Glutamate receptor ionotropic, NMDA 3A

Overview
NameGlutamate receptor ionotropic, NMDA 3A
Smed IDSMED30005496
Length (bp)3281
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor ionotropic, NMDA 3A (SMED30005496) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 3A (SMED30005496) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor ionotropic, NMDA 3A (SMED30005496) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor ionotropic, NMDA 3A (SMED30005496) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005496

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30005496h1SMcG0014484 Contig55294newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005496h1SMcG0014484 Contig55294uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30005496h1SMcG0014484 dd_Smed_v4_16599_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:HGNC Symbol;Acc:HGNC:16767])

HSP 1 Score: 118.242 bits (295), Expect = 3.478e-26
Identity = 99/374 (26.47%), Postives = 167/374 (44.65%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICYYYRDGKFRAAMKTKLEGISIQ--------LRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE I + ++ DF      +    + K         +++  T+  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + AV + LYEW SPFGL P GR R+  +S +SAL   +A+LFG T+  K PK W  + L N WA  C+  ++ YTANL            ++GI    + +  +  +F    ++  E    Q        +R  N +  + + +  +K+D E    F        I +K  L+     ++ CK + +   +   G+  G  P SPL   IS+L+  Y++ GFMD+L   + +  P C     +       GI++ SG F+ +
Sbjct:  576 CYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMA-VTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYN-VPATPDGVEYLKNDPEKLDAF--------IMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLHDKWYRVVP-CGKRSFAVTETLQMGIKHFSGLFVLL 938          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN3B (glutamate ionotropic receptor NMDA type subunit 3B [Source:HGNC Symbol;Acc:HGNC:16768])

HSP 1 Score: 93.9745 bits (232), Expect = 1.041e-18
Identity = 83/374 (22.19%), Postives = 158/374 (42.25%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQ-------NDICYYYRDGKFR----------AAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + +    DF      +    +++         ++++  +  A + S  I+   +  +D T PF      +M    D    +GA   P  +  W+ +     + A+ + +YEW SP+GL P GR R+  +S +SAL   +A+LF  T+ +K PK    ++L N WA  C+++++ YTANL   + G          +D   ++    FR          A +K     +   +R  +         ++  D  +     ++K++         L+     ++ CK + +   +   G+  G    SPL   +S+ +  Y++ GF+DLL   + K  P C   + +        I + +G F+ +
Sbjct:  476 CYGYCIDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMA-VTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAFIMDKSL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKMVP-CGKRVFAVTETLQMSIYHFAGLFVLL 838          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN2B (glutamate ionotropic receptor NMDA type subunit 2B [Source:HGNC Symbol;Acc:HGNC:4586])

HSP 1 Score: 74.7146 bits (182), Expect = 1.041e-12
Identity = 105/461 (22.78%), Postives = 200/461 (43.38%), Query Frame = 3
Query:  657 TQIRHQLKKCQEFSVPMIMLLCDLDLAVKILNFSSDFHTKTMQYIMNPFTNLLLTDISSSVVESPDNLLKISKNT-GLGIQFAKREFMMETAPRASIISVIELILRFTAMSKNWKNCYCLSKRR-----LIAKYLSSLFFEDGSLKQGEVSFYRLSKNITKFQKNGENHFIEAGYFSKCRTWKINNSE--NYIHPLSLCDNLPEMENXXXXXXXXXXXXEYHESLLW-VNNQSDTEADNFRPMMHQVVCHELYHSHNHF----CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIK-TASEMISNTSIQAL---IFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMI-CIIATVCAVAMALYEWHSPFGLN---PWGRQRN-INYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            ++I++QLKK Q    P+I+L C  + A  I   ++        Y      +L+  D  +   E P  L+ +S +    G+    R+ +      AS     +++   + + +   +CY   ++R     ++ +YL ++ FE  +L   E   Y++   +     N E  +   G       WK  + +   Y+ P  +C   PE E ++     I  L E    ++  V+  S T   N  P   ++V          +    C G  + +L+ I K +   + LY+ T       I  T + MI    ++     + S+ I+   +  +D + PF     +VM   S+      A   PF+  VW+M+  ++  V AVA+ ++E+ SP G N     GR+    ++++  A+  +W ++F +++  + PK    K++ + WA   ++ +A YTANL  F+
Sbjct:  214 SKIQNQLKKLQS---PIILLYCTKEEATYIFEVANSVGLTGYGYTW-IVPSLVAGDTDTVPAEFPTGLISVSYDEWDYGLPARVRDGIAIITTAAS-----DMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSE-DGYQMHPKLVIILLNKERKWERVG------KWKDKSLQMKYYVWP-RMC---PETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQKRIVTENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFM 654          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4584])

HSP 1 Score: 71.2478 bits (173), Expect = 9.008e-12
Identity = 54/199 (27.14%), Postives = 96/199 (48.24%), Query Frame = 3
Query: 1404 FCSGLLVHLLETIG----KHLDIDFLYVYTENVPISSIKTASEMISNT-SIQA--LIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFG---LNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            FC  LL+ L  T+      HL  D  +   E V  S+ K  + M+    S QA  ++  + I+     +++ ++PF +    ++      +  L +  +PF   +W+++ +   V AV + L +  SPFG   +N    + +   +L+SA+   W +L    I   AP+S+  ++L   WA   ++IVA YTANL  F+
Sbjct:  479 FCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA-LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFL 676          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Match: GRIN1 (glutamate ionotropic receptor NMDA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4584])

HSP 1 Score: 71.2478 bits (173), Expect = 9.233e-12
Identity = 54/199 (27.14%), Postives = 96/199 (48.24%), Query Frame = 3
Query: 1404 FCSGLLVHLLETIG----KHLDIDFLYVYTENVPISSIKTASEMISNT-SIQA--LIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFG---LNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            FC  LL+ L  T+      HL  D  +   E V  S+ K  + M+    S QA  ++  + I+     +++ ++PF +    ++      +  L +  +PF   +W+++ +   V AV + L +  SPFG   +N    + +   +L+SA+   W +L    I   AP+S+  ++L   WA   ++IVA YTANL  F+
Sbjct:  479 FCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA-LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFL 676          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 63.5438 bits (153), Expect = 8.488e-10
Identity = 53/205 (25.85%), Postives = 92/205 (44.88%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLY----VYTENVPISSIKTASEMISN---TSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIAT-VCAVAMALYEWHSPFGLN----PWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQ 1985
            CSG  V LL  +    DI F Y    V  E   + +    + +I++         + S+K++      +D + PF     +++  +        A   PF +  W++I  +   V A+++ L+EW SP+  N    P    +   +SL  +   VWA LF  ++ T  PKS   +++   WA   +  +A+YTANL  F+   +Q
Sbjct:  517 CSGYCVDLLNKLAN--DIGFTYTLYKVRDEKWGLKTENGWNGLIADLMHNKADMCVTSLKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYSFNMQKYPPPEHK---FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQ 716          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-2 (NMDA class glutamate Receptor [Source:UniProtKB/TrEMBL;Acc:E0AHC1])

HSP 1 Score: 59.6918 bits (143), Expect = 7.521e-9
Identity = 40/150 (26.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query: 1551 IFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIAT-VCAVAMALYEWHSPFGLN----PWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQ 1985
            + S+K++      +D + PF     +++  +        A   PF +  W++I  +   V A+++ L+EW SP+  N    P    +   +SL  +   VWA LF  ++ T  PKS   +++   WA   +  +A+YTANL  F+   +Q
Sbjct:    9 VTSLKLNSERARDIDFSLPFLDTGISIIVKIRSGVLSPTAFLEPFEYSTWVIILFVCIHVAAISIFLFEWVSPYSFNMQKYPPPEHK---FSLFRSYWLVWATLFSASVSTDVPKSTVSRLMALVWAAFGLTFLAVYTANLAAFMITRVQ 155          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 53.5286 bits (127), Expect = 9.035e-7
Identity = 52/230 (22.61%), Postives = 92/230 (40.00%), Query Frame = 3
Query: 1383 LYHSHNHFC-SGLLVHLLE---------------TIGKHLDIDFLYVY-TENVPISSIKTASEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFG----------------LNPW-GRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            L +S  +FC +GL + LL                T   HL+  +  V  +E   I+      E+  +T+  A I  + I+      +D TEP+ +    ++         + +  +P    +W  + I   +  +A+   ++ SPF                    W G+  + N +   A+  VW +L    +  K P+S   +VL   W   C+++VA YTANL  F+
Sbjct:  448 LENSTEYFCCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGVVQASETTGITISGVIGELDGDTADMA-IGGITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFL 676          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Match: nmr-1 (NMDA class glutamate Receptor; NMDA-type ionotropic glutamate receptor NMR-1 [Source:UniProtKB/TrEMBL;Acc:G5EGQ9])

HSP 1 Score: 53.5286 bits (127), Expect = 9.035e-7
Identity = 52/230 (22.61%), Postives = 92/230 (40.00%), Query Frame = 3
Query: 1383 LYHSHNHFC-SGLLVHLLE---------------TIGKHLDIDFLYVY-TENVPISSIKTASEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFG----------------LNPW-GRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            L +S  +FC +GL + LL                T   HL+  +  V  +E   I+      E+  +T+  A I  + I+      +D TEP+ +    ++         + +  +P    +W  + I   +  +A+   ++ SPF                    W G+  + N +   A+  VW +L    +  K P+S   +VL   W   C+++VA YTANL  F+
Sbjct:  448 LENSTEYFCCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGVVQASETTGITISGVIGELDGDTADMA-IGGITINPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYCLDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFL 676          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091453)

HSP 1 Score: 77.411 bits (189), Expect = 4.879e-14
Identity = 53/201 (26.37%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS-----EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLG--AAFRPFTFFVWIMICIIATVCAVAMA-LYEWHSPFGLNPWGRQRNIN-----YSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            CSG  + LLE   + L   +  V  E+    +++          + N     ++ S+ I+      +D +EPF  +E  +   ++    ++   A   PF    W+++ I+A   A  M  L+EW SP G +     +N N     +SL      VWA+LF   +H  +P+ +  + + N WA   +V +A+YTANL  F+
Sbjct:  382 CSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPF--METGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFM 580          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301842)

HSP 1 Score: 77.411 bits (189), Expect = 4.879e-14
Identity = 53/201 (26.37%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS-----EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLG--AAFRPFTFFVWIMICIIATVCAVAMA-LYEWHSPFGLNPWGRQRNIN-----YSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            CSG  + LLE   + L   +  V  E+    +++          + N     ++ S+ I+      +D +EPF  +E  +   ++    ++   A   PF    W+++ I+A   A  M  L+EW SP G +     +N N     +SL      VWA+LF   +H  +P+ +  + + N WA   +V +A+YTANL  F+
Sbjct:  382 CSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPF--METGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFM 580          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0091454)

HSP 1 Score: 77.411 bits (189), Expect = 4.879e-14
Identity = 53/201 (26.37%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS-----EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLG--AAFRPFTFFVWIMICIIATVCAVAMA-LYEWHSPFGLNPWGRQRNIN-----YSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            CSG  + LLE   + L   +  V  E+    +++          + N     ++ S+ I+      +D +EPF  +E  +   ++    ++   A   PF    W+++ I+A   A  M  L+EW SP G +     +N N     +SL      VWA+LF   +H  +P+ +  + + N WA   +V +A+YTANL  F+
Sbjct:  382 CSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPF--METGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFM 580          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0339592)

