-LDIPVFELYGMSESSGPHTISSPTAFQIGSCGTLLRGCRTLLHSKDE-------EGSGEVCFWGRHVFMGYLNMEEKTREAIDDDGWLHSGDLGRVDEQGLLYITGRIKELIITAGGENVPPIPIEDAIKEELPVVSNAMVIGDRRKFLSVLLTLKCESNGDSGEPDDALTDEVVHWCQRVGSTATRASQIAGGKDPVVERAIRDGIERVNKRAP-SNAQRVQKWELLLRDFSIPGGELGPTMKLKRPVVTKIYQELIERLYE 701          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: acsl3b (acyl-CoA synthetase long chain family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-492])

HSP 1 Score: 125.561 bits (314), Expect = 3.187e-32
Identity = 82/289 (28.37%), Postives = 142/289 (49.13%), Query Frame = 2
Query:  680 MPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAG---KNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSI-GSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEI---------RLLAEEMKIIKPTILFAVPRILNRIYDKVM-PIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKL 1504
            +P L+Y+V ++            +G++    SD+   G   ++       P  +D + +++TSG+TGIPKG  I H +++++I G      D+       + ++ +LPL HV E     +      +I + S +          +    ++ I++PT++ AVP I+ RIY  VM  +   S L+  IF L    K++++ RG      + + ++F K+ A+LGGNV +++ G+AP+SP    F        V +GYG TET    T+    D   GHVG P+    I+L
Sbjct:    7 VPRLRYVVLVDGTASGVAGVKLPRGIEVMGMSDVEELGDKPQHRQRARDRPGPRDLAVVMYTSGSTGIPKGVRIAHSNLVAAITGMYLRINDICG----DDTYIGYLPLAHVLELGAEMVCLSRGCRIGYSSAQTLTDQSTRIKKGSQGDVTILRPTLMAAVPEIMERIYKGVMGKVQCMSLLQRIIFKLAYNYKLEQLERGF--DTPLCNRLVFNKLCALLGGNVRLLLSGAAPLSPRTQRFMNVCFCCPVGQGYGLTETCAAGTIAELQDYSTGHVGAPLSCCEIQL 289          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005646.1 (pep scaffold:Pmarinus_7.0:GL484188:1842:9754:1 gene:ENSPMAG00000005099.1 transcript:ENSPMAT00000005646.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 1.497e-24
Identity = 58/178 (32.58%), Postives = 95/178 (53.37%), Query Frame = 2
Query:  203 QSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINH-VKCEVIFVDTNKKVDFLLN--SKSSMPHLKYIVTLN--DIG 721
            QS+ V+ ++ +R S       +      D KT+Y++F  G+   ++ PCLGY+       Y W++Y EV E S   G+G+I      P  +  +G+F +N  EW+  EQ C  YSM++VPLYDT G+++ ++IIN   +  V+  DT ++   LL        P L+ +V +   D+G
Sbjct:   60 QSVEVEGQDGVRRSALLKKDKLLEFYYEDAKTMYEVFHRGMRVSKNGPCLGYR--KPKKPYQWMSYKEVAERSEWFGSGLIHK-GCRPATDQFIGVFAQNRPEWIITEQACYMYSMVVVPLYDTLGQEAIRFIINRAAEIAVVVCDTVERARVLLRGVENRETPGLRTVVVMETPDLG 234          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: FAA2 (Medium chain fatty acyl-CoA synthetase; activates imported fatty acids; accepts a wide range of fatty acid chain lengths with a preference for medium chains, C9:0-C13:0; localized to the peroxisome; comparative analysis suggests that a mitochondrially targeted form may result from translation starting at a non-canonical codon upstream of the annotated start codon [Source:SGD;Acc:S000000817])

HSP 1 Score: 285.034 bits (728), Expect = 7.589e-86
Identity = 203/656 (30.95%), Postives = 322/656 (49.09%), Query Frame = 2
Query:  281 CTD--MKTLYDLFQCGLIHGEHEPCLGYK-VDSSAAN----YHWLTYSEVDENSRQTGAGIIKLLNQS-----PGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEV-IFVDTNKKVDFLLNSKSSMPHLKYIVTL---NDIGKDKVQ---EASL--------KGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSA-STFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIR-----LLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFR-----KIQAILG-GNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIY-SLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKYRSVEDICNDPVATEIIERD-------LSAVGR-QNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            C D  ++T YD F           CLG + +D +       + + +YS V +     G+GI+ L+N          +  V I   N  EW+  +  C  YS+    LY+T G  + +YI+N  +  + IF  +N     + +    +P +K++ TL   +++  D+++   E+ L        + + FF    +   G  N IP   P      +I FTSGTTG+PKG  ++H ++ S I  A STF       N++   + FLPL H++ER+V      Y   I F  G +      +L E++KI+KP  +  VPRIL R    +   + +S ++  + N  L +K            SI +++++      KI+  LG  N   I+ GSAP+S D + F RS +   + +GYG TET     L+ P + D G  G     +  +L  VPE+     +D +GE+ ++G      YF +   +SK +D DGW  TGD+     KG++ ++DR K+ FKLA GEY+APE++ENIY S  P + QIFV GD LK F V IV  D+D  + + A            V  E + R+       L+ + +  + L GFE +   ++    ++ E+ ++TPT K+KRA+ASKFF   +  LY
Sbjct:   87 CVDKNLRTAYDHFMFSARRWPQRDCLGSRPIDKATGTWEETFRFESYSTVSKRCHNIGSGILSLVNTKRKRPLEANDFVVAILSHNNPEWILTDLACQAYSLTNTALYETLGPNTSEYILNLTEAPILIFAKSN-----MYHVLKMVPDMKFVNTLVCMDELTHDELRMLNESLLPVKCNSLNEKITFFSLEQVEQVGCFNKIPAIPPTPDSLYTISFTSGTTGLPKGVEMSHRNIASGIAFAFSTFRIPPDKRNQQLYDMCFLPLAHIFERMV----IAYDLAIGFGIGFLHKPDPTVLVEDLKILKPYAVALVPRILTRFEAGIKNALDKSTVQRNVANTILDSKSARFTARGGPDKSIMNFLVYHRVLIDKIRDSLGLSNNSFIITGSAPISKDTLLFLRSALDIGIRQGYGLTETFAGVCLSEPFEKDVGSCGAIGISAECRLKSVPEMGYHADKDLKGELQIRGPQVFERYFKNPNETSKAVDQDGWFSTGDVAFIDGKGRISVIDRVKNFFKLAHGEYIAPEKIENIYLSSCPYITQIFVFGDPLKTFLVGIVGVDVDAAQPILAAKHPEVKTWTKEVLVENLNRNKKLRKEFLNKINKCTDGLQGFEKLHNIKVGLEPLTLEDDVVTPTFKIKRAKASKFFKDTLDQLY 733          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: FAA1 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; accounts for most acyl-CoA synthetase activity; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms ER foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000005844])