HSP 1 Score: 77.411 bits (189), Expect = 5.288e-14
Identity = 53/201 (26.37%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS-----EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLG--AAFRPFTFFVWIMICIIATVCAVAMA-LYEWHSPFGLNPWGRQRNIN-----YSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            CSG  + LLE   + L   +  V  E+    +++          + N     ++ S+ I+      +D +EPF  +E  +   ++    ++   A   PF    W+++ I+A   A  M  L+EW SP G +     +N N     +SL      VWA+LF   +H  +P+ +  + + N WA   +V +A+YTANL  F+
Sbjct:  563 CSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPF--METGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFM 761          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Match: Nmdar2 (gene:FBgn0053513 transcript:FBtr0301844)

HSP 1 Score: 77.411 bits (189), Expect = 5.308e-14
Identity = 53/201 (26.37%), Postives = 92/201 (45.77%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS-----EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLG--AAFRPFTFFVWIMICIIATVCAVAMA-LYEWHSPFGLNPWGRQRNIN-----YSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            CSG  + LLE   + L   +  V  E+    +++          + N     ++ S+ I+      +D +EPF  +E  +   ++    ++   A   PF    W+++ I+A   A  M  L+EW SP G +     +N N     +SL      VWA+LF   +H  +P+ +  + + N WA   +V +A+YTANL  F+
Sbjct:  563 CSGFCIDLLEKFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPF--METGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLYLQNTNVTPYRFSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFM 761          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 114.39 bits (285), Expect = 3.018e-25
Identity = 91/368 (24.73%), Postives = 159/368 (43.21%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGK-FRAA----------MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + ++ +F      +    ++K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW SPFG+ P GR R   +S +SAL   +A+LFG T+ +K PK W  + L N WA  C+++++ YTANL   + G    +      D K FR            MK     +   +R  N          +  D  +     ++K +         L+     ++ CK + +   +   G+  G    SPL   IS+ +  Y++ G+MD+L   + K  P C   + +       GI + SG F+ +
Sbjct:  366 CYGYCIDLLEKLSEDMNFEFDLYIVGDGKYGAVKGGQWTGLVGDLLSGVADMA-VTSFSINSARSKVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHGRNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKGFRFGTVRESSAEDYMKKSFPEMHEYMRKFNEPTTPDGVATLKTDPPQLDAFIMDKAL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFVSRYKSDGYMDMLHDKWYKVVP-CGKRVFAVTETLQMGIRHFSGLFVLL 722          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 112.464 bits (280), Expect = 9.304e-25
Identity = 91/374 (24.33%), Postives = 163/374 (43.58%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICY---YYRDGKFRAA-----MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + ++ +F      +    ++K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW SPFG+ P GR R   +S +SAL   +A+LFG T+ +K PK W  + L N WA  C+++++ YTANL            ++GI    + +    +R G  R +     MK     +   +R  N          +  D  +     ++K +         L+     ++ CK + +   +   G+  G    SPL   IS+ +  Y++ G+MD+L   + K  P C   + +       GI + SG F+ +
Sbjct:  364 CYGYCIDLLEKLSEDMNFEFDLYIVGDGKYGAVKGGQWTGLVGDLLSGVADMA-VTSFSINSARSKVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHGRNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKLHHPSQGFRFGTVRESSAEDYMKKSFPEMHEYMRKFNEPTTPDGVATLKTDPPQLDAFIMDKAL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFVSRYKSDGYMDMLHDKWYKVVP-CGKRVFAVTETLQMGIRHFSGLFVLL 726          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 109.768 bits (273), Expect = 1.050e-23
Identity = 88/374 (23.53%), Postives = 162/374 (43.32%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAG------------ILQNDICYYYRDGKFRAA-----MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + +  +F      +    + K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW+SPFG+ P GR R   +S +SAL   +A+LFG T+ +K PK W  + L N WA  C+++++ YTANL   + G            +  +     +R G  R +     +K     +   +R  N          +  D  +     ++K +         L+     ++ CK + +   +   G+  G    SPL + +S+ +  Y++ G+MD+L   + K  P C   + +       GI++ SG F+ +
Sbjct:  558 CYGYCIDLLEKLAEDMHFEFDLYIVGDGKYGAWKGGRWSGLVGDLLSGVADMA-VTSFSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFITLYEWNSPFGMTPHGRNRIRVFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDVKLHHPSLGFRFGTVRESSAEDYVKKSFPEMHEYMRRFNKPTTPDGVSTLKTDPPQLDAFIMDKAL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTRNVSEYVSRYKSDGYMDMLHDKWYKVVP-CGKRVFAVTETLQMGIQHFSGLFVLL 920          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3a (glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [Source:ZFIN;Acc:ZDB-GENE-130530-780])

HSP 1 Score: 109.383 bits (272), Expect = 1.058e-23
Identity = 95/374 (25.40%), Postives = 153/374 (40.91%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGI--------LQNDICYY----YRDGKFRAA-----MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + +  DF      +    + K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   V AV + LYEW SPFG+ P GR R+  +S +SAL   +A+LFG T   K PK W  + L N WA  C+  ++ YTANL   + G         + +   ++    +R G  R +     +K     +   +R  N    + + I  +KDD +    F        I +KN                 PL  N                 IS+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ +
Sbjct:  588 CYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLA-VTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPT-TPDGIDHLKDDPQKLDAF--------IMDKNS----------------PLTSN-----------------ISELVSQYKSDGFMDMLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVML 917          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Match: grin3a (glutamate receptor, ionotropic, N-methyl-D-aspartate 3A [Source:ZFIN;Acc:ZDB-GENE-130530-780])

HSP 1 Score: 109.383 bits (272), Expect = 1.164e-23
Identity = 95/374 (25.40%), Postives = 153/374 (40.91%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGI--------LQNDICYY----YRDGKFRAA-----MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + +  DF      +    + K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   V AV + LYEW SPFG+ P GR R+  +S +SAL   +A+LFG T   K PK W  + L N WA  C+  ++ YTANL   + G         + +   ++    +R G  R +     +K     +   +R  N    + + I  +KDD +    F        I +KN                 PL  N                 IS+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ +
Sbjct:  578 CYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLA-VTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPT-TPDGIDHLKDDPQKLDAF--------IMDKNS----------------PLTSN-----------------ISELVSQYKSDGFMDMLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVML 907          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: nup155 (nucleoporin 155kDa [Source:Xenbase;Acc:XB-GENE-973827])

HSP 1 Score: 115.931 bits (289), Expect = 1.939e-25
Identity = 100/374 (26.74%), Postives = 166/374 (44.39%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAG--------ILQNDICYY----YRDGKFRAA-----MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + ++ DF      +    + K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW SPFGL P GR R+  +S +SAL   +A+LFG T   K PK W  + L N WA  C+  ++ YTANL   + G         + +   ++    +R G  R +     +K     +   +R  N  + +S  +  +K+D EA   F        I +K  L+     ++ CK + +   +   G+  G  P SPL   IS+L+  Y++ GFMD L   + K  P C     +       GI + SG F+ +
Sbjct:  588 CYGYCIDLLEKLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGAAHLA-VTSFSINTARSQVIDFTSPFFSTSLGILVRTKDTAAPIGAFMWPLHWTMWLGIFVSLHITAIFLTLYEWKSPFGLTPNGRNRSKVFSFSSALNVCYAILFGRTAAIKTPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPS-TSEGVTFLKNDPEALDAF--------IMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELVSQYKSSGFMDSLHDKWYKVVP-CGKRSFAVTETLQMGITHFSGLFVML 950          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN3B (glutamate receptor, ionotropic, N-methyl-D-aspartate 3B [Source:NCBI gene;Acc:100497172])

HSP 1 Score: 110.923 bits (276), Expect = 5.147e-24
Identity = 100/374 (26.74%), Postives = 157/374 (41.98%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYV-----YTENVPISSIKTASEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRA---AMKTKLEGISIQLRHMNCLNLSSNSII--------------IVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + L  DF LY+     Y             +++S  +  A + S  I+   +  +D T PF      ++  + D    +GA   P  + +W+ I +   + A+ +  YEW SPFG+ P GR R   +S +SAL   +A+LFG T+ +K PK    +VL N WA  C+++++ YTANL   + G           D  F A       KL   S   R       S+   I               V    +   L    T+   I +K  L+     +S CK + +   +   G+  G    SPL   IS+ +  Y++ GFMD L   + K  P C   + +       GI + SG F+ +
Sbjct:  482 CYGYCIDLLEKLSEDLRFDFELYIVGDGKYGARKGDRWTGLVGDLLSGAAHMA-VTSFSINSARSTVIDFTSPFYSTSLGILVRMRDTASPIGAFMWPLHWSMWVGIFVALHITALFLTFYEWKSPFGMTPHGRNRTKIFSYSSALNLCYAILFGRTVSSKTPKCCTGRVLMNLWAIFCLLVLSSYTANLAAVMVG-----------DKTFEALSGIHDPKLHHPSQGFRFGTVWESSAEQYIKKSFPEMHNYMRKFSVPATSDGVHLTDPPTLNAFIMDKALLDYEVSIDSDCKLLTIGKPFAIEGYGIGLPQNSPLTSNISEFISRYKSSGFMDTLHDKWYKMVP-CGKRVYAVTETLQMGIYHFSGLFVLL 842          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 75.485 bits (184), Expect = 4.883e-13
Identity = 100/476 (21.01%), Postives = 203/476 (42.65%), Query Frame = 3
Query:  651 NSTQIRHQLKKCQEFSVPMIMLLCDLDLAVKILNFSSDFHTKTMQYIMNPFTNLLLTDISSSVVESPDNLLKISKNTGLGIQFAKREFMMETAPRASI----ISVIELILRFTAMSKNWKNCYCLSKRR-----LIAKYLSSLFFEDGSLKQGEVSFYRLSKNITKFQKNGENHFIEAGYFSKCRTWKINNSENYIHPL-SLCDNLPEMENXXXXXXXXXXXXEYHESLLWVNNQSDTEADNFRP-----MMHQVVCHELYHSHNHF----------CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA-----SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMI-CIIATVCAVAMALYEWHSPFGLN---PWGRQRN-INYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            N ++I++QLKK Q    P+I+L C  + A  I   +         Y      +L+  D  +   E P  L+ +S        + + ++ +    R  I     +   ++    ++ ++  +CY + + R     ++ +YL ++ FE  +L   E   Y++   +     N +  +   G + K R+ K+   + Y+ P+  L  N  E +++             H S++ +        ++  P     M + V C +   + N            C G  + +L+ I K +   + LY+ T       I         E+++  +  A + S+ I+   +  +D + PF     +VM   S+      A   PF+  VW+M+  ++  V AVA+ ++E+ SP G N     GR+    ++++  A+  +W ++F +++  + PK    K++ + WA   ++ +A YTANL  F+
Sbjct:  207 NDSKIQNQLKKLQS---PVILLYCTKEEATYIFEVAHSVGLTGYGYTW-IVPSLVAGDTDTVPAEFPTGLISVS--------YDEWDYDLPARVRDGIAIITTAASTMLSEHNSIPQSKSSCYNIQESRVYEAHMLKRYLINVTFEGRNLSFSEDG-YQMHPKLVIILLNQQRKWERVGKY-KDRSLKM---KYYVWPVFELYPNSEEHKDE-------------HLSIVTLEEAPFVIVEDVDPLSGTCMRNTVPCRKQIRTENRTEEGGNYIKRCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVTKRAYMA-VGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFM 651          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2B (glutamate receptor, ionotropic, N-methyl D-aspartate 2B [Source:NCBI gene;Acc:100490580])