HSP 1 Score: 234.187 bits (596), Expect = 1.925e-67
Identity = 166/610 (27.21%), Postives = 288/610 (47.21%), Query Frame = 2
Query:  377 ANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIG-KDKVQEASL---------------KGVQFFKFSDILVAGKN--NPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFF------SGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSP-LKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKYR---------SVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            ++YH+ ++ ++ +   + G G++K+    P  + K+ ++     +W+ +  G     + +V  YDT GE+   + +     + IF D N  +  L+    +   +KYI+  + I  +D+ Q   +                 ++ F F DIL  GK   N I +  P   D   I++TSG+TG PKG ++ H ++++ +G AS   +V+KF    +  + FLPL H++E +   L F +   I +       S  +R    +++  KPTI+  V  +   +   ++  I   P L   IF      K+  + R  I        ++F+KI+   GG +  ++ G +P+S D   F  +++  ++I GYG TET    T+  P + + G  G       +KL DV EL    A++ +GEV + G     EY+ + E +S+ + SDGW  TGDIG W   G LKI+DR K++ K   GEY+A E+LE++Y  +  VA I V  D  K   V I++P+      +  K           ++E+   D    + +  DL   G+   L+G E++          +P+NG +T   KLKR +       ++  +Y
Sbjct:   95 SHYHYNSFDQLTDIMHEIGRGLVKI-GLKPNDDDKLHLYAATSHKWMKMFLGAQSQGIPVVTAYDTLGEKGLIHSLVQTGSKAIFTD-NSLLPSLIKPVQAAQDVKYIIHFDSISSEDRRQSGKIYQSAHDAINRIKEVRPDIKTFSFDDILKLGKESCNEIDVHPPGKDDLCCIMYTSGSTGEPKGVVLKHSNVVAGVGGASL--NVLKFVGNTDRVICFLPLAHIFELVFELLSFYWGACIGYATVKTLTSSSVRNCQGDLQEFKPTIMVGVAAVWETVRKGILNQIDNLPFLTKKIFWTAYNTKLN-MQRLHIPGGGALGNLVFKKIRTATGGQLRYLLNGGSPISRDAQEFITNLICPMLI-GYGLTETCASTTILDPANFELGVAGDLTGCVTVKLVDVEELGYF-AKNNQGEVWITGANVTPEYYKNEEETSQALTSDGWFKTGDIGEWEANGHLKIIDRKKNLVKTMNGEYIALEKLESVYRSNEYVANICVYADQSKTKPVGIIVPNHAPLTKLAKKLGIMEQKDSSINIENYLEDAKLIKAVYSDLLKTGKDQGLVGIELLAGIVFFDGEWTPQNGFVTSAQKLKRKDILNAVKDKVDAVY 697          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: FAA4 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; role in stationary phase survival; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms cytoplasmic foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000004860])

HSP 1 Score: 223.787 bits (569), Expect = 8.773e-64
Identity = 172/607 (28.34%), Postives = 288/607 (47.45%), Query Frame = 2
Query:  383 YHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVD------------TNKKVDFLLNSKSSMPHLK------YIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKN--NPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFS------GEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKY------RSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            Y  +TY E+       G G+IK+  +  G N K  IF     +W+    GC    + +V  YDT GE    + +       IF D            T K V F+++++   P  K      Y    + +  DK++E     ++ + F +I+  GK   + + L  PK +DP+ I++TSG+TG PKG ++TH ++++ IG      +VI +    +  ++FLPL H++E       F + G + + +         R    ++   KPT++  V  +   +   ++  I++ P  S      + A +KE N   I  + +   +IF++I+   GGN+  I+ G + +S D   F  +++  ++I GYG TE    A +  P   D G  G  V     KL DV +L    A++ +GE+  KG    SEY+ + E ++     DGW  TGDI  WT KGQ+KI+DR K++ K   GEY+A E+LE+IY  +P V  I V  D  K   V IV+P+L     +  +         VE   ++    + + +D+ +  +   L G E++          +PENGL+T   KLKR +       +++ +Y+
Sbjct:   97 YITMTYEEMICVMHDIGRGLIKIGVKPNGEN-KFHIFASTSHKWMKTFLGCMSQGIPVVTAYDTLGESGLIHSMVETDSVAIFTDNQLLSKLAVPLKTAKNVKFVIHNEPIDPSDKRQNGKLYKAAKDAV--DKIKEVR-PDIKIYSFDEIIEIGKKAKDEVELHFPKPEDPACIMYTSGSTGTPKGVVLTHYNIVAGIGGVG--HNVIGWIGPTDRIIAFLPLAHIFELTFEFEAFYWNGILGYANVKTLTPTSTRNCQGDLMEFKPTVMVGVAAVWETVRKGILAKINELPGWSQTLFWTVYA-LKERN---IPCSGLLSGLIFKRIREATGGNLRFILNGGSAISIDAQKFLSNLLCPMLI-GYGLTEGVANACVLEPEHFDYGIAGDLVGTITAKLVDVEDLGYF-AKNNQGELLFKGAPICSEYYKNPEETAAAFTDDGWFRTGDIAEWTPKGQVKIIDRKKNLVKTLNGEYIALEKLESIYRSNPYVQNICVYADENKVKPVGIVVPNLGHLSKLAIELGIMVPGEDVESYIHEKKLQDAVCKDMLSTAKSQGLNGIELLCGIVFFEEEWTPENGLVTSAQKLKRRDILAAVKPDVERVYK 691          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Match: FAA3 (Long chain fatty acyl-CoA synthetase; activates imported fatty acids with a preference for C16:0-C18:0 chain lengths; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery [Source:SGD;Acc:S000001271])

HSP 1 Score: 216.083 bits (549), Expect = 5.751e-61
Identity = 170/609 (27.91%), Postives = 286/609 (46.96%), Query Frame = 2
Query:  383 YHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTN------------KKVDFLLNSKSSMPH-LKYIVTLNDIGKD---KVQEASLKGVQFFKFSDILVAGKN--NPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAE--------EMKIIKPTILFAVPRILNRIYDKVMPIISQ-SPLKSYIFNLGLAAKMKEVN-RGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKYR------SVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            Y  +TY E+       G G+ K+    P    K  IF     +W+ +  GC    + +V  YDT GE    + +   +   IF D              K + FL++++   P+  +    L    KD   K++E     ++ + F +++  GK   + + L  P+ +D + I++TSG+   PKG ++TH +++S I  A    +V  +    +  LSFLPL H++E +     F + G + +  G ++ L          ++   KPTI+  V  +   +   ++  IS  +P+   IF    + K K V   G + +      ++F+K++   GG+++ IM G + +S D   FF  V+  ++I GYG TET   A +  P   + G VG  V     KL DV +L    A++ +GE+ +KG    SEY+ +   ++     DGW  TGDI  WT KGQLKI+DR K++ K   GEY+A E+LE++Y  +  V  I V  D  +   V IV+P+         K R       +E+  +D      + +++ A  +   L+G E++          +PENG +T   KLKR E       E++ +Y+
Sbjct:   97 YKMMTYQELIWVMHDMGRGLAKI-GIKPNGEHKFHIFASTSHKWMKIFLGCISQGIPVVTAYDTLGESGLIHSMVETESAAIFTDNQLLAKMIVPLQSAKDIKFLIHNEPIDPNDRRQNGKLYKAAKDAINKIREVR-PDIKIYSFEEVVKIGKKSKDEVKLHPPEPKDLACIMYTSGSISAPKGVVLTHYNIVSGI--AGVGHNVFGWIGSTDRVLSFLPLAHIFELVFEFEAFYWNGILGY--GSVKTLTNTSTRNCKGDLVEFKPTIMIGVAAVWETVRKAILEKISDLTPVLQKIFWSAYSMKEKSVPCTGFLSR------MVFKKVRQATGGHLKYIMNGGSAISIDAQKFFSIVLCPMII-GYGLTETVANACVLEPDHFEYGIVGDLVGSVTAKLVDVKDLGYY-AKNNQGELLLKGAPVCSEYYKNPIETAVSFTYDGWFRTGDIVEWTPKGQLKIIDRRKNLVKTLNGEYIALEKLESVYRSNSYVKNICVYADESRVKPVGIVVPNPGPLSKFAVKLRIMKKGEDIENYIHDKALRNAVFKEMIATAKSQGLVGIELLCGIVFFDEEWTPENGFVTSAQKLKRREILAAVKSEVERVYK 691          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO46335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC0])

HSP 1 Score: 485.337 bits (1248), Expect = 4.531e-163
Identity = 261/673 (38.78%), Postives = 381/673 (56.61%), Query Frame = 2
Query:  107 LATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLN-DIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFG---NKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            LA  G +  G +++  T+P       N +   QSI +   N  R S       ++     D +T +++F  G      +PCLG++V +    Y WLTY+EV   +   G+G+ +L +     +T +G++  N IEWV +EQ C  ++ ++ PLYDT G  +C +IIN  K  ++  D   K+  LL      P LK+I+ +N D+  ++ QE    G++   FSD+   GK +P   +LPK  D + + +TSGTTG PKG +ITH + ++ +        + K G   +  ++H+S+LPL H+YERL   ++FMY GK+ FF G IR + E+++ +KPT+  +VPR+LNR+YDKVM  IS S +K ++FN  L+ K  EV R I+RKNSIWDY++F KIQ                                V+EGYGQTETT  AT+ L GD   GHVG P+P + IKL DVP+++   A+D +GE+C  G      Y  D E + + ID DGWLH+GD+G WTE G LK++DR KHIFKLAQGEY+APE++E +Y   PLV Q+FV GDS K   V +V+P+   L  W   +     +E +CN+    + I  ++SA+G++ KL  F+ VK   L     + +NGLLTPTLK KR      F    + LY
Sbjct:   19 LAGLGAVAVGSLLYMATRPSESACPVNPHK--QSIEIPGDNYARRSAMSE--ELTAYMFEDCRTTHEVFLRGARISGDKPCLGHRV-TEGGPYEWLTYNEVLNRASNVGSGLQELGSNDVEGDTFIGVYASNKIEWVLIEQACAMHAKVITPLYDTLGPDACAFIINQAKMSMVVCDA-AKIPLLLQRADQCPTLKFIIKINPDVTSEEKQEGERNGIKIISFSDVEAMGKAHPYEKKLPKPDDLAVVCYTSGTTGNPKGAMITHSNAVAMLAGLCVM--IKKCGIRVDNDDVHISYLPLAHMYERLAQLMIFMYGGKVGFFGGNIRKIMEDLQELKPTVFISVPRVLNRVYDKVMKEISSSSIKKFVFNTALSFKKAEVERNIVRKNSIWDYLVFNKIQ--------------------------------VLEGYGQTETTAAATIQLVGDHTFGHVGPPMPCTKIKLVDVPDMNYF-AKDGKGEICFYGPNVFKGYLHDPEKTREAIDEDGWLHSGDVGEWTENGTLKLIDRKKHIFKLAQGEYIAPEKIEAVYMQCPLVHQVFVYGDSRKSCIVGVVVPEETALKKWTEKNEVQGDMEALCNNEKVRKAILEEMSAMGKKEKLFSFQQVKDIYLHPDPFTVDNGLLTPTLKFKRPVIQAHFKDTFEKLY 650          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO45461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR3])

HSP 1 Score: 473.781 bits (1218), Expect = 4.479e-158
Identity = 261/642 (40.65%), Postives = 375/642 (58.41%), Query Frame = 2
Query:  203 QSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDK-VQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNK--KEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSL-VIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            QS+ +D    +R S       +      D+ T Y+ FQ G       PCLG + D     Y WL+Y+EV E +   G+ ++ L    P   T VGI  KNC+EWV  +  C  +SM+ VP+YDT G  +C +IINH   E I V  + KV F+L +   +PHLK I+ + ++ K++  ++A + G++   FS     G+ N   +  PK  D  +I +TSGTTG PKG + TH ++++ +      + VI+  N    ++H S+LPL H YER     M     +I F+ G+ +LL E+++ +KPT   +VPRI+N++YDKVM  +S+S  KS++F  GL AK  ++N+ + R N+IWD ++F+K+Q + GG V  I  G+AP+SP V+ FFR  MG   ++EGYGQTE T  A+L LP D   G VG P+  ++IKL DVPE      +D +GEVC+KG   I  Y  + E +++ +D DGWLHTGDIG+W E G LKI+DR K IFKLAQGEY+AP +LENI   SP VAQ FV G+SLK F VAI++PD   L  W         ++ +C      + +  D+  V ++ +L  FE VK   L   A S EN L+T T K+KR +  K F   I++LY 
Sbjct:   33 QSVAIDGDPVVRRSALSE--HLMATYYDDVTTAYEGFQRGCRIAGDLPCLGKRGDKIGM-YRWLSYNEVRERAHSFGSALVHL-GCHPSQRTFVGIQAKNCVEWVLTDLACQMFSMVSVPIYDTHGPDACLFIINHADVETI-VCNHTKVPFILKNIKRIPHLKCIIQIGELVKEEERKDAKVSGIELLSFSIAEEIGRKNIKVVNPPKPNDIFTICYTSGTTGTPKGAVQTHSNVIADV------SGVIRQYNTCGIDVHFSYLPLAHAYERTGVICMLQSGCRIGFYRGDPQLLFEDIQELKPTFFASVPRIMNKVYDKVMAQVSESKFKSWMFQKGLHAKKADMNKNVFRSNTIWDKVVFKKVQMLFGGRVRAITSGAAPLSPKVMTFFRCAMGDCRIMEGYGQTECTACASLQLPQDMQAGIVGPPLTCNYIKLVDVPEKSYST-KDLKGEVCIKGPNVIPRYHKNPEKTAETLDEDGWLHTGDIGMWLENGALKIIDRKKDIFKLAQGEYVAPGKLENIAQRSPFVAQAFVHGESLKTFVVAILVPDGEVLKKWAAQKNIQGDLKTLCEKEEVRQAVFEDVVRVCKEAELFSFEQVKAVHLHPEAFSVENDLMTATFKIKRPQIIKAFHDVIESLYH 662          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO45504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR2])

HSP 1 Score: 456.833 bits (1174), Expect = 2.616e-152
Identity = 243/614 (39.58%), Postives = 360/614 (58.63%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNK----KEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            D+ T+Y+ F  G+   ++ P LG +   +   Y W TYS++ E +   G+G+ +L    P   T VG++  NC EW+  +  C  +SM+ VP+YD+ G ++C YIIN  K   I V   KKV+FLL     +P LK I+ ++  G+ +  ++ + G++   F ++   G NNP      + +D  +I +TSGTTG PKG ++TH++++S +   S +  +IK   +    ++ HLS+LP  H+YER    LM M   KI  + G+   L ++ K ++PT+  AVPR+LN IYDKV+P+   S      F            R IIRK++IWD ++F+KIQ ++GGNV II  GSAP+S  V +F R VMG  + EGYG TETT   T+    D + GHVG PVP + +KL DVPE+D   A + +GE+C++GR     Y  D E + +  DS GW ++GDIG WT+ G L+I+DR KHIFKL+QGEY+AP +++N Y  S  VAQ+FV G+SLK F VA+V+PD   L  W         ++ +C +    + I  D+ A G++ KL   E VK   L     + E GLLTPTLK KR   ++FF +++  LY+
Sbjct:   19 DVNTVYEAFLRGMRMSDNGPFLGTR--QATRGYKWATYSQIHERASNFGSGLCEL-GCDPSQETFVGLWSTNCTEWLLADLACQMFSMVTVPIYDSHGSEACTYIINKAKLSTI-VCHKKKVNFLLEHAHLLPTLKSIIVISGAGEVRRDKSDILGIRIISFDEVEKIGINNPHEKVPARPEDTFTISWTSGTTGFPKGVILTHDNIISDM---SAYLFLIKQDGEELTPQDTHLSYLPPEHMYERCTQVLMMMAGAKIGLYHGKREFLMDDFKALRPTVFAAVPRLLNAIYDKVVPLRRYSLFAGNTFFFHA--------RRIIRKDTIWDRLVFKKIQDLIGGNVRIITCGSAPLSARVTSFIRCVMGCYLNEGYGSTETTAMVTMQRLKDFNTGHVGAPVPCATVKLVDVPEMDYY-ASNNQGEICIRGRNVFKGYLHDAERTEEAFDSSGWFYSGDIGEWTQDGTLRIIDRKKHIFKLSQGEYIAPAKIQNAYLRSMFVAQVFVHGNSLKSFIVAVVVPDAEVLIPWAKTHDIEGDIKQLCQNQTVRKAIHGDMIAKGKEAKLNSLEQVKGIYLHPELFTVEEGLLTPTLKTKRPALAQFFEEKLNVLYE 616          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO46361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQG4])