HSP 1 Score: 75.485 bits (184), Expect = 5.042e-13
Identity = 100/476 (21.01%), Postives = 203/476 (42.65%), Query Frame = 3
Query:  651 NSTQIRHQLKKCQEFSVPMIMLLCDLDLAVKILNFSSDFHTKTMQYIMNPFTNLLLTDISSSVVESPDNLLKISKNTGLGIQFAKREFMMETAPRASI----ISVIELILRFTAMSKNWKNCYCLSKRR-----LIAKYLSSLFFEDGSLKQGEVSFYRLSKNITKFQKNGENHFIEAGYFSKCRTWKINNSENYIHPL-SLCDNLPEMENXXXXXXXXXXXXEYHESLLWVNNQSDTEADNFRP-----MMHQVVCHELYHSHNHF----------CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA-----SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMI-CIIATVCAVAMALYEWHSPFGLN---PWGRQRN-INYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            N ++I++QLKK Q    P+I+L C  + A  I   +         Y      +L+  D  +   E P  L+ +S        + + ++ +    R  I     +   ++    ++ ++  +CY + + R     ++ +YL ++ FE  +L   E   Y++   +     N +  +   G + K R+ K+   + Y+ P+  L  N  E +++             H S++ +        ++  P     M + V C +   + N            C G  + +L+ I K +   + LY+ T       I         E+++  +  A + S+ I+   +  +D + PF     +VM   S+      A   PF+  VW+M+  ++  V AVA+ ++E+ SP G N     GR+    ++++  A+  +W ++F +++  + PK    K++ + WA   ++ +A YTANL  F+
Sbjct:  197 NDSKIQNQLKKLQS---PVILLYCTKEEATYIFEVAHSVGLTGYGYTW-IVPSLVAGDTDTVPAEFPTGLISVS--------YDEWDYDLPARVRDGIAIITTAASTMLSEHNSIPQSKSSCYNIQESRVYEAHMLKRYLINVTFEGRNLSFSEDG-YQMHPKLVIILLNQQRKWERVGKY-KDRSLKM---KYYVWPVFELYPNSEEHKDE-------------HLSIVTLEEAPFVIVEDVDPLSGTCMRNTVPCRKQIRTENRTEEGGNYIKRCCKGFCIDILKKIAKTVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVTKRAYMA-VGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFM 641          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Match: GRIN2A (glutamate receptor, ionotropic, N-methyl D-aspartate 2A [Source:NCBI gene;Acc:100489006])

HSP 1 Score: 71.2478 bits (173), Expect = 8.548e-12
Identity = 51/204 (25.00%), Postives = 99/204 (48.53%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA-----SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMI-CIIATVCAVAMALYEWHSPFGLNPWGRQRNI---------NYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            C G  + +L+ + K +   + LY+ T       IK        E++   ++ A + S+ I+   +  +D + PF     +VM   S+      A   PF+  VW+M+  ++  V AVA+ ++E+ SP G N     RN+         ++++  A+  +W ++F +++  + PK    K++ + WA   ++ +A YTANL  F+
Sbjct:  316 CKGFCIDILKKLSKTVKFTYDLYLVTNGKHGKKIKNVWNGMIGEVVYKRAVMA-VGSLTINEERSEAVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVSAVAVFVFEYFSPVGYN-----RNLADGKAPHGPSFTIGKAVWLLWGLVFNNSVPVQNPKGTTSKIIVSIWAFFAVIFLASYTANLAAFM 513          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3a (glutamate receptor ionotropic, NMDA3A [Source:MGI Symbol;Acc:MGI:1933206])

HSP 1 Score: 119.013 bits (297), Expect = 1.277e-26
Identity = 99/374 (26.47%), Postives = 167/374 (44.65%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICYYYRDGKFRAAMKTKLEGISIQ--------LRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + ++ DF      +    + K         +++S T+  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW SPFG+ P GR RN  +S +SAL   +A+LFG T   K PK W  + L N WA  C+  ++ YTANL            ++GI    + +  +  +F    ++  E    Q        +R  N +  + + +  +K+D E    F        I +K  L+     ++ CK + +   +   G+  G  P SPL   IS+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ +
Sbjct:  576 CYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMA-VTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYN-VPATPDGVQYLKNDPEKLDAF--------IMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVLL 938          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3a (glutamate receptor ionotropic, NMDA3A [Source:MGI Symbol;Acc:MGI:1933206])

HSP 1 Score: 119.013 bits (297), Expect = 1.406e-26
Identity = 99/374 (26.47%), Postives = 167/374 (44.65%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICYYYRDGKFRAAMKTKLEGISIQ--------LRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + ++ DF      +    + K         +++S T+  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW SPFG+ P GR RN  +S +SAL   +A+LFG T   K PK W  + L N WA  C+  ++ YTANL            ++GI    + +  +  +F    ++  E    Q        +R  N +  + + +  +K+D E    F        I +K  L+     ++ CK + +   +   G+  G  P SPL   IS+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ +
Sbjct:  576 CYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMA-VTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYN-VPATPDGVQYLKNDPEKLDAF--------IMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVLL 938          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 107.842 bits (268), Expect = 1.062e-23
Identity = 87/374 (23.26%), Postives = 161/374 (43.05%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQ-------NDICYYYRDGKFR----------AAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + L  DF      +    +++         ++++  +  A + S  I+   +  +D T PF      +M    D    +GA   P  + +W+ +     + A+ + LYEW SP+GL P GR R   +S +SAL   +A+LFG T+ +K PK    + L N WA  C+++++ YTANL   + G          +D   ++    FR          A +K     +   +R  +         ++  D  +     ++K++         L+     ++ CK + +   +   G+  G    SPL   +S+ +  Y++ GF+DLL   + K  P C   + +       G+ ++SG F+ +
Sbjct:  118 CYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMA-VTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKMVP-CGKRVFAVTETLQMGVYHLSGLFVLL 480          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 105.531 bits (262), Expect = 2.015e-22
Identity = 89/375 (23.73%), Postives = 164/375 (43.73%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQ-------NDICYYYRDGKFR----------AAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + L  DF LY+  +     +++         ++++  +  A + S  I+   +  +D T PF      +M    D    +GA   P  + +W+ +     + A+ + LYEW SP+GL P GR R   +S +SAL   +A+LFG T+ +K PK    + L N WA  C+++++ YTANL   + G          +D   ++    FR          A +K     +   +R  +         ++  D  +     ++K++         L+     ++ CK + +   +   G+  G    SPL   +S+ +  Y++ GF+DLL   + K  P C   + +       G+ ++SG F+ +
Sbjct:  476 CYGYCIDLLERLAEDLAFDFELYIVGDGK-YGALRDGRWTGLVGDLLAGRAHMA-VTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKMVP-CGKRVFAVTETLQMGVYHLSGLFVLL 838          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Match: Grin3b (glutamate receptor, ionotropic, NMDA3B [Source:MGI Symbol;Acc:MGI:2150393])