HSP 1 Score: 404.445 bits (1038), Expect = 4.593e-133
Identity = 220/544 (40.44%), Postives = 330/544 (60.66%), Query Frame = 2
Query:  512 WVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFV---DTNKKVDFLLNSKSSMPH---LKYIVT-LNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFAD--VIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCK-HIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            W   + GC  +SM+ VP+YD+ G  +C +II      V F+          FL   +S + H   + ++++ LN      ++     GV     SD   A +   + ++ PK+ D  ++ +TSGTTG PKG ++TH++++S + +        +I++    ++HLSFLPL+H+YER+   ++FM  GKI FF+G+I+ L ++ K ++PT+  AVPR+LNRI+DKV   I++S +K +IF + L AK +++ R I+R+++IWDY+IF KIQA+LGG V  I+ GSAP+SP V  F R VMG  V EGYGQTET    TL L  D   GHVG P P + +KL DVPE+D   A + +GE+CVKGR     Y  +  M+++++D D WL+TGDIG WT  G  ++  R +    +  +GEY+AP+++ENIY  SP VAQI+V GDS++ F VA+V+PD   L+ W         ++ +C +    + I   +  VG +++L   E V+   LCS A S +NGLLTPTLK+KR + S FF   I  LY
Sbjct:    2 WFLTDLGCQMFSMITVPIYDSHGYAACTHIIKQGMITVSFLCVLTYRLGFVFLAGLQSIVCHSSKVSFLLSALNQYDVGIIRSLVTVGVPISS-SDRSAAAR---LRIKPPKSDDLYTVCYTSGTTGTPKGAMLTHDNVISDLSAFLYVLKQVIIRYFGVDDVHLSFLPLSHMYERVNQIVIFMNGGKIGFFNGDIKKLLDDFKTLRPTVFGAVPRLLNRIHDKVTNEINKSWIKRWIFQIALNAKKRDLARKIVRRDTIWDYLIFNKIQALLGGRVWFIISGSAPLSPKVATFIRCVMGCQVQEGYGQTETVASVTLQLLDDFTAGHVGPPTPVNVVKLVDVPEMDY-WANNKQGEICVKGRNVFKGYLHNPAMTAEVLDKDRWLYTGDIGEWTTVGTRRLYTRERGACIQGNEGEYIAPQKIENIYLRSPFVAQIYVHGDSIRSFLVAVVVPDAEVLEAWAEKKGIRGDLKRLCQNKTVHQRIFESMVKVGEESQLNSLEKVRGIHLCSEAFSIDNGLLTPTLKIKRPQMSTFFRDIIDNLY 540          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Match: EDO29879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2D4])

HSP 1 Score: 256.914 bits (655), Expect = 2.805e-75
Identity = 180/600 (30.00%), Postives = 305/600 (50.83%), Query Frame = 2
Query:  377 ANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKS-SMPHLKYIVTLNDIGKDKVQE--ASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFS--------GEIRLLAE-EMKIIKPTILFAVPRILNRIYDKVMPIISQSP-LKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARD---CRGEVCVKGRMCISEYFGDREMSSK--LIDSDG--WLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKYRSVED----ICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
              Y+WLTY+EVD  +R  G G+I L  Q P  N  + +F +   +W+     C  +   +V +Y T G+++  + IN    EV FV T+  +   L + S  +  L++I+ + +  K  +    +S+K     +  + L + + N     +P  +D + I++TSG+TG+PKG +I+H ++L++  +A+  A V     +K++++ +LPL HV E +  N +  +   I + S         +I+  ++ ++ +++PT++ AVP I++RI   VM  +   P L    F      K++++ RG      + +  IF K++ +LGG V  ++ G AP+S D   F        V +GYG TET G  T+    D   G VG P+    +KL    E    + RD    RGE+ + G      Y+ + + + +   +D +G  W HTGDIG + + G LKI+DR K + KL  GEY++  ++E   +    V  + V  DSLK FCV +V+P     K +    +   D    +C++    E + +D+  VG   KL  FEI +R  L     +PE+ L+T  LKLKR   + F+   ++TLY
Sbjct:  119 GEYNWLTYAEVDSRARNLGNGLITL-GQQPRQN--IVVFAETQADWMVSALSCFGFGFPVVTIYATLGDEAVAHGINET--EVNFVITDSVLLPKLAAVSGQLTQLQHIIYMGNAKKSVLMNFPSSIKLHSMVEVEE-LGSRQGNAQSRYVPHPEDTAVIMYTSGSTGLPKGVIISHANLLAA--TAAMGARVEPSITEKDVYVGYLPLAHVLELVAENALLAHGACIGYSSPLTLSDQSSKIKKGSKGDLTVLRPTLMAAVPVIMDRIRQNVMEKVKDGPRLLQLFFTFAYNYKLQQIKRGY--DAPLLNRFIFAKLRKLLGGRVRQMLSGGAPLSSDTQYFMNVCFCCPVGQGYGLTETCGGGTICHTWDRTTGRVGPPIASCEVKLVSWEEGGYTI-RDKPFARGEIVIGGSNVTLGYYKNPQKTQEDFEVDRNGQRWFHTGDIGEFHDDGCLKIIDRKKDLVKLQSGEYVSLGKVEAALAQCQYVENVCVFADSLKTFCVCLVVPRPKQLKQLADSLQVPTDDWSAVCSNKAIREAVLKDIRIVGNSAKLEKFEIPQRMSLVLEQWTPESELVTAALKLKRKNITSFYQDTLRTLY 707          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:101166257])

HSP 1 Score: 502.286 bits (1292), Expect = 8.276e-169
Identity = 261/615 (42.44%), Postives = 373/615 (60.65%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            +D KTLY++FQ GL    + PCLG++       Y WL Y +V + +   G+G+++     P  NT  GIF +N  EW+  E  C  YSM++VPLYDT G ++  +II+  +   +  D  KK + LL +  K     LK I+ ++    +  +  +  GV+     DI   GK N   PIP   PK +D S I FTSGTTG PKG +ITHE++++ +       +     + +++ +SFLPL H++ER+V   ++    ++ F+ G+IRLL ++MK ++PTI   VPR+LNRIYDKV    ++SP + ++ N  +  K  EV  GIIRKNSIWD +IF K+Q  LGG V +++ G+AP+SP V+ F R+ +G  + EGYGQTE     T T+PGD+  GHVG+P+P +++KL DV E+    A +  GEVC+KG+     Y  D E +++ +D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+Y  S  VAQ+FV GDSL+   VAIV+PD D   G+        S+E++C +    + I  D++ +GR+  L  FE VK   L     + ENGLLTPTLK KRAE    F  +I  LY
Sbjct:   73 SDAKTLYEIFQRGLKVSGNGPCLGHR--KPGRPYQWLKYKQVSDRAEHLGSGLLQK-GLKPNTNTFFGIFAQNRPEWIIGELACYTYSMVVVPLYDTLGPEALVFIIDRAEISTVLCDDQKKAETLLQNREKGETSVLKLIIIMDSFNPELFERGAKCGVEVMSLEDIEALGKKNLQKPIP---PKPEDLSVICFTSGTTGDPKGAMITHENIVADLAGVIKIFESSFVPSTQDVSISFLPLAHMFERIVQTAVYGAGARVGFYQGDIRLLPDDMKTLQPTIFPVVPRLLNRIYDKVQSG-AKSPFQKWLLNFAVDRKYAEVQEGIIRKNSIWDKLIFNKVQESLGGRVRLMVTGAAPISPAVLKFLRAALGCQIFEGYGQTECAAACTFTMPGDATTGHVGMPLPCNYMKLADVEEMSYF-ASNGEGEVCIKGKNVFKGYLKDPERTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYVRSEAVAQVFVHGDSLQSCLVAIVVPDADVLPGFAKKLGHQGSIEELCKNSEIKKAIITDMTKLGREAGLKSFEQVKDVYLHPEMFTIENGLLTPTLKAKRAELKALFLPQIDQLY 679          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:101166257])

HSP 1 Score: 491.5 bits (1264), Expect = 1.147e-164
Identity = 256/612 (41.83%), Postives = 370/612 (60.46%), Query Frame = 2
Query:  284 TDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLD---GWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            +D KTLY++FQ GL    + PCLG++       Y WL Y +V + +   G+G+++     P  NT  GIF +N  EW+  E  C  YSM++VPLYDT G ++  +II+  +   +  D  KK + LL +  K     LK I+ ++    +  +  +  GV+     DI    +   +  Q PK +D S I FTSGTTG PKG +ITHE++++ +       +     + +++ +SFLPL H++ER+V   ++    ++ F+ G+IRLL ++MK ++PTI   VPR+LNRIYDKV    ++SP + ++ N  +  K  EV  GIIRKNSIWD +IF K+Q  LGG V +++ G+AP+SP V+ F R+ +G  + EGYGQTE     T T+PGD+  GHVG+P+P +++KL DV E+    A +  GEVC+KG+     Y  D E +++ +D DGWLHTGDIG W   G LKI+DR K+IFKLAQGEY+APE++EN+Y  S  VAQ+FV GDSL+   VAIV+PD D   G+        S+E++C +    + I  D++ +GR+  L  FE VK   L     + ENGLLTPTLK KRAE    F  +I  LY
Sbjct:   73 SDAKTLYEIFQRGLKVSGNGPCLGHR--KPGRPYQWLKYKQVSDRAEHLGSGLLQK-GLKPNTNTFFGIFAQNRPEWIIGELACYTYSMVVVPLYDTLGPEALVFIIDRAEISTVLCDDQKKAETLLQNREKGETSVLKLIIIMDSFNPELFERGAKCGVEVMSLEDIEDVLRIF-LSQQPPKPEDLSVICFTSGTTGDPKGAMITHENIVADLAGVIKIFESSFVPSTQDVSISFLPLAHMFERIVQTAVYGAGARVGFYQGDIRLLPDDMKTLQPTIFPVVPRLLNRIYDKVQSG-AKSPFQKWLLNFAVDRKYAEVQEGIIRKNSIWDKLIFNKVQESLGGRVRLMVTGAAPISPAVLKFLRAALGCQIFEGYGQTECAAACTFTMPGDATTGHVGMPLPCNYMKLADVEEMSYF-ASNGEGEVCIKGKNVFKGYLKDPERTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYVRSEAVAQVFVHGDSLQSCLVAIVVPDADVLPGFAKKLGHQGSIEELCKNSEIKKAIITDMTKLGREAGLKSFEQVKDVYLHPEMFTIENGLLTPTLKAKRAELKALFLPQIDQLY 678          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl1b (acyl-CoA synthetase long chain family member 1 [Source:NCBI gene;Acc:101156334])

HSP 1 Score: 488.034 bits (1255), Expect = 3.644e-163
Identity = 269/675 (39.85%), Postives = 388/675 (57.48%), Query Frame = 2
Query:  107 LATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPH-LKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYR-SVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            L + G + A    +  T+P    L    +   QS+ V+ ++  R S              D KT+Y+ F  G+   ++ PCLG +       Y W++Y EV + S   G+  +     S  ++  +GIF +N  EW   E  C  YS++ VPLYDT G ++  +I++      +  D   KV+ +L+  ++  H LK IV + +  +  V+     G+Q     ++   GK N   PIP   P+ +D + I FTSGTTG PKG +++H +++S+  +     +V    N  ++H+S+LPL H++ER+V   M ++ G+I FF G+IR L++++  +KPT   AVPR+LNRIYDKV      S LK ++     + K  E+ +GI+RK+SIWDY+IF+K+QA LGG V +++ G+AP+SP V+ F R  MG    EGYGQTE TG  T+T+PGD   GHVG P+P + IKL DVPE++        GEVCVKG      Y  D E +++ ID+DGW+HTGDIG W   G LKIVDR KHIFKLAQGEY+APE++ENIY+ S  VAQ+FV GDSL+   VA+V+PD   L GW       + S  ++C        I  D+  +G++  L  FE VK   L +   S ENGLLTPTLK KR E  + F  +I  LY+
Sbjct:   30 LVSVGAVAAATTYYLATRPRA--LPPVCDPHRQSVEVEGEDLARRSVLMNDGSFLTHIYDDAKTMYESFLRGIKLSQNGPCLGSR--KPKQPYEWISYGEVKKRSENLGSAFLHK-GHSKSVDPHIGIFSQNRPEWTMTELACYTYSLVSVPLYDTLGTEAIAHILDKASISTVVCDVKDKVNLILDCFNNSKHFLKTIVLMEEPSESLVERGRRAGIQILTLQEMEALGKANHQQPIP---PQPEDLAVICFTSGTTGNPKGAMLSHGNIMSNCSAFVKLTEVSCPINHTDVHISYLPLAHMFERVVQGCMLLHGGRIGFFQGDIRRLSDDLHTLKPTFFPAVPRLLNRIYDKVFGQADTS-LKRWLLQFAYSRKEAELRKGIVRKDSIWDYLIFKKVQASLGGRVRLMLTGAAPISPAVLTFLRVAMGCQFYEGYGQTECTGGCTITVPGDWSEGHVGPPLPCNIIKLMDVPEMNYYAVHG-EGEVCVKGPNVFKGYLKDPEKTAETIDADGWVHTGDIGKWLPNGTLKIVDRKKHIFKLAQGEYIAPEKIENIYTRSDAVAQLFVHGDSLQACLVAVVVPDPEFLSGWAERKLGLQGSYMELCGSKKVKAAILEDMIRLGKEGGLKSFEQVKAIYLHTELFSIENGLLTPTLKSKRNEMLQHFRSQIDELYK 694          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: ENSORLT00000030072.1 (long-chain-fatty-acid--CoA ligase 6 [Source:NCBI gene;Acc:101163681])

HSP 1 Score: 484.952 bits (1247), Expect = 1.433e-161
Identity = 258/616 (41.88%), Postives = 370/616 (60.06%), Query Frame = 2
Query:  287 DMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQS--PGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNS--KSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNN---PIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            D +T+Y++FQ GL      PCLG +  +    Y W++Y EV   +   G+G   LL+Q   P  N  +G+F +N  EW+  E  C  YSM++VPLYDT G  + ++IIN      +  D  +K   LL++  +   P L+ I+ ++     +V+++   GV      ++   G+ +   PIP   P   D S + FTSGTTG PKG ++TH ++++         D + F NK +  +SFLPL H++ERL+ ++++ + G+I F+ G+IRLL+++MK ++PTI   VPR+LNR+YDK+    + +PLK ++ N     K  EV+ GIIR +SIWD I F KIQA LGG + +I+ G+AP SP V+ F R+ +G  V E YGQTE T   T T PGD  PGHVG P+P + IKL DVPE +   ++   GEVCVKG      Y  D E +++ +D+DGWLHTGDIG W   G LKI+DR KHIFKLAQGEY++PE++ENIY  S  VAQ++V GDSL+   V IV+PD   +  W        + +D+C +    + I  DL  +G+ + L  FE VK   + +   S +NGLLTPTLK KR E  +FF Q+I  LY
Sbjct:  112 DARTMYEVFQRGLHISGDGPCLGSRQPNQP--YKWISYKEVMARAEHLGSG---LLHQGCLPNPNQFIGVFAQNRPEWIISELACYTYSMVVVPLYDTLGADAIRFIINTADISTVICDKIEKAQVLLDNVERKETPGLRRIILMDAFDPAQVEKSKNCGVHVQAMQEVEALGREHHRKPIP---PAPDDLSIVCFTSGTTGNPKGVMLTHGNVVADFSGFLKVTDKVIFPNKDDCLISFLPLAHMFERLIESVVYCHGGRIGFYQGDIRLLSDDMKALRPTIFPVVPRLLNRMYDKIFSQ-ANTPLKRWLLNFAAKRKGAEVSSGIIRSDSIWDKIFFSKIQASLGGRLRMIITGAAPTSPTVLGFLRAALGCQVYEAYGQTECTAGCTYTTPGDWTPGHVGAPLPCNLIKLVDVPEKNYFASKG-EGEVCVKGPNVFKGYLKDPERTAETLDADGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYISPEKIENIYIRSEPVAQLYVHGDSLQSCLVGIVVPDPEIMPDWAKKKGILGTYKDLCKNTELKKAILEDLVRLGKASGLHSFEQVKNIYIHNEMFSIQNGLLTPTLKAKRPELKEFFKQKIDQLY 717          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Match: acsl1b (acyl-CoA synthetase long chain family member 1 [Source:NCBI gene;Acc:101156334])