HSP 1 Score: 77.411 bits (189), Expect = 2.507e-14
Identity = 36/82 (43.90%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 1731 AVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAG 1976
            A+ + LYEW SP+GL P GR R   +S +SAL   +A+LFG T+ +K PK    + L N WA  C+++++ YTANL   + G
Sbjct:    7 ALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVG 88          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q9R1M7|NMD3A_RAT (Glutamate receptor ionotropic, NMDA 3A OS=Rattus norvegicus OX=10116 GN=Grin3a PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 9.246e-26
Identity = 99/374 (26.47%), Postives = 167/374 (44.65%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICYYYRDGKFRAAMKTKLEGISIQ--------LRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + ++ DF      +    + K         +++S T+  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW SPFG+ P GR RN  +S +SAL   +A+LFG T   K PK W  + L N WA  C+  ++ YTANL            ++GI    + +  +  +F    ++  E    Q        +R  N +  + + +  +K+D E    F        I +K  L+     ++ CK + +   +   G+  G  P SPL   IS+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ +
Sbjct:  576 CYGYCIDLLEQLAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLSGTANMA-VTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSALNVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYN-VPATPDGVQYLKNDPEKLDAF--------IMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVLL 938          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q8TCU5|NMD3A_HUMAN (Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens OX=9606 GN=GRIN3A PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 1.670e-25
Identity = 99/374 (26.47%), Postives = 167/374 (44.65%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICYYYRDGKFRAAMKTKLEGISIQ--------LRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE I + ++ DF      +    + K         +++  T+  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + AV + LYEW SPFGL P GR R+  +S +SAL   +A+LFG T+  K PK W  + L N WA  C+  ++ YTANL            ++GI    + +  +  +F    ++  E    Q        +R  N +  + + +  +K+D E    F        I +K  L+     ++ CK + +   +   G+  G  P SPL   IS+L+  Y++ GFMD+L   + +  P C     +       GI++ SG F+ +
Sbjct:  576 CYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMA-VTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYN-VPATPDGVEYLKNDPEKLDAF--------IMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLHDKWYRVVP-CGKRSFAVTETLQMGIKHFSGLFVLL 938          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q91ZU9|NMD3B_MOUSE (Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.410e-21
Identity = 89/375 (23.73%), Postives = 164/375 (43.73%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQ-------NDICYYYRDGKFR----------AAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + L  DF LY+  +     +++         ++++  +  A + S  I+   +  +D T PF      +M    D    +GA   P  + +W+ +     + A+ + LYEW SP+GL P GR R   +S +SAL   +A+LFG T+ +K PK    + L N WA  C+++++ YTANL   + G          +D   ++    FR          A +K     +   +R  +         ++  D  +     ++K++         L+     ++ CK + +   +   G+  G    SPL   +S+ +  Y++ GF+DLL   + K  P C   + +       G+ ++SG F+ +
Sbjct:  476 CYGYCIDLLERLAEDLAFDFELYIVGDGK-YGALRDGRWTGLVGDLLAGRAHMA-VTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKMVP-CGKRVFAVTETLQMGVYHLSGLFVLL 838          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|Q8VHN2|NMD3B_RAT (Glutamate receptor ionotropic, NMDA 3B OS=Rattus norvegicus OX=10116 GN=Grin3b PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 2.311e-21
Identity = 89/375 (23.73%), Postives = 163/375 (43.47%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQ-------NDICYYYRDGKFR----------AAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + L  DF LY+  +     +++         ++++  +  A + S  I+   +  +D T PF      +M    D    +GA   P  + +W+ +     + A+ + LYEW SP+GL P GR R   +S +SAL   +A+LFG T+ +K PK    + L N WA  C+++++ YTANL   + G          +D   ++    FR          A +K     +   +R  +         ++  D  +     ++K++         L+     ++ CK + +   +   G+  G    SPL   +S+ +  Y++ GF+DLL   + K  P C   + +       G+ + SG F+ +
Sbjct:  476 CYGYCIDLLERLAEDLAFDFELYIVGDGK-YGALRDGRWTGLVGDLLAGRAHMA-VTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKMVP-CGKRVFAVTETLQMGVYHFSGLFVLL 838          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Match: sp|O60391|NMD3B_HUMAN (Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 4.997e-18
Identity = 83/374 (22.19%), Postives = 158/374 (42.25%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQ-------NDICYYYRDGKFR----------AAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + +    DF      +    +++         ++++  +  A + S  I+   +  +D T PF      +M    D    +GA   P  +  W+ +     + A+ + +YEW SP+GL P GR R+  +S +SAL   +A+LF  T+ +K PK    ++L N WA  C+++++ YTANL   + G          +D   ++    FR          A +K     +   +R  +         ++  D  +     ++K++         L+     ++ CK + +   +   G+  G    SPL   +S+ +  Y++ GF+DLL   + K  P C   + +        I + +G F+ +
Sbjct:  476 CYGYCIDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMA-VTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAFIMDKSL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKMVP-CGKRVFAVTETLQMSIYHFAGLFVLL 838          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A210Q7T0 (Glutamate receptor ionotropic, NMDA 3A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07996 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 4.383e-52
Identity = 152/450 (33.78%), Postives = 245/450 (54.44%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI----AGILQNDICYYYRDGKFRAAM--KTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYT-NSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHK 2714
            C GL + LL  + + LD D+ LY+  +      I  +        M+ +  +    FS+    +    +D T P+ F  ++V+         + A   PF   VW+ I I AT+ A+AMAL+EW+SPFGLNPWGR+R  NY+LAS LT V+++LFGHT+ TK+PKSWP KV++NFWA ACI ++A YTANL  FI    AGI   DI Y  R    R  +   + +E I  ++ +   L L+S    + K D EA ++ +   +   +G+   LE  +   +  C+  +L   +   G+  G    SPL   +S+ +  Y  IG++D L   +   A +C    +++  ++   + + +G F+ + +G +  +++  +EH ++R +VP++R     S  KS  ++F SQRLHR++ S  L+   E+ +EMI IV+NREF K+F K  + +
Sbjct:  464 CRGLAIDLLNRLSRDLDFDYTLYIVGDVTYGKEINGSWNGMVKDLMVGSAHMAVAAFSITRKRLK--VIDFTHPYFFSGFSVLYSERKRHTRMHAFLEPFAVEVWVAIFISATIGAIAMALFEWNSPFGLNPWGRKRKQNYTLASGLTMVYSVLFGHTVRTKSPKSWPSKVMQNFWAFACIFVIASYTANLAAFIAGKHAGINYQDI-YDSRMFDIRVGVLEASAVESIVKKINYR--LFLTSQRHHVPKSD-EAIEMLIAGQLDAYLGDYPILEYARGNLDPKCQLRLLSQTFGEDGYGIGIAKDSPLKIPLSEKIKEYHEIGYIDDLIDVHFADA-ECYKQRITSEESR-LEVLHHAGLFVMLSVGIVFGIILCFVEHAIYRNLVPRFRKKSPKSCMKSSHLMFFSQRLHRILTSAELVNANESAKEMIGIVKNREFSKLFMKSTIRR 905          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A2S1WM03 (Putative ionotropic glutamate receptor NMDA-like 2 OS=Hirudo verbana OX=311461 PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 5.544e-51
Identity = 154/487 (31.62%), Postives = 254/487 (52.16%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDI--------DFLYVYTENVPISSIKTASEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDD--------EEAQKLFLNKTVQILIGEKNELENFQYT-NSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENV---SGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHKPVPSRIISPTKISVFDISSEMVKMKRRSFES 2807
            C GL + LLE + K L+         D  + + E   +       ++ +  +  A + +     + +  +D T P+ +  ++++         + A   PF  +VWI I   ATV AVA++L EW+SPFGLNPWGR+R  NY+L S L  V+A+LF HTI TK+PK+WP K L+NFWA A I I + YTANL  F+AG     +     D +     +T++ G+ I+   +       N  ++++          E    L  N T+   +G+   LE+ + T ++ C+  ++  G+    ++ G    S L  ++S  ++ YQ  G++D L   +  G+ KCS     N         N+   +G +L +  G +V +L++L+EH  F+ +VP WR+ P  S WKS S++F SQRL+R+I SE+L+ P  + REM+ +VR R+F K+F K    +   +R     + ++F++  E ++ K RS ES
Sbjct:  235 CHGLSIMLLEKLAKDLNFRLQIYFVGDSQFGHQEPPSMEWTGIVRDLTTGLA-HAAVTAFSATRLRSEEIDFTYPYFYSGFSILVSEKKRSTPIYAFMEPFDGWVWISIVCSATVVAVALSLLEWNSPFGLNPWGRRRKTNYTLGSGLNMVYAILFQHTIKTKSPKAWPSKWLQNFWAGASIFIYSSYTANLAAFLAGKNSGVVISGLDDPRL-LEPETRI-GL-IKGSAVEEFTARVNPKLLLRAQHYPANMSLENVVALLQNDTIDAFLGDTPILEHARTTLDNKCQLRLVGRGFGEDSYAIGVPKHSWLRDQLSAKIIDYQESGYLDDLMALHFSGS-KCSDNPNHNQLQGEAAPMNLDQHAGLYLLLVAGVVVCVLLMLVEHATFKWLVPYWRSKPSVSFWKSFSMMFWSQRLYRIITSEQLVSPHHSAREMMEVVRKRDFAKLFQKSVRRQETRAR----NRRNLFNV-VEQLRWKNRSLES 711          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: K1Q117 (Glutamate [NMDA] receptor subunit 3A OS=Crassostrea gigas OX=29159 GN=CGI_10021966 PE=3 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.625e-50
Identity = 170/598 (28.43%), Postives = 296/598 (49.50%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFL-YVYTENVPISSIKTASEM--ISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSD-HKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQND--ICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFL-----NKTVQILIGEKNELEN--FQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENM--HKPVPSRIISPTKISVFDISSEMVKMKRRSFESIAAFENCSNHSSLDESHSKDNAIISNMNSAPTARAPLVSIDDEDFVFT----------------PVSNKQFSDET--HSNFSSSSRYLKYKWRKKPLLKMSKDSLGSLNSFIGSTE 3101
            CSG ++ +LE +   L  D+L Y   EN   ++    S +  + N S + +  ++ +    +  L  TEP+ F  +A++    +  K  + A   PF  +VW+ I + AT  A+A +L+EW+SPFGLNPWGR+R  NY+L SAL  V+++LFGHT+ TK+PKSWP KVL+NFWA   I IVA YTANL  ++AGI + D  I  ++     +     +    +  LR +N  N    +I+I +   +  +L +     NK+ +  + ++  LE    Q+ N   K      G N        +    L + +S L+L Y   G +    + Y+K     +    S    + YG+++  G F+ +     V   +L++E  +FR +VP  R  P  S WK+ +I +++QRL+R + SE+L+ P +T +EMI IV+ R+F ++F K  +  H  +  + + P  + + DI+  +++ K+   +  A   +    +   +S+  D+    +M+      +  V+ D++D   +                P++N++ + +   H   S S + +    R  P  +   DS+ S  SF  S +
Sbjct:  426 CSGFVMDILEYLATDLAFDYLVYFRDENSHNATNLYESLLHDVRNGSAEIIAGALTVTSNRSKQLRFTEPYYFSGFAMIVPPQEASKPSMDAFTAPFDSYVWMAIFLSATTAALATSLFEWNSPFGLNPWGRKRLKNYTLGSALVMVYSVLFGHTVSTKSPKSWPAKVLQNFWAGLAIFIVASYTANLAAYLAGINRVDDMISIFHNTMNSKRVHVLRSSPAADYLRVINERN--RKNIMISEVPPDVTQLNIINNLKNKSYEYYVNDRLLLEYALAQHDNCSIKFSGNDFGEN-LYAFGLNRDAVDLTENMSSLILSYLEGGQVTEALQRYVKNR---NCVGRSERFTRKYGLDHTGGLFIILLSAMFVGAFLLVIELCVFRYLVPYLRKKPNDSLWKNRNIEYVNQRLYRTVMSEQLVSPQQTAQEMIRIVKERQFERLFLKNELSKHGRIQKKGV-PKGLRLIDITDNLIRSKKEESQIFATSSSGKIFTIQKQSYDNDDDCEDSMSDV----SDYVTGDEQDIQISFEDIENPTVLSDISEVPINNQRKASKNSPHVTRSMSEKVIGQFIRHNPRARYCSDSVYSGVSFKSSNK 1012          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: K1Q881 (Glutamate [NMDA] receptor subunit 3A OS=Crassostrea gigas OX=29159 GN=CGI_10021967 PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 5.211e-50
Identity = 139/452 (30.75%), Postives = 233/452 (51.55%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS-----EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSI----------IIVKDDEEAQKLFLNKTVQILIGEKNELENFQYT-NSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHK 2714
            C G  V LL  +   L+ +++     +      K  +       ++N      I +  I       +D + P+ F  + V+      K  + A   PF+  VW  I + A++ A+ M+++EW+SPFGLNPWGR+R  NY++ S +T V+++LFGHT+ TK+PKSWP KVL+NFWA ACI I+A YTANL  F+AG   N I Y        +   ++L  I + +   + +   +N+I           +V    +A  + +N  +   +G+   L+  +   +  C   I+P  +    +  GF   SPL K +S+ + HY   G+++ L   +     KC      N       + + SG F  + I  +  +L++L+EH++F+ ++P  R  P+ S WKS++++F SQRLHR I+S  L+   E+ +EM+ IV+N +F ++F K  + K
Sbjct:  261 CRGFAVDLLNKLASDLEFEYVLYIVHDTTYGKEKNGTWDGMMRDLTNGIAHMAIAAFSITGNRLRAIDFSYPYYFSRFTVLYTQQSQKTYMYAFLEPFSPEVWCTIFVSASLSALGMSMFEWNSPFGLNPWGRKRKQNYTIGSGMTMVYSLLFGHTVSTKSPKSWPSKVLQNFWASACIFIIASYTANLAAFLAG-KHNGIDY-------NSVFDSRLMEIRVGVLGGSAVEALTNNINKKLYQRSQHYLVPTTNDAINMLINGNIDAYLGDYPILDYARVKLDPNCNLYIVPQSFGEDEYGIGFPKDSPLQKPVSEKIKHYHESGYLENLIDIHFD-EEKC-FNQGINQQRFSLTVFHHSGLFALLSIAIVCCILLVLVEHLVFKFLLPICRGRPDDSFWKSLNVMFFSQRLHRCINSAVLVSAQESAKEMLGIVKNGDFSRLFMKSTIRK 702          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Match: A0A482X0J8 (Uncharacterized protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR006593 PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 2.179e-46
Identity = 147/471 (31.21%), Postives = 238/471 (50.53%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPIS--SIKTASEMISNTSIQALIFSMKIDFIHNP---FLDITEPFGFLEYAVMADLSDHKQLLGAAFR-PFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGI-LQNDICYYYRDGKFRAAMKT-KLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHKPVPSRIISPTKISVFDISSEMVKMKR 2792
            C GL + LLE + + L+ DF LYV  + +  S    K  + ++ +    A   S     +++P    +D + P+ F   +++A       +   AF  PF+  +WI I     V AVA+A+YEW SPFGLNPWGRQR+ N+S++SA+   W +L GH +  KAPKSWP K L N W    ++ VA YTAN+   IAG+  QN +  Y+        + T K       +   N +         V D  E  K   N T+ +LI +   L+ ++ T++ CK +      N   ++ G   G PL   IS ++  Y + G+MD+L + +  G P C          +  G+  V+G FL +G+G +V  L+LL EH+ +R  +P  R+ P+ + W+S +I+F SQ+L+R I+   L+ P    RE++  +R  +   +F K    K    R    +K   F++  E+ ++++
Sbjct:  140 CYGLTMDLLENVAEELEFDFHLYVVADGMHGSRKGAKKWNGVVGDLMSGAAHMSFAALSVNSPRSEVIDFSVPYFFSGVSLLAAPKQRTDIPLLAFLLPFSPELWIAIFTSLNVTAVAVAIYEWLSPFGLNPWGRQRSKNFSMSSAMWVCWGLLCGHLVAFKAPKSWPNKFLINVWGGFSVIFVASYTANIAALIAGLFFQNAVGDYHDRSLLSQRVATPKASAADYYIHKANQMLWDHVQKYSVTDVAEGVKHLKNGTLDVLIADTPILDYYRATDNGCKLMKFGDTINEDTYAVGMTKGFPLKDSISAVMAKYSSNGYMDILQEKWYGGLP-CFKLATEMAQPRPLGVAAVAGVFLLLGLGMVVGCLILLAEHLFYRYTLPILRHKPKGTIWRSRNIMFFSQKLYRFINCVELVSPHHAARELVHTIRQGQITSLFQKSVKRKEHEQRRRRRSKAQFFEMIQEIRRVQQ 609          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:NCBI gene;Acc:103022487])