HSP 1 Score: 478.789 bits (1231), Expect = 1.097e-159
Identity = 263/672 (39.14%), Postives = 383/672 (56.99%), Query Frame = 2
Query:  107 LATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPH-LKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPD---LDGWKTVDAKYR-SVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            L + G + A    +  T+P    L    +   QS+ V+ ++  R S              D KT+Y+ F  G+   ++ PCLG +       Y W++Y EV + S   G+  +     S  ++  +GIF +N  EW   E  C  YS++ VPLYDT G ++  +I++      +  D   KV+ +L+  ++  H LK IV + +  +  V+     G+Q     +           ++ P+ +D + I FTSGTTG PKG +++H +++S+  +     +V    N  ++H+S+LPL H++ER+V   M ++ G+I FF G+IR L++++  +KPT   AVPR+LNRIYDKV      S LK ++     + K  E+ +GI+RK+SIWDY+IF+K+QA LGG V +++ G+AP+SP V+ F R  MG    EGYGQTE TG  T+T+PGD   GHVG P+P + IKL DVPE++        GEVCVKG      Y  D E +++ ID+DGW+HTGDIG W   G LKIVDR KHIFKLAQGEY+APE++ENIY+ S  VAQ+FV GDSL+   VA+V+PD   L GW       + S  ++C        I  D+  +G++  L  FE VK   L +   S ENGLLTPTLK KR E  + F  +I  LY+
Sbjct:   30 LVSVGAVAAATTYYLATRPRA--LPPVCDPHRQSVEVEGEDLARRSVLMNDGSFLTHIYDDAKTMYESFLRGIKLSQNGPCLGSR--KPKQPYEWISYGEVKKRSENLGSAFLHK-GHSKSVDPHIGIFSQNRPEWTMTELACYTYSLVSVPLYDTLGTEAIAHILDKASISTVVCDVKDKVNLILDCFNNSKHFLKTIVLMEEPSESLVERGRRAGIQILTLQE-----------MEPPQPEDLAVICFTSGTTGNPKGAMLSHGNIMSNCSAFVKLTEVSCPINHTDVHISYLPLAHMFERVVQGCMLLHGGRIGFFQGDIRRLSDDLHTLKPTFFPAVPRLLNRIYDKVFGQADTS-LKRWLLQFAYSRKEAELRKGIVRKDSIWDYLIFKKVQASLGGRVRLMLTGAAPISPAVLTFLRVAMGCQFYEGYGQTECTGGCTITVPGDWSEGHVGPPLPCNIIKLMDVPEMNYYAVHG-EGEVCVKGPNVFKGYLKDPEKTAETIDADGWVHTGDIGKWLPNGTLKIVDRKKHIFKLAQGEYIAPEKIENIYTRSDAVAQLFVHGDSLQACLVAVVVPDPEFLSGWAERKLGLQGSYMELCGSKKVKAAILEDMIRLGKEGGLKSFEQVKAIYLHTELFSIENGLLTPTLKSKRNEMLQHFRSQIDELYK 683          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000024739.1 (SMESG000024739.1)

HSP 1 Score: 1400.57 bits (3624), Expect = 0.000e+0
Identity = 677/680 (99.56%), Postives = 677/680 (99.56%), Query Frame = 2
Query:   68 MFDINDCQSLALKLATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ 2107
            MFDINDCQSLALKLATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDIL  GKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIK LYQ
Sbjct:    1 MFDINDCQSLALKLATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVVDAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILATGKNNPIPLQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTILFAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKILYQ 680          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000081754.1 (SMESG000081754.1)

HSP 1 Score: 214.157 bits (544), Expect = 2.487e-59
Identity = 183/625 (29.28%), Postives = 295/625 (47.20%), Query Frame = 2
Query:  371 SAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGL---NTKVGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLND-IGKDK--VQEASLKG------------VQFFKFSDILVAGKNNPIP--LQLPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVI-KFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKI----------IKPTILFAVPRILNRIYDKVM-PIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIWDYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDC--RGEVCVKGRMCISEYFGDREMSSKLI--DSDG--WLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIP------DLDGWKTVDAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMSPENGLLTPTLKLKRAEASKFFAQEIKTLYQ*E 2113
            +   Y+W T+ E DE        +I L     GL     KV I+ +   EW+ V Q   + ++++  LY T GE++  + IN  +  +I+  +++ +  + +  +S P +K IV ++  I KD+  ++   LK             +   K  DI    K+  +      P     + I++TSG+TG+PKG  IT  ++++S+       DV+ KF  ++EI++S+LPL HV E LV  L+ +  G    +S  + L     KI          ++PT++  VP IL RI   V   +  Q P    +F      K K + RG    +   D I+FR+I+ +LGG V+ ++ G AP+S +  NF  ++    +++GYG TET    ++    D   GH G P+    IKL D  E           RGEV + G      Y+   E + +    D  G  W  TGDIG+ ++ G L IVDR K + KL  GEY++  ++E   S SP+V  + V  DS + F +  + P       L     +D     +E +C D    + + +D+S +  + K+  FEI ++  L     +P++GL+T  LKLKR E    F   I   Y  E
Sbjct:  115 TLGKYYWETFKETDERINNVAKAMINL-----GLVPTKDKVVIYSETQAEWMIVAQASFKSNIIITTLYATLGEEAIVHGINESEASLIYT-SHELLPKIASVITSCPLIKTIVFMDQKIFKDRNAMEMEELKHKIKSKLPSNVTLMTLSKLEDIGAESKDEILKNLSNKPTKDSLAVIMYTSGSTGLPKGVKITQGNIVASMAG---MKDVLPKFNVEEEIYISYLPLAHVME-LVCELLLVTMGIKLGYSSPLTLTDTSSKIKSKTKGDISVLRPTLMVCVPTILERITKAVWDKVTDQGPFFLELFKWAYDYKRKRLGRGY--PSVFMDRIVFRRIKKLLGGRVQFMLSGGAPLSEEAQNFV-NICFCPIVQGYGLTETCAGGSIMNMYDLRTGHGGPPITSLQIKLRDWAEGGYSPQDKPYPRGEVLIGGGNVALGYYKQPEKTEECFFEDESGTRWFCTGDIGMISKDGCLSIVDRKKDLVKLQGGEYVSLGKVELAISKSPVVESVCVYADSSESFSICFISPKQKQLIQLAEKCGIDCSSNDLEVLCKDKKIIDAVTKDISQICIEKKIERFEIPQKVFLDPKPWTPDSGLVTDALKLKRREIKYKFQDVIDRFYNRE 726          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 188.348 bits (477), Expect = 1.240e-50
Identity = 157/624 (25.16%), Postives = 298/624 (47.76%), Query Frame = 2
Query:  344 PCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTK--VGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLN-DIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQ--DPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRL---LAEEMKIIKPTILFAVPRILNRIYDKVMPIISQS-PLKSYIF----NLGLAAKMKEVNRGIIRKNS-IWDYIIFRKIQAILGGNVEIIMV-GSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLEN-IYSLSPLVAQIFVTGDSLKDFCVAIVIP---DLDGWKTVD----AKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTA--------------MSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            P L YK D        +T  +  E  ++  +  IKL     GL+ K  VGI   N   W   + G      ++  +Y T+    C++I+N   C++I V+ + +++ +L+    +P LK I+    D+  +   + S+    + +F ++  A   + +  +L + Q  D + +++TSGTTG PKG +++H++M+ ++  A     +  F N     +S+LPL+H+   L   +  +  G   +F+    L   L + +K ++PT+   VPR+  +I +++  I S++  +K YI     N+G    + ++    + K+  +  Y++F KI+  LG +  I +   +AP++   +++F S +   + + YG +E TGP T+ +      G  G  + G  +K+ +  E ++       GE+C++GR     Y+ + E + + IDSDGWLH+GD+G   +   L I  R K +   A GE +AP  +E+ I    P ++ + + GD  K     + +    D+D  +  +    A  RS++DI    +  + +E  L       K    E +K+   CS +               S   G L PT+K+KR    + +++ + ++Y
Sbjct:   60 PVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKL-----GLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSV---ISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNI-------GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIG---IEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 664          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 187.963 bits (476), Expect = 1.887e-50
Identity = 157/624 (25.16%), Postives = 298/624 (47.76%), Query Frame = 2
Query:  344 PCLGYKVDSSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTK--VGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLN-DIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQ--DPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRL---LAEEMKIIKPTILFAVPRILNRIYDKVMPIISQS-PLKSYIF----NLGLAAKMKEVNRGIIRKNS-IWDYIIFRKIQAILGGNVEIIMV-GSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLEN-IYSLSPLVAQIFVTGDSLKDFCVAIVIP---DLDGWKTVD----AKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTA--------------MSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            P L YK D        +T  +  E  ++  +  IKL     GL+ K  VGI   N   W   + G      ++  +Y T+    C++I+N   C++I V+ + +++ +L+    +P LK I+    D+  +   + S+    + +F ++  A   + +  +L + Q  D + +++TSGTTG PKG +++H++M+ ++  A     +  F N     +S+LPL+H+   L   +  +  G   +F+    L   L + +K ++PT+   VPR+  +I +++  I S++  +K YI     N+G    + ++    + K+  +  Y++F KI+  LG +  I +   +AP++   +++F S +   + + YG +E TGP T+ +      G  G  + G  +K+ +  E ++       GE+C++GR     Y+ + E + + IDSDGWLH+GD+G   +   L I  R K +   A GE +AP  +E+ I    P ++ + + GD  K     + +    D+D  +  +    A  RS++DI    +  + +E  L       K    E +K+   CS +               S   G L PT+K+KR    + +++ + ++Y
Sbjct:   74 PVLKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKL-----GLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSV---ISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNI-------GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIG---IEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 678          
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 183.726 bits (465), Expect = 1.777e-49
Identity = 150/598 (25.08%), Postives = 289/598 (48.33%), Query Frame = 2
Query:  422 RQTGAGIIKLLNQSPGLNTK--VGIFMKNCIEWVYVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLNSKSSMPHLKYIVTLN-DIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQLPKAQ--DPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKKEIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRL---LAEEMKIIKPTILFAVPRILNRIYDKVMPIISQS-PLKSYIF----NLGLAAKMKEVNRGIIRKNS-IWDYIIFRKIQAILGGNVEIIMV-GSAPVSPDVVNFFRSVMGSLVIEGYGQTETTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVKGRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFKLAQGEYLAPERLEN-IYSLSPLVAQIFVTGDSLKDFCVAIVIP---DLDGWKTVD----AKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTA--------------MSPENGLLTPTLKLKRAEASKFFAQEIKTLY 2104
            ++  +  IKL     GL+ K  VGI   N   W   + G      ++  +Y T+    C++I+N   C++I V+ + +++ +L+    +P LK I+    D+  +   + S+    + +F ++  A   + +  +L + Q  D + +++TSGTTG PKG +++H++M+ ++  A     +  F N     +S+LPL+H+   L   +  +  G   +F+    L   L + +K ++PT+   VPR+  +I +++  I S++  +K YI     N+G    + ++    + K+  +  Y++F KI+  LG +  I +   +AP++   +++F S +   + + YG +E TGP T+ +      G  G  + G  +K+ +  E ++       GE+C++GR     Y+ + E + + IDSDGWLH+GD+G   +   L I  R K +   A GE +AP  +E+ I    P ++ + + GD  K     + +    D+D  +  +    A  RS++DI    +  + +E  L       K    E +K+   CS +               S   G L PT+K+KR    + +++ + ++Y
Sbjct:    9 QKAASNFIKL-----GLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSV---ISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLS-LDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNI-------GEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDI---GIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 587          
The following BLAST results are available for this feature:
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSL53.086e-16643.06acyl-CoA synthetase long chain family member 5 [So... [more]
ACSL53.086e-16643.06acyl-CoA synthetase long chain family member 5 [So... [more]
ACSL53.086e-16643.06acyl-CoA synthetase long chain family member 5 [So... [more]
ACSL52.487e-16543.06acyl-CoA synthetase long chain family member 5 [So... [more]
ACSL65.776e-16039.29acyl-CoA synthetase long chain family member 6 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-53.226e-14837.13Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-137.336e-13838.54Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-131.331e-13738.54Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-133.941e-13738.54Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-31.788e-11533.54Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG39612.671e-16439.74gene:FBgn0036821 transcript:FBtr0302322[more]
CG39613.935e-16439.74gene:FBgn0036821 transcript:FBtr0333712[more]
CG39611.746e-16339.74gene:FBgn0036821 transcript:FBtr0075077[more]
CG39611.746e-16339.74gene:FBgn0036821 transcript:FBtr0075078[more]
Acsl1.760e-6929.17gene:FBgn0263120 transcript:FBtr0088701[more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsl59.595e-16842.93acyl-CoA synthetase long chain family member 5 [So... [more]
acsl59.595e-16842.93acyl-CoA synthetase long chain family member 5 [So... [more]
acsl59.595e-16842.93acyl-CoA synthetase long chain family member 5 [So... [more]
acsl59.595e-16842.93acyl-CoA synthetase long chain family member 5 [So... [more]
acsl1a1.399e-15738.79acyl-CoA synthetase long chain family member 1a [S... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qtrt21.703e-16440.12queuine tRNA-ribosyltransferase accessory subunit ... [more]
qtrt24.114e-16441.90queuine tRNA-ribosyltransferase accessory subunit ... [more]
qtrt21.318e-16339.58queuine tRNA-ribosyltransferase accessory subunit ... [more]
qtrt21.939e-16239.76queuine tRNA-ribosyltransferase accessory subunit ... [more]
qtrt22.619e-16238.57queuine tRNA-ribosyltransferase accessory subunit ... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acsl53.044e-17043.18acyl-CoA synthetase long-chain family member 5 [So... [more]
Acsl15.577e-16038.56acyl-CoA synthetase long-chain family member 1 [So... [more]
Acsl15.577e-16038.56acyl-CoA synthetase long-chain family member 1 [So... [more]
Acsl19.657e-16038.56acyl-CoA synthetase long-chain family member 1 [So... [more]
Acsl61.385e-15739.53acyl-CoA synthetase long-chain family member 6 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8JZR0|ACSL5_MOUSE2.129e-16943.18Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculu... [more]
sp|O88813|ACSL5_RAT1.348e-16842.21Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norv... [more]
sp|Q9ULC5|ACSL5_HUMAN1.482e-16543.06Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapien... [more]
sp|Q9JID6|ACSL1_CAVPO2.389e-16240.27Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porce... [more]
sp|Q9UKU0|ACSL6_HUMAN2.774e-15939.29Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapien... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9LHV81.307e-17442.15AMP-binding domain-containing protein OS=Biomphala... [more]
A0A4D5RU115.446e-17440.99Putative long chain fatty acid coa ligase (Fragmen... [more]
A0A1Z5L6081.335e-17340.99Sodium-solute symporter (Fragment) OS=Ornithodoros... [more]
A0A2R5L9Z62.470e-17340.84Putative long chain fatty acid coa ligase (Fragmen... [more]
A0A1Z5L3773.103e-17340.8430S ribosomal protein S12 (Fragment) OS=Ornithodor... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsl52.479e-16842.93acyl-CoA synthetase long chain family member 5 [So... [more]
acsl51.033e-16542.81acyl-CoA synthetase long chain family member 5 [So... [more]
ENSAMXT00000010887.28.132e-16340.38pep primary_assembly:Astyanax_mexicanus-2.0:14:290... [more]
acsl22.226e-16238.36long-chain-fatty-acid--CoA ligase 6 [Source:NCBI g... [more]
acsl1a8.863e-15637.45long-chain-fatty-acid--CoA ligase 1 [Source:NCBI g... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSL17.558e-15741.00acyl-CoA synthetase long chain family member 1 [So... [more]
ACSL12.129e-13244.91acyl-CoA synthetase long chain family member 1 [So... [more]
acsbg23.214e-5527.37acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsl3b3.187e-3228.37acyl-CoA synthetase long chain family member 3b [S... [more]
ENSPMAT00000005646.11.497e-2432.58pep scaffold:Pmarinus_7.0:GL484188:1842:9754:1 gen... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FAA27.589e-8630.95Medium chain fatty acyl-CoA synthetase; activates ... [more]
FAA11.925e-6727.21Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA48.773e-6428.34Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA35.751e-6127.91Long chain fatty acyl-CoA synthetase; activates im... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO463354.531e-16338.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454614.479e-15840.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455042.616e-15239.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463614.593e-13340.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298792.805e-7530.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsl58.276e-16942.44acyl-CoA synthetase long chain family member 5 [So... [more]
acsl51.147e-16441.83acyl-CoA synthetase long chain family member 5 [So... [more]
acsl1b3.644e-16339.85acyl-CoA synthetase long chain family member 1 [So... [more]
ENSORLT00000030072.11.433e-16141.88long-chain-fatty-acid--CoA ligase 6 [Source:NCBI g... [more]
acsl1b1.097e-15939.14acyl-CoA synthetase long chain family member 1 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024739.10.000e+099.56SMESG000024739.1[more]
SMESG000081754.12.487e-5929.28SMESG000081754.1[more]
SMESG000027204.11.240e-5025.16SMESG000027204.1[more]
SMESG000027204.11.887e-5025.16SMESG000027204.1[more]
SMESG000027204.11.777e-4925.08SMESG000027204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005508 ID=SMED30005508|Name=Long-chain-fatty-acid--CoA ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=2206bp
CAGTTTTTAAATATTTTAAATTTAGTTTGTATTATTTTTGCAGTTTAACT
GATTTTATTGGTCACAAATGTTTGACATAAATGATTGTCAGTCTCTTGCA
TTAAAACTAGCTACTACGGGACTGATTGTTGCAGGTGGAGTCATGTGGTC
AATGACTAAACCTCCTGGACCAATGTTAATGAAAAACGCTAATTATGATT
GTCAATCTATCGTTGTTGATGCTAAGAATTCAATTCGATCATCTCAATTT
CCTACAATCCCTCCGGTGAGCAGGGGTAAATGCACTGACATGAAAACTCT
GTATGATTTGTTTCAATGTGGCCTAATTCACGGGGAACATGAGCCATGCC
TTGGTTACAAAGTGGATAGTTCAGCCGCTAATTATCACTGGCTGACATAT
AGTGAAGTCGACGAAAATTCTCGACAAACTGGAGCTGGCATAATAAAGCT
TTTGAATCAATCTCCAGGATTAAATACAAAAGTCGGAATATTCATGAAGA
ATTGCATTGAATGGGTTTATGTTGAACAAGGCTGTACGAGATATTCCATG
CTGCTTGTGCCATTGTACGATACCAGCGGGGAGCAATCCTGCCAGTATAT
AATAAATCATGTGAAATGTGAAGTAATATTTGTGGACACGAACAAAAAAG
TTGATTTCCTTTTAAATTCAAAGTCATCTATGCCTCATTTGAAATACATA
GTAACACTGAATGATATTGGGAAAGATAAAGTTCAAGAAGCTTCACTAAA
AGGAGTGCAATTTTTTAAATTTTCAGATATATTGGTAGCTGGCAAAAATA
ATCCAATTCCATTGCAGTTGCCTAAAGCGCAAGATCCGAGCTCGATTTTG
TTCACAAGTGGAACAACAGGAATTCCCAAGGGCTGCTTAATAACGCACGA
ATCAATGTTGTCTAGCATTGGCTCAGCGTCAACTTTTGCTGATGTCATAA
AATTCGGCAATAAAAAGGAAATTCATTTGTCGTTTTTACCACTGACTCAT
GTTTATGAGAGATTAGTCCACAACCTTATGTTTATGTACACCGGGAAAAT
TGCATTTTTCTCTGGTGAAATTCGTCTTTTGGCTGAGGAAATGAAAATTA
TAAAACCGACAATTTTATTTGCTGTTCCGCGCATTCTCAATCGGATCTAT
GACAAAGTGATGCCGATAATTTCACAGAGCCCTCTAAAATCATATATTTT
CAATCTGGGTTTGGCGGCTAAAATGAAGGAAGTAAACCGGGGAATCATCA
GAAAAAACAGCATATGGGATTATATTATTTTCAGAAAGATCCAAGCCATT
CTCGGAGGGAATGTGGAGATAATTATGGTAGGCAGTGCACCGGTGTCCCC
TGATGTTGTTAACTTTTTCCGTTCGGTTATGGGTAGCTTGGTCATCGAGG
GCTATGGACAAACCGAAACCACTGGACCTGCTACATTGACTCTTCCAGGT
GATTCTGATCCTGGTCATGTTGGAATTCCAGTTCCGGGATCTTTTATAAA
GCTTTGCGACGTCCCTGAACTTGACTTAGTCGTTGCCAGGGACTGTAGGG
GAGAAGTTTGCGTAAAAGGCAGGATGTGCATCAGTGAATACTTTGGTGAC
CGGGAAATGTCGAGTAAATTAATTGATTCAGACGGATGGTTGCATACCGG
TGACATTGGGTTGTGGACTGAGAAAGGTCAATTGAAAATTGTCGACCGCT
GCAAGCACATATTCAAGCTAGCACAAGGAGAATATTTAGCCCCGGAACGA
TTGGAGAATATCTACAGTCTCAGTCCGTTAGTTGCACAGATATTTGTCAC
TGGAGACAGCTTGAAAGATTTCTGCGTTGCGATTGTTATTCCTGATCTCG
ACGGGTGGAAGACTGTCGATGCTAAATATAGGTCAGTTGAAGACATTTGC
AATGATCCCGTGGCAACAGAAATCATTGAAAGGGATCTCAGCGCAGTTGG
GAGGCAGAATAAGCTTATGGGATTTGAGATCGTTAAACGAGCCCGACTCT
GCTCGACAGCTATGTCACCGGAAAATGGCCTCCTTACTCCAACATTGAAA
TTGAAACGCGCTGAAGCCTCGAAATTCTTTGCTCAGGAAATCAAAACATT
ATATCAATGAGAAATACCCGGCTATCCGAGTGGCTCATTTCCTGTTAAAT
ACCAATTGATGGATTCTGTGAATTTTTCTTTAATAAATATATTTTCTAGC
ATCGGA
back to top