HSP 1 Score: 115.161 bits (287), Expect = 1.547e-25
Identity = 111/405 (27.41%), Postives = 183/405 (45.19%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAG--------ILQNDICYY----YRDGKFRAAMKTKLEGISIQLRH--MNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKW 2561
            C G  + LLE + + +  DF      +    + K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   V AV + LYEW SPFG+ P GR R+  +S +SAL   +A+LFG T   K PK W  + L N WA  C+  ++ YTANL   + G         + +   ++    +R G  R +        S    H  M   N+ +    I     + QKL         I +K  L+     ++ CK++ +   +   G+  G +  SPL   IS+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ + +G  +SLL  + EHI+ R ++P+ +N P+   W
Sbjct:  585 CYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLA-VTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPKGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNVPTTPDGIDHLKADPQKL------DAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLKQNSPLTSNISELVSQYKSDGFMDMLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTIAEHIVHRWVIPRMQNKPQYQYW 981          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: GRIN3A (glutamate ionotropic receptor NMDA type subunit 3A [Source:NCBI gene;Acc:103022487])

HSP 1 Score: 115.161 bits (287), Expect = 1.550e-25
Identity = 111/405 (27.41%), Postives = 183/405 (45.19%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAG--------ILQNDICYY----YRDGKFRAAMKTKLEGISIQLRH--MNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKW 2561
            C G  + LLE + + +  DF      +    + K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   V AV + LYEW SPFG+ P GR R+  +S +SAL   +A+LFG T   K PK W  + L N WA  C+  ++ YTANL   + G         + +   ++    +R G  R +        S    H  M   N+ +    I     + QKL         I +K  L+     ++ CK++ +   +   G+  G +  SPL   IS+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ + +G  +SLL  + EHI+ R ++P+ +N P+   W
Sbjct:  606 CYGYCIDLLEKLAEDMGFDFDLYIVGDGKYGAYKNGRWTGLVGDLMSGAAHLA-VTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPKGRNRDRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNVPTTPDGIDHLKADPQKL------DAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLKQNSPLTSNISELVSQYKSDGFMDMLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVMLCVGVALSLLTTIAEHIVHRWVIPRMQNKPQYQYW 1002          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 112.079 bits (279), Expect = 1.581e-24
Identity = 91/374 (24.33%), Postives = 162/374 (43.32%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDI---CYYYRDGKFRAA-----MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + +D +F      +    + K         ++++  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW SPFG+ P GR R   +S +SAL   +A+LFG T+ +K PK W  + L N WA  C+++++ YTANL            ++GI    +    + +R G  R +     MK     +   +R  N          +  D  +     ++K +         L+     ++ CK + +   +   G+  G    SPL   IS+ +  Y++ G+MD+L   + K  P C   + +       GI + SG F+ +
Sbjct:  428 CYGYCIDLLEKLSEDMDFEFDLYIVGDGKYGAWKGGRWTGLVGDLLNGVADMA-VTSFSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPFGMTPHGRNRVRVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEELSGIHDAKLHHPSHGFRFGTVRESSAEDYMKKSFPEMHEYMRRFNEPTTPDGVATLKTDPPQLDAFIMDKAL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNISEFISRYKSDGYMDMLHDKWYKVVP-CGKRVFAVTETLQMGIRHFSGLFVLL 790          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3bb (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Bb [Source:ZFIN;Acc:ZDB-GENE-131122-77])

HSP 1 Score: 106.686 bits (265), Expect = 5.696e-23
Identity = 58/196 (29.59%), Postives = 98/196 (50.00%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAG 1976
            C G  + LLE + + +D +F      +    + K         ++++  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW SPFG+ P GR R   +S +SAL   +A+LFG T+ +K PK W  + L N WA  C+++++ YTANL   + G
Sbjct:  428 CYGYCIDLLEKLSEDMDFEFDLYIVGDGKYGAWKGGRWTGLVGDLLNGVADMA-VTSFSINSARSKVMDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWKSPFGMTPHGRNRVRVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVG 622          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Match: grin3ba (glutamate receptor, ionotropic, N-methyl-D-aspartate 3Ba [Source:ZFIN;Acc:ZDB-GENE-070912-354])

HSP 1 Score: 90.8929 bits (224), Expect = 4.109e-18
Identity = 84/374 (22.46%), Postives = 157/374 (41.98%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICYY---YRDGKFRAA-----MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + +  +F      +    + K         +++   +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   + A+ + LYEW+SPF            +S +SAL   +A+LFG T+ +K PK W  + L N WA  C+++++ YTANL            ++GI    + +    +R G  R +     MK     +   +R  N          +  D  +     ++K +         L+     ++ CK + +   +   G+  G    SPL + +S+ +  Y++ G+MD+L   + K  P C   + +       GI++ SG F+ +
Sbjct:  458 CYGYCIDLLEKLAEDMQFEFDLYIVGDGKYGAWKGGEWTGLVGDLLRGAADMA-VTSFSINSARSRVIDFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWVGIFVALHITALFLTLYEWNSPF-----------VFSYSSALNLCYAILFGRTVASKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEEVSGIHDAKLHHPSLGFRFGTVRESSAEDYMKKSFPEMHEYMRRFNKPTTPEGVSTLKTDPAQLDAFIMDKAL---------LDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTRNVSEYVSRYKSDGYMDMLHDKWYKVVP-CGKRVFAVTETLQMGIQHFSGLFVLL 809          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 5.535e-11
Identity = 54/223 (24.22%), Postives = 103/223 (46.19%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA-SEMIS---NTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIAT-VCAVAMALYEWHSPFGLNPWGRQRNIN-------YSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRAAMK 2036
            C G  + +L+ + K +   + LY+ T     S I    + MI    N      + S+ I+   +  +D + PF     +VM   S+      A   PF+  VW+M+ I+   V  +A+ ++E+ SP G N   RQ +         +++  ++  +WA++F +++  + P+    K + + WA   ++ +A YTANL  F+      D      D KF++ ++
Sbjct:  396 CKGFCIDILKKLSKTVKFTYDLYLVTNGKHGSKINGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYN---RQLSAGKEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLE 615          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000779.1 (pep scaffold:Pmarinus_7.0:GL482437:4504:14157:1 gene:ENSPMAG00000000712.1 transcript:ENSPMAT00000000779.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 3.473e-8
Identity = 45/161 (27.95%), Postives = 70/161 (43.48%), Query Frame = 3
Query: 1584 PFLDITEPF--GFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPF--GLNP------------WGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGK 2018
            P L+ T PF    L  AV A   + +  LGA   P  + VW+ + +     A+ + L+E  +P   G  P               +   ++SLA+AL   +++LFG  +   AP+ W  + L   WA  C++   +YTANL   + G    D      D K
Sbjct:  346 PPLEFTAPFLSSSLSIAV-ARRQEGRHPLGAFALPLHWTVWVGVFVALHAIALFLTLFECRTPRADGEAPVGTSGSAAAAAGTPAKARGSFSLAAALGLCYSVLFGRNVARGAPRCWSSRFLVGLWAMFCLLCFCIYTANLAAMLVGGRSRDELMGIHDPK 505          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 74.7146 bits (182), Expect = 1.594e-13
Identity = 54/213 (25.35%), Postives = 96/213 (45.07%), Query Frame = 3
Query: 1362 HQVVCHELYHSHNHFCSGLLVHLLE----TIGKHLDIDFLYVYTENVPISSIKTASEMISNTSIQA----LIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRN--INYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            H +    +  + + FC  LL+ L E    T    L  D  Y     V  S  K  + M+    IQ     ++ ++ I+     +++ ++PF +    ++   ++    L +  RPF   +W+++ +   + AV + L +  SPFG     R+       +L+SA+   W +L    I    P+S+  +VL   WA   ++IVA YTANL  F+
Sbjct:  428 HVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEV-IQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFL 639          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Match: EDO44842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE9])

HSP 1 Score: 54.6842 bits (130), Expect = 9.493e-8
Identity = 60/216 (27.78%), Postives = 103/216 (47.69%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYT--ENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAF-RPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASAL-TSVWAML---FGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDG 2015
            C GL + L++ + +  DI F+ V    +     S K         E+++  +  A+  S+ I    + F+D +EPF      ++     H    G  F +PF    W++I  +  + AV + L+E H+P GL    RQ++ NY     +  SVW M    F   ++   P+    +V+ + W+ A ++I A+YTANL  F+  +LQ+    +Y DG
Sbjct:    3 CYGLCIDLIKLLSR--DIGFIPVIETIQGGRAGSFKNGKWTGLIGEVVAGNADMAMS-SISITSQRSKFVDFSEPFIHTGSTILV-AKRHGSFKGDGFLKPFKVSAWLLIFAVLYLVAVVVLLFESHNP-GLQ---RQKHRNYRGEFDIHQSVWLMFSRFFSGILNAPIPRFVSSRVVLSSWSFATLMIDALYTANLAAFM--VLQDQA--HYIDG 206          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: GRIN3A (glutamate receptor ionotropic, NMDA 3A [Source:NCBI gene;Acc:101161818])