protein sequence of SMED30005508-orf-1

>SMED30005508-orf-1 ID=SMED30005508-orf-1|Name=SMED30005508-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=681bp
MFDINDCQSLALKLATTGLIVAGGVMWSMTKPPGPMLMKNANYDCQSIVV
DAKNSIRSSQFPTIPPVSRGKCTDMKTLYDLFQCGLIHGEHEPCLGYKVD
SSAANYHWLTYSEVDENSRQTGAGIIKLLNQSPGLNTKVGIFMKNCIEWV
YVEQGCTRYSMLLVPLYDTSGEQSCQYIINHVKCEVIFVDTNKKVDFLLN
SKSSMPHLKYIVTLNDIGKDKVQEASLKGVQFFKFSDILVAGKNNPIPLQ
LPKAQDPSSILFTSGTTGIPKGCLITHESMLSSIGSASTFADVIKFGNKK
EIHLSFLPLTHVYERLVHNLMFMYTGKIAFFSGEIRLLAEEMKIIKPTIL
FAVPRILNRIYDKVMPIISQSPLKSYIFNLGLAAKMKEVNRGIIRKNSIW
DYIIFRKIQAILGGNVEIIMVGSAPVSPDVVNFFRSVMGSLVIEGYGQTE
TTGPATLTLPGDSDPGHVGIPVPGSFIKLCDVPELDLVVARDCRGEVCVK
GRMCISEYFGDREMSSKLIDSDGWLHTGDIGLWTEKGQLKIVDRCKHIFK
LAQGEYLAPERLENIYSLSPLVAQIFVTGDSLKDFCVAIVIPDLDGWKTV
DAKYRSVEDICNDPVATEIIERDLSAVGRQNKLMGFEIVKRARLCSTAMS
PENGLLTPTLKLKRAEASKFFAQEIKTLYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR000873AMP-dep_Synth/Lig
IPR020845AMP-binding_CS
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0001676long-chain fatty acid metabolic process
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:2001236regulation of extrinsic apoptotic signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0000166nucleotide binding
GO:0004467long-chain fatty acid-CoA ligase activity
GO:0005524ATP binding
GO:0016874ligase activity
GO:0102391decanoate--CoA ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0005743mitochondrial inner membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 400..542
e-value: 2.6E-33
score: 117.3
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 85..393
e-value: 2.0E-38
score: 134.1
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 104..551
e-value: 2.8E-84
score: 283.2
NoneNo IPR availablePANTHERPTHR43272FAMILY NOT NAMEDcoord: 19..679
NoneNo IPR availablePANTHERPTHR43272:SF28LONG-CHAIN-FATTY-ACID--COA LIGASE 1coord: 19..679
NoneNo IPR availableCDDcd05927LC-FACS_eukcoord: 106..679
e-value: 0.0
score: 646.966
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 75..675
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 260..271