HSP 1 Score: 118.627 bits (296), Expect = 1.340e-26
Identity = 97/371 (26.15%), Postives = 162/371 (43.67%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICYYYRDGKFRAAMKTKLE-----GISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE +G+ +   F      +      K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   V A+ + LYEWHSPFG+ P GR RN  +S +SAL   +A+LFG T+  K PK W  ++L N WA  C+  ++ YTANL            ++GI    + +  +  +F    ++  E            +M   N+ +    I     + QKL         I +K  L+     ++ CK++ +   +   G+  G    SPL    S+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ +
Sbjct:  551 CYGYCIDLLEKLGEDMGFTFDLYIVGDGKYGGFKNGRWTGLVGDLLSGAAHLA-VTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAIFLTLYEWHSPFGMTPRGRNRNRVFSFSSALNVCYAILFGRTVAIKPPKCWTGRLLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFATVRESSAEDYVKKSFPEMHEYMRRYNVPATPDGIHNLKADPQKL------DAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLPQNSPLTSNFSELVSQYKSDGFMDMLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVML 913          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: GRIN3A (glutamate receptor ionotropic, NMDA 3A [Source:NCBI gene;Acc:101161818])

HSP 1 Score: 118.627 bits (296), Expect = 1.640e-26
Identity = 97/371 (26.15%), Postives = 162/371 (43.67%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVF---------IAGILQNDICYYYRDGKFRAAMKTKLE-----GISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE +G+ +   F      +      K         +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W+ I +   V A+ + LYEWHSPFG+ P GR RN  +S +SAL   +A+LFG T+  K PK W  ++L N WA  C+  ++ YTANL            ++GI    + +  +  +F    ++  E            +M   N+ +    I     + QKL         I +K  L+     ++ CK++ +   +   G+  G    SPL    S+L+  Y++ GFMD+L   + K  P C     +       GI++ SG F+ +
Sbjct:  610 CYGYCIDLLEKLGEDMGFTFDLYIVGDGKYGGFKNGRWTGLVGDLLSGAAHLA-VTSFSINSARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAIFLTLYEWHSPFGMTPRGRNRNRVFSFSSALNVCYAILFGRTVAIKPPKCWTGRLLMNLWAIFCLFCLSTYTANLAAVMVGEKTYEQLSGIHDPKLHHPSQGFRFATVRESSAEDYVKKSFPEMHEYMRRYNVPATPDGIHNLKADPQKL------DAFIMDKALLDYEVSIDADCKTLTVGKPFAIEGYGIGLPQNSPLTSNFSELVSQYKSDGFMDMLHDKWYKVVP-CGKRSFAVTETLQMGIKHFSGLFVML 972          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin3ba (glutamate ionotropic receptor NMDA type subunit 3B [Source:NCBI gene;Acc:101155155])

HSP 1 Score: 111.309 bits (277), Expect = 2.741e-24
Identity = 98/375 (26.13%), Postives = 171/375 (45.60%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA------SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAG--------ILQNDICYY----YRDGKFRAA-----MKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFM 2459
            C G  + LLE + + +   F LY+  +    +   T        +++S  +  A + S  I+   +  +D T PF      ++    D    +GA   P  + +W  I +   + A+ + LYEW+SPFG+ P GR R   +S +SAL   +A+LFG T+ TK PK W  + L N WA  C+++++ YTANL   + G         + ++  ++    +R G  R +     MK     +   +R  N    +   + ++K D  A   F        I +K  L+     ++ CK + +   +   G+  G   GSPL + +S+ +  Y++ GFMD+L   + K  P C   + +       GI++ SG F+ +
Sbjct:  587 CYGYCIDLLEKLAEDMGFTFDLYIVGDGKYGALSGTGRWTGLVGDLLSGAADMA-VTSFSINSARSRVIDFTSPFYSTSLGILVRSHDTAAPIGAFMWPLHWSMWAGIFVTLHLTALFLTLYEWNSPFGMTPHGRNRLRVFSYSSALNLCYAILFGRTVATKTPKCWTGRFLMNLWAIFCLLVLSSYTANLAAVMVGEKTFEQVSGIHDEKLHHPSMGFRFGTVRESSAEDYMKKSFPEMHDYMRRFNQPT-TPEGVHMLKTDPPALDAF--------IMDKALLDFEVSIDADCKLLTVGKPFAIEGYGIGLPQGSPLTRNVSEFVSRYKSDGFMDMLHDKWYKVVP-CGKRVFAVTETLQMGIQHFSGLFVLL 950          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin2bb (glutamate receptor ionotropic, NMDA 2B-like [Source:NCBI gene;Acc:101163953])

HSP 1 Score: 69.707 bits (169), Expect = 1.531e-11
Identity = 50/198 (25.25%), Postives = 98/198 (49.49%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIK-TASEMISNTSIQAL---IFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMI-CIIATVCAVAMALYEWHSPFGLNPW---GRQ-RNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            C G  + +L+ I K +   + LY+ T       +  T + M+    ++     + S+ I+   +  +D + PF     +VM   S+      A   PF+  VW+M+  ++  V AVA+ ++E+ SP G N     GR+    ++++  A+  +W ++F +++  + PK    K++ + WA   ++ +A YTANL  F+
Sbjct:  458 CKGFCIDILKKIAKAVKFTYDLYLVTNGKHGKKVNGTWNGMVGEVVLKKAHMAVGSLTINEERSEVIDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFM 655          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Match: grin2aa (glutamate ionotropic receptor NMDA type subunit 2A [Source:NCBI gene;Acc:101161811])

HSP 1 Score: 69.707 bits (169), Expect = 1.735e-11
Identity = 49/199 (24.62%), Postives = 97/199 (48.74%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDF-LYVYTENVPISSIKTA-----SEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMI-CIIATVCAVAMALYEWHSPFGLN---PWGRQ-RNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFI 1970
            C G  + +L+ I K++   + LY+ T       I         E++   ++ A + S+ I+   +  +D + PF     +VM   S+      A   PF+  VW+M+  ++  V A+A+ ++E+ SP G N     G+     ++++  A+  +W ++F +++  + PK    K + + WA   ++ +A YTANL  F+
Sbjct:  475 CKGFCIDILKKIAKYVKFTYDLYLVTNGKHGKKINNVWNGMVGEVVYKKAVMA-VGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLLVTAMAVFMFEYISPLGFNRNLAQGKDPHGPSFTMGKAVWLLWGLVFNNSVPVQNPKGTTSKFIVSVWAFFAVIFLASYTANLAAFM 672          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000008719.1 (SMESG000008719.1)

HSP 1 Score: 2066.97 bits (5354), Expect = 0.000e+0
Identity = 1057/1057 (100.00%), Postives = 1057/1057 (100.00%), Query Frame = 3
Query:   42 MIYNARSFSFSVLNLVFCFNINCHMFSRGLKSDLPNAIVINSRPGLFKEMIDIKSFRFSVRTLNMTENPLNGSSILSLLDKLYDCSTLAVIGICEKPAVSNLIQMWTEEKKIYFISYSCTVKGPFAKLENNVFQLDSGISLYSTAIANNLEINMKLFRKFGIGILVDRNSFISLELLKSLKQTMLKVFSGNAIFFTVSISGSMNSTQIRHQLKKCQEFSVPMIMLLCDLDLAVKILNFSSDFHTKTMQYIMNPFTNLLLTDISSSVVESPDNLLKISKNTGLGIQFAKREFMMETAPRASIISVIELILRFTAMSKNWKNCYCLSKRRLIAKYLSSLFFEDGSLKQGEVSFYRLSKNITKFQKNGENHFIEAGYFSKCRTWKINNSENYIHPLSLCDNLPEMENXXXXXXXXXXXXEYHESLLWVNNQSDTEADNFRPMMHQVVCHELYHSHNHFCSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTASEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHKPVPSRIISPTKISVFDISSEMVKMKRRSFESIAAFENCSNHSSLDESHSKDNAIISNMNSAPTARAPLVSIDDEDFVFTPVSNKQFSDETHSNFSSSSRYLKYKWRKKPLLKMSKDSLGSLNSFIGSTESKSKYSKNPKLFYPSLTPTHGERKQKTLLRMQCLDQD 3212
            MIYNARSFSFSVLNLVFCFNINCHMFSRGLKSDLPNAIVINSRPGLFKEMIDIKSFRFSVRTLNMTENPLNGSSILSLLDKLYDCSTLAVIGICEKPAVSNLIQMWTEEKKIYFISYSCTVKGPFAKLENNVFQLDSGISLYSTAIANNLEINMKLFRKFGIGILVDRNSFISLELLKSLKQTMLKVFSGNAIFFTVSISGSMNSTQIRHQLKKCQEFSVPMIMLLCDLDLAVKILNFSSDFHTKTMQYIMNPFTNLLLTDISSSVVESPDNLLKISKNTGLGIQFAKREFMMETAPRASIISVIELILRFTAMSKNWKNCYCLSKRRLIAKYLSSLFFEDGSLKQGEVSFYRLSKNITKFQKNGENHFIEAGYFSKCRTWKINNSENYIHPLSLCDNLPEMENKKYLRKKIRILIEYHESLLWVNNQSDTEADNFRPMMHQVVCHELYHSHNHFCSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTASEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNSFGFSFGFQPGSPLFKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGIGFLVSLLVLLLEHILFRLIVPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHKPVPSRIISPTKISVFDISSEMVKMKRRSFESIAAFENCSNHSSLDESHSKDNAIISNMNSAPTARAPLVSIDDEDFVFTPVSNKQFSDETHSNFSSSSRYLKYKWRKKPLLKMSKDSLGSLNSFIGSTESKSKYSKNPKLFYPSLTPTHGERKQKTLLRMQCLDQD
Sbjct:    1 MIYNARSFSFSVLNLVFCFNINCHMFSRGLKSDLPNAIVINSRPGLFKEMIDIKSFRFSVRTLNMTENPLNGSSILSLLDKLYDCSTLAVIGICEKPAVSNLIQMWTEEKKIYFISYSCTVKGPFAKLENNVFQLDSGISLYSTAIANNLEINMKLFRKFGIGILVDRNSFISLELLKSLKQTMLKVFSGNAIFFTVSISGSMNSTQIRHQLKKCQEFSVPMIMLLCDLDLAVKILNFSSDFHTKTMQYIMNPFTNLLLTDISSSVVESPDNLLKISKNTGLGIQFAKREFMMETAPRASIISVIELILRFTAMSKNWKNCYCLSKRRLIAKYLSSLFFEDGSLKQGEVSFYRLSKNITKFQKNGENHFIEAGYFSKCRTWKINNSENYIHPLSLCDNLPEMENKKYLRKKIRILIEYHESLLWVNNQSDTEADNFRPMMHQVVCHELYHSHNHFCSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTASEMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNSFGFSFGFQPGSPLFKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVSGCFLFMGIGFLVSLLVLLLEHILFRLIVPQWRNLPETSKWKSISILFMSQRLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHKPVPSRIISPTKISVFDISSEMVKMKRRSFESIAAFENCSNHSSLDESHSKDNAIISNMNSAPTARAPLVSIDDEDFVFTPVSNKQFSDETHSNFSSSSRYLKYKWRKKPLLKMSKDSLGSLNSFIGSTESKSKYSKNPKLFYPSLTPTHGERKQKTLLRMQCLDQD 1057          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000037019.1 (SMESG000037019.1)

HSP 1 Score: 255.373 bits (651), Expect = 4.491e-71
Identity = 173/461 (37.53%), Postives = 252/461 (54.66%), Query Frame = 3
Query: 1362 HQVVCHEL-------YHSHNHF------------------CSGLLVHLLETIGKHLDIDFLYVYTENVPISSI--KTASEMISN-----TSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVK-------DDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNK----GYGIENVSGCFLFMGXXXXXXXXXXXXXXXXXXXXXPQWRNLPETSKWKSISILFMSQRLHRVIHS 2615
            H VVC++L       +  +NH                   C G  + +L+ +   L  D  Y    N    S      + M+ N       I A  FS+ +D      +D+++PF   +  +++ + D   LLG  ++PFT  +W+ ICIIATVCAVAM ++EW+SPFGL+PWGR R+ NY+LASAL SV+A++FGHTI TKAPKSWPVK ++N WA ACIVI AMYTANLTVFIAG+      +            T++  I         ++L      +VK         ++A++LFLNKT+ I++ E   + N +   SLC+     L     G+ FGF   S +  EI   L  Y   GF DLL KS       C  + + ++ NK    GY IEN+ G F+ + +G +V+ L+L LEH+L+  I+P+W N+P+ S WKSI ++F+SQRL+R++H+
Sbjct:  390 HNVVCYDLPENDGKYFDIYNHINQLQKNTNLSKSRNFVRCCYGFSITILQKLAMDLKYDLTYYIVSNSSYGSFINNEWNGMVRNIMDGIAHIGAGAFSITVD--RTKVIDMSDPFYTSDIEILSMIKDRDSLLGVVYKPFTLELWLFICIIATVCAVAMGIFEWNSPFGLSPWGRMRHKNYTLASALNSVYAVMFGHTIKTKAPKSWPVKWVQNCWAFACIVIAAMYTANLTVFIAGV-----AHLSNTNSELNVGNTQIGIIKDSNIIQTLIDLDDKRYPVVKWNVRYLDSSKDAEELFLNKTLDIILDESLVIRNLKAKGSLCRLHTRTLNIGPIGYGFGFAKDSWIKNEIQSRLRIYSDFGFFDLLEKSISDSNYLCQKSKILSSDNKTDKKGYKIENLVGLFVALSVGLIVAFLILFLEHMLYWWIIPRWHNMPKESCWKSIHVMFISQRLYRIVHN 843          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 129.413 bits (324), Expect = 3.469e-30
Identity = 99/337 (29.38%), Postives = 157/337 (46.59%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS------EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRD----GKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGW-NXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKC 2384
            C G  V LL  +   +D D +    ++    S+   S      E+I   + Q +  ++ + +  N  +D T PF   ++ V+           A FRPF+  +WI+I +   V   A++ +EW SPFGLNP GR R  NY+L S +T+V+ + F  T   K+PKS+P K  +N W C CIVI +MY  N+   IA +++ ++   + D      F  A  +    ISI L     L    N I  VK + E +    NK V   + E+  L N  Y    C + +  L +     F+ G    +    E+S+ LL Y   G++  L K+ +  + +C
Sbjct:  371 CYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRA-QLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNI---IATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYL---RNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDY----CPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASREC 696          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 129.413 bits (324), Expect = 3.480e-30
Identity = 99/337 (29.38%), Postives = 157/337 (46.59%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS------EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRD----GKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGW-NXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKC 2384
            C G  V LL  +   +D D +    ++    S+   S      E+I   + Q +  ++ + +  N  +D T PF   ++ V+           A FRPF+  +WI+I +   V   A++ +EW SPFGLNP GR R  NY+L S +T+V+ + F  T   K+PKS+P K  +N W C CIVI +MY  N+   IA +++ ++   + D      F  A  +    ISI L     L    N I  VK + E +    NK V   + E+  L N  Y    C + +  L +     F+ G    +    E+S+ LL Y   G++  L K+ +  + +C
Sbjct:  366 CYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRA-QLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNI---IATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYL---RNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDY----CPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASREC 691          
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Match: SMESG000006949.1 (SMESG000006949.1)

HSP 1 Score: 129.028 bits (323), Expect = 3.528e-30
Identity = 99/337 (29.38%), Postives = 157/337 (46.59%), Query Frame = 3
Query: 1407 CSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTAS------EMISNTSIQALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTFFVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWAMLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQNDICYYYRD----GKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKLFLNKTVQILIGEKNELENFQYTNSLCKSVILPLGW-NXXXXXXXXXXXXXXXKEISQLLLHYQTIGFMDLLTKSYIKGAPKC 2384
            C G  V LL  +   +D D +    ++    S+   S      E+I   + Q +  ++ + +  N  +D T PF   ++ V+           A FRPF+  +WI+I +   V   A++ +EW SPFGLNP GR R  NY+L S +T+V+ + F  T   K+PKS+P K  +N W C CIVI +MY  N+   IA +++ ++   + D      F  A  +    ISI L     L    N I  VK + E +    NK V   + E+  L N  Y    C + +  L +     F+ G    +    E+S+ LL Y   G++  L K+ +  + +C
Sbjct:  371 CYGFSVRLLIRLMIDMDFDVVLYSIKDYKYGSLVNGSWNGLMKEIIIRRA-QLVFGTLTVTYDRNKHIDFTIPFHAGKFGVLIQDKIKSYTDDAVFRPFSTHIWILIALWCYVAGFALSSFEWLSPFGLNPKGRHRKRNYNLGSGVTAVYTLFFRKTQPFKSPKSYPAKFFQNVWTCFCIVIFSMYINNI---IATVIETNVKKTFSDLMQEPDFILASTSGTSHISIFLEKHPYL---RNKIFYVKTETEGKVALRNKQVTAFLSEELVLRNTDY----CPNRLEILNYLGVAPFAIGVPKDAWYRNELSKYLLIYDFNGYISHLLKNMMLASREC 696          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A3.478e-2626.47glutamate ionotropic receptor NMDA type subunit 3A... [more]
GRIN3B1.041e-1822.19glutamate ionotropic receptor NMDA type subunit 3B... [more]
GRIN2B1.041e-1222.78glutamate ionotropic receptor NMDA type subunit 2B... [more]
GRIN19.008e-1227.14glutamate ionotropic receptor NMDA type subunit 1 ... [more]
GRIN19.233e-1227.14glutamate ionotropic receptor NMDA type subunit 1 ... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nmr-28.488e-1025.85NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-27.521e-926.67NMDA class glutamate Receptor [Source:UniProtKB/T... [more]
nmr-19.035e-722.61NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
nmr-19.035e-722.61NMDA class glutamate Receptor; NMDA-type ionotropi... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmdar24.879e-1426.37gene:FBgn0053513 transcript:FBtr0091453[more]
Nmdar24.879e-1426.37gene:FBgn0053513 transcript:FBtr0301842[more]
Nmdar24.879e-1426.37gene:FBgn0053513 transcript:FBtr0091454[more]
Nmdar25.288e-1426.37gene:FBgn0053513 transcript:FBtr0339592[more]
Nmdar25.308e-1426.37gene:FBgn0053513 transcript:FBtr0301844[more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grin3bb3.018e-2524.73glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3bb9.304e-2524.33glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3ba1.050e-2323.53glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3a1.058e-2325.40glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3a1.164e-2325.40glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nup1551.939e-2526.74nucleoporin 155kDa [Source:Xenbase;Acc:XB-GENE-973... [more]
GRIN3B5.147e-2426.74glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
GRIN2B4.883e-1321.01glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2B5.042e-1321.01glutamate receptor, ionotropic, N-methyl D-asparta... [more]
GRIN2A8.548e-1225.00glutamate receptor, ionotropic, N-methyl D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grin3a1.277e-2626.47glutamate receptor ionotropic, NMDA3A [Source:MGI ... [more]
Grin3a1.406e-2626.47glutamate receptor ionotropic, NMDA3A [Source:MGI ... [more]
Grin3b1.062e-2323.26glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
Grin3b2.015e-2223.73glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
Grin3b2.507e-1443.90glutamate receptor, ionotropic, NMDA3B [Source:MGI... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R1M7|NMD3A_RAT9.246e-2626.47Glutamate receptor ionotropic, NMDA 3A OS=Rattus n... [more]
sp|Q8TCU5|NMD3A_HUMAN1.670e-2526.47Glutamate receptor ionotropic, NMDA 3A OS=Homo sap... [more]
sp|Q91ZU9|NMD3B_MOUSE1.410e-2123.73Glutamate receptor ionotropic, NMDA 3B OS=Mus musc... [more]
sp|Q8VHN2|NMD3B_RAT2.311e-2123.73Glutamate receptor ionotropic, NMDA 3B OS=Rattus n... [more]
sp|O60391|NMD3B_HUMAN4.997e-1822.19Glutamate receptor ionotropic, NMDA 3B OS=Homo sap... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210Q7T04.383e-5233.78Glutamate receptor ionotropic, NMDA 3A OS=Mizuhope... [more]
A0A2S1WM035.544e-5131.62Putative ionotropic glutamate receptor NMDA-like 2... [more]
K1Q1173.625e-5028.43Glutamate [NMDA] receptor subunit 3A OS=Crassostre... [more]
K1Q8815.211e-5030.75Glutamate [NMDA] receptor subunit 3A OS=Crassostre... [more]
A0A482X0J82.179e-4631.21Uncharacterized protein OS=Laodelphax striatellus ... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A1.547e-2527.41glutamate ionotropic receptor NMDA type subunit 3A... [more]
GRIN3A1.550e-2527.41glutamate ionotropic receptor NMDA type subunit 3A... [more]
grin3bb1.581e-2424.33glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3bb5.696e-2329.59glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
grin3ba4.109e-1822.46glutamate receptor, ionotropic, N-methyl-D-asparta... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010716.15.535e-1124.22pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
ENSPMAT00000000779.13.473e-827.95pep scaffold:Pmarinus_7.0:GL482437:4504:14157:1 ge... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO355451.594e-1325.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448429.493e-827.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIN3A1.340e-2626.15glutamate receptor ionotropic, NMDA 3A [Source:NCB... [more]
GRIN3A1.640e-2626.15glutamate receptor ionotropic, NMDA 3A [Source:NCB... [more]
grin3ba2.741e-2426.13glutamate ionotropic receptor NMDA type subunit 3B... [more]
grin2bb1.531e-1125.25glutamate receptor ionotropic, NMDA 2B-like [Sourc... [more]
grin2aa1.735e-1124.62glutamate ionotropic receptor NMDA type subunit 2A... [more]
back to top
BLAST of Glutamate receptor ionotropic, NMDA 3A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008719.10.000e+0100.00SMESG000008719.1[more]
SMESG000037019.14.491e-7137.53SMESG000037019.1[more]
SMESG000006949.13.469e-3029.38SMESG000006949.1[more]
SMESG000006949.13.480e-3029.38SMESG000006949.1[more]
SMESG000006949.13.528e-3029.38SMESG000006949.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005496 ID=SMED30005496|Name=Glutamate receptor ionotropic, NMDA 3A|organism=Schmidtea mediterranea sexual|type=transcript|length=3281bp
ATTAGGAAATTTAGTATGGCCAGACATTGCATGAGTTTAACATGATCTAC
AATGCTAGATCTTTCTCTTTTTCAGTGTTAAATTTGGTATTCTGTTTCAA
TATCAATTGTCACATGTTTTCGAGGGGCCTGAAATCGGATCTTCCGAACG
CTATCGTTATCAATTCCCGACCGGGATTATTTAAAGAAATGATTGACATT
AAGTCGTTCCGATTTTCCGTTCGAACGTTGAATATGACAGAAAATCCTTT
GAATGGTTCCAGTATCCTATCTTTACTGGATAAGCTTTATGACTGCTCAA
CCTTGGCTGTCATTGGCATTTGTGAAAAACCAGCCGTTTCCAATCTCATT
CAAATGTGGACTGAGGAAAAGAAAATATATTTCATTTCCTACTCTTGTAC
AGTAAAGGGGCCTTTTGCAAAGCTAGAAAACAATGTCTTCCAGTTGGATT
CTGGGATCAGCCTCTATTCAACAGCCATTGCCAATAATCTTGAAATAAAT
ATGAAACTCTTTCGAAAATTCGGTATTGGAATTTTAGTCGACAGAAACTC
ATTTATCTCTTTAGAATTACTAAAATCACTCAAACAAACAATGTTAAAAG
TATTTAGCGGAAATGCAATCTTTTTTACAGTATCTATTTCAGGTTCAATG
AACTCGACGCAAATAAGGCATCAGCTCAAAAAGTGTCAAGAATTTTCTGT
GCCTATGATTATGCTCTTGTGTGATTTGGATTTAGCTGTCAAAATACTCA
ATTTTTCGTCTGACTTTCATACAAAAACTATGCAATACATTATGAACCCG
TTCACGAATCTTCTTCTCACCGACATTAGCAGTTCGGTTGTCGAATCACC
GGACAATCTTTTGAAAATCTCCAAGAATACAGGTTTAGGAATCCAATTCG
CCAAAAGAGAGTTTATGATGGAAACTGCTCCTCGTGCTTCTATTATTAGT
GTTATTGAGTTGATTTTAAGGTTTACAGCTATGTCGAAAAATTGGAAAAA
CTGTTATTGTCTATCGAAAAGACGCTTAATCGCAAAATACTTGTCCAGTT
TATTTTTCGAAGACGGCAGCTTAAAACAGGGAGAGGTTTCGTTTTATAGG
CTCTCGAAAAATATAACAAAGTTCCAAAAGAATGGAGAAAATCATTTTAT
TGAAGCCGGGTATTTTTCTAAGTGTAGAACATGGAAAATCAACAACTCGG
AAAATTACATTCATCCGCTTAGTCTGTGCGACAATCTACCGGAAATGGAA
AATAAAAAATACTTAAGAAAGAAAATAAGAATATTAATTGAATATCATGA
GTCACTTTTGTGGGTAAATAATCAGTCAGACACAGAGGCTGACAATTTTC
GGCCGATGATGCACCAAGTCGTTTGTCATGAGCTGTATCACAGTCACAAT
CACTTTTGTTCGGGTCTTCTTGTTCATCTATTGGAAACGATTGGCAAGCA
CTTGGACATTGATTTTCTTTACGTTTACACGGAAAATGTTCCAATAAGTT
CGATAAAAACCGCGAGTGAAATGATTTCGAATACGAGTATTCAAGCGCTT
ATTTTTAGCATGAAAATTGACTTCATTCACAACCCATTTCTCGATATCAC
CGAGCCGTTTGGATTTCTTGAATATGCTGTGATGGCTGATCTCAGTGATC
ATAAACAATTATTGGGAGCAGCTTTCAGACCATTTACATTTTTTGTTTGG
ATCATGATATGTATCATTGCAACGGTTTGTGCTGTTGCGATGGCTCTTTA
TGAATGGCACAGCCCTTTTGGACTAAATCCTTGGGGAAGGCAGAGAAATA
TAAATTACTCTCTTGCAAGTGCTTTGACATCAGTCTGGGCTATGTTGTTT
GGACATACAATTCATACAAAGGCTCCTAAGTCTTGGCCAGTAAAAGTATT
GAAAAACTTTTGGGCATGCGCCTGCATTGTGATTGTTGCAATGTACACTG
CTAATCTCACAGTATTCATAGCAGGAATATTGCAAAATGACATTTGCTAT
TATTATAGGGATGGAAAATTTAGAGCAGCGATGAAAACGAAGCTGGAAGG
AATAAGCATTCAACTGCGACACATGAATTGTTTAAACCTATCGAGTAACT
CTATTATTATTGTGAAAGATGATGAAGAAGCCCAAAAATTATTTCTTAAC
AAAACAGTCCAAATATTGATAGGGGAAAAAAATGAGTTGGAGAATTTTCA
ATATACAAATTCCCTATGCAAGTCAGTGATTCTTCCATTAGGATGGAATT
CATTTGGGTTTTCTTTTGGCTTCCAGCCAGGATCACCTTTATTTAAAGAA
ATTTCTCAATTGCTTCTTCATTACCAAACAATAGGTTTTATGGATTTATT
GACGAAGTCTTACATTAAAGGAGCTCCAAAGTGCAGCCTGACAATGATGT
CAAATAACACCAACAAAGGTTACGGTATAGAAAATGTAAGTGGATGTTTC
CTATTCATGGGTATCGGATTTTTGGTGTCCCTACTTGTTTTGTTATTGGA
ACATATTTTGTTTCGCTTGATTGTTCCACAATGGAGAAATCTTCCCGAAA
CAAGCAAATGGAAAAGCATATCAATTTTATTTATGAGTCAACGACTTCAT
CGAGTTATTCACAGTGAAAGACTGATTAAACCGACAGAAACGACTCGTGA
GATGATTGCGATCGTTCGAAATCGAGAATTTCACAAAATGTTTTTCAAAG
AAAATATGCACAAACCTGTTCCATCGAGGATTATCTCTCCTACAAAGATA
TCCGTATTTGACATCAGTTCTGAAATGGTGAAAATGAAACGAAGAAGTTT
TGAATCAATCGCAGCTTTTGAGAACTGTTCCAACCATTCAAGTTTAGATG
AAAGCCATTCAAAAGACAATGCAATTATCTCCAATATGAATTCGGCTCCT
ACTGCGAGAGCTCCTTTGGTTTCAATTGATGATGAAGATTTCGTTTTTAC
TCCGGTTTCCAACAAACAATTTTCCGACGAAACCCATTCAAATTTCAGTT
CATCTTCCAGGTATTTAAAATACAAATGGCGCAAGAAACCTTTATTGAAA
ATGTCCAAAGACTCTTTGGGGTCATTAAACTCTTTTATTGGTAGCACAGA
ATCTAAATCGAAATATTCGAAAAATCCTAAACTGTTTTATCCGTCTTTGA
CACCAACTCACGGGGAAAGGAAGCAAAAAACACTATTACGAATGCAATGT
TTAGATCAAGACTGAGTTTTAAATCATTATTTTAGTAATTTTTCATGTGT
CTCTTTAAATTTTGAATACATTGAGAACAAT
back to top

protein sequence of SMED30005496-orf-1

>SMED30005496-orf-1 ID=SMED30005496-orf-1|Name=SMED30005496-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1058bp
MIYNARSFSFSVLNLVFCFNINCHMFSRGLKSDLPNAIVINSRPGLFKEM
IDIKSFRFSVRTLNMTENPLNGSSILSLLDKLYDCSTLAVIGICEKPAVS
NLIQMWTEEKKIYFISYSCTVKGPFAKLENNVFQLDSGISLYSTAIANNL
EINMKLFRKFGIGILVDRNSFISLELLKSLKQTMLKVFSGNAIFFTVSIS
GSMNSTQIRHQLKKCQEFSVPMIMLLCDLDLAVKILNFSSDFHTKTMQYI
MNPFTNLLLTDISSSVVESPDNLLKISKNTGLGIQFAKREFMMETAPRAS
IISVIELILRFTAMSKNWKNCYCLSKRRLIAKYLSSLFFEDGSLKQGEVS
FYRLSKNITKFQKNGENHFIEAGYFSKCRTWKINNSENYIHPLSLCDNLP
EMENKKYLRKKIRILIEYHESLLWVNNQSDTEADNFRPMMHQVVCHELYH
SHNHFCSGLLVHLLETIGKHLDIDFLYVYTENVPISSIKTASEMISNTSI
QALIFSMKIDFIHNPFLDITEPFGFLEYAVMADLSDHKQLLGAAFRPFTF
FVWIMICIIATVCAVAMALYEWHSPFGLNPWGRQRNINYSLASALTSVWA
MLFGHTIHTKAPKSWPVKVLKNFWACACIVIVAMYTANLTVFIAGILQND
ICYYYRDGKFRAAMKTKLEGISIQLRHMNCLNLSSNSIIIVKDDEEAQKL
FLNKTVQILIGEKNELENFQYTNSLCKSVILPLGWNSFGFSFGFQPGSPL
FKEISQLLLHYQTIGFMDLLTKSYIKGAPKCSLTMMSNNTNKGYGIENVS
GCFLFMGIGFLVSLLVLLLEHILFRLIVPQWRNLPETSKWKSISILFMSQ
RLHRVIHSERLIKPTETTREMIAIVRNREFHKMFFKENMHKPVPSRIISP
TKISVFDISSEMVKMKRRSFESIAAFENCSNHSSLDESHSKDNAIISNMN
SAPTARAPLVSIDDEDFVFTPVSNKQFSDETHSNFSSSSRYLKYKWRKKP
LLKMSKDSLGSLNSFIGSTESKSKYSKNPKLFYPSLTPTHGERKQKTLLR
MQCLDQD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 552..577
score: 34.62
coord: 799..823
score: 16.8
coord: 619..646
score: 43.21
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 456..792
e-value: 1.0E-30
score: 108.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 537..820
e-value: 1.0E-30
score: 108.7
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 527..740
e-value: 1.0E-30
score: 108.7
NoneNo IPR availablePANTHERPTHR18966:SF448coord: 522..966
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 522..966
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 449..776
NoneNo IPR availableTMHMMTMhelixcoord: 586..608
NoneNo IPR availableTMHMMTMhelixcoord: 623..645
NoneNo IPR availableTMHMMTMhelixcoord: 794..816
NoneNo IPR availableTMHMMTMhelixcoord: 551..573
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 552..810
e-value: 1.2E-14
score: 54.4