Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30005493
Uniprot Best hitKinesin-like protein KIF28P OS=Rattus norvegicus OX=10116 GN=Kif28p PE=2 SV=1 (E=5.12612e-176)
Length (bp)3133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30005493) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30005493) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein (SMED30005493) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30005493) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005493

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005493SMESG000017296.1 SmedASXL_015654SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30005493SMESG000017296.1 dd_Smed_v4_12573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005493SMESG000017296.1 dd_Smed_v6_12573_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30005493SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30005493SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30005493SMESG000017296.1 dd_Smed_v4_12573_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30005493SMESG000017296.1 dd_Smed_v4_12573_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30005493SMESG000017296.1 dd_Smed_v4_12573_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1B (kinesin family member 1B [Source:HGNC Symbol;Acc:HGNC:16636])

HSP 1 Score: 411.379 bits (1056), Expect = 1.340e-121
Identity = 277/677 (40.92%), Postives = 378/677 (55.83%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIX--XXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGM---------------------------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAIL---TRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEIL 1904
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+     K+F+FDYSYWSH +          P+ P   +ASQ +V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G   ES  GI+P +C ELF+ I    NE + Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q       N S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P  K++REL+EE  RLK  L  Q   DI    M                                  EE I+RL+             +SE I  + +E W+ K+   +A    E+ +  +++                 K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I      N+ +  V+++P        VNG R+  ++   L   +R++ G ++++ F           K P+A+  S  V DW   Q E+   +G D+K       Q +EIL
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDP--CFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLK-------------ESEKIIAELNETWEEKLRKTEAIRM-EREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIFRSERSNSGEVIVTLEPCERS-ETYVNGKRV--SQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPV-DWTFAQRELLEKQGIDMKQEMEKRLQEMEIL 642          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1A (kinesin family member 1A [Source:HGNC Symbol;Acc:HGNC:888])

HSP 1 Score: 377.481 bits (968), Expect = 3.689e-120
Identity = 204/379 (53.83%), Postives = 260/379 (68.60%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYES--NKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG-------NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  R++K II M+G TT IVNPK      K+F+FDYSYWSH +             P  I YASQ++V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G +    +GI+P +C +LF  I   +N+++ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q      T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  SG        K+  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P
Sbjct:    1 MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTS-------------PEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDP 364          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1B (kinesin family member 1B [Source:HGNC Symbol;Acc:HGNC:16636])

HSP 1 Score: 385.956 bits (990), Expect = 1.059e-115
Identity = 206/372 (55.38%), Postives = 258/372 (69.35%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+     K+F+FDYSYWSH +          P+ P   +ASQ +V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G   ES  GI+P +C ELF+ I    NE + Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q      T  S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDP--CFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDP 358          

HSP 2 Score: 56.6102 bits (135), Expect = 2.935e-7
Identity = 44/166 (26.51%), Postives = 77/166 (46.39%), Query Frame = 3
Query: 1449 KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAIL---TRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEIL 1904
            K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I      N+ +  V+++P        VNG R+  ++   L   +R++ G ++++ F           K P+A+  S  V DW   Q E+   +G D+K       Q +EIL
Sbjct:  484 KTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIFRSERSNSGEVIVTLEPCERSETY-VNGKRV--SQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPV-DWTFAQRELLEKQGIDMKQEMEKRLQEMEIL 642          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1B (kinesin family member 1B [Source:HGNC Symbol;Acc:HGNC:16636])

HSP 1 Score: 385.956 bits (990), Expect = 1.059e-115
Identity = 206/372 (55.38%), Postives = 258/372 (69.35%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+     K+F+FDYSYWSH +          P+ P   +ASQ +V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G   ES  GI+P +C ELF+ I    NE + Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q      T  S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDP--CFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDP 358          

HSP 2 Score: 56.6102 bits (135), Expect = 2.935e-7
Identity = 44/166 (26.51%), Postives = 77/166 (46.39%), Query Frame = 3
Query: 1449 KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAIL---TRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEIL 1904
            K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I      N+ +  V+++P        VNG R+  ++   L   +R++ G ++++ F           K P+A+  S  V DW   Q E+   +G D+K       Q +EIL
Sbjct:  484 KTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIFRSERSNSGEVIVTLEPCERSETY-VNGKRV--SQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPV-DWTFAQRELLEKQGIDMKQEMEKRLQEMEIL 642          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF1A (kinesin family member 1A [Source:HGNC Symbol;Acc:HGNC:888])

HSP 1 Score: 389.808 bits (1000), Expect = 2.938e-114
Identity = 258/631 (40.89%), Postives = 361/631 (57.21%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYES--NKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG-------NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTK-----GM----------------------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAIL---TRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKN 1778
            M   SVKVAVR+RPFN RE  R++K II M+G TT IVNPK      K+F+FDYSYWSH +             P  I YASQ++V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G +    +GI+P +C +LF  I   +N+++ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q      T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  SG        K+  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P  K+IREL++E  RL+  L  Q   DI        GM                            SEE I+RL+             ++E I  + +E W+ K+   +A    E+ +  +++                 K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H +    +R   +  V+++P        VNG ++   + + L   +R++ G S+++ F +
Sbjct:    1 MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTS-------------PEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNKLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLK-------------ETEKIIAELNETWEEKLRRTEAIRM-EREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDGERRQDIV---LSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEG-ADTYVNGKKV--TEPSILRSGNRIIMGKSHVFRFNH 596          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-6 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:G5EFQ4])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 351/865 (40.58%), Postives = 514/865 (59.42%), Query Frame = 3
Query:   90 ESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXX-XXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADS--TSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKI--EAA-DAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRS---------ILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPT-SDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQK 2636
            +S+ VAVR+RPFN REK RN KL+I M  + T ++     N+ K F +D+SYWSHD F    N  + P  P   YA Q++VF DLG+ VL NA  GYNCSLFAYGQTGSGKSYS++G+++NKGIVP +C ELFK I     +++++ V  SM+EIY E++RDLL      KG L +RE+   GF+V++L  VPV S++++E ++ +GT +RTIAATQMNATSSRAHT++ + FNQ        ++ K S I L+DLAGSER  +    GDRLKEG  IN+SL+ LG VI AL DS      K T IPYRDSVLT LLKNALGGNSKT+MIAA+SPADIN++ETLSTLR+ADR K IK  A+VNEN  E+ +RELREEN RL+  + G    D      S E+I++LR ++ E+ K       E+   + S  WQ KI  EAA  A    EK   ++K  K  ++ N+NEDP LT  + +FI   + +VG  P     S   +++ G  I   H  L +N     + + P S D  + +NG  +  + ET L  NDR+ FG ++LY+F NPT K     +  +E+ Q EIA      + +R          ILE +++  LP+V   NA++ E+ ++ KF+++++  + + L+    G  ++ +++ ++     +L E+S F+NR + +QEMYE   DG    N+P + DPF+EP  S + +  + V+LQ+L Y I +     ++D  G+E G +++ + PC   G  L  + +++ED  QL+ K  + K+ +   ++   R I  S  K+  +   K   T T   +  +Y   E+   +  +TK+  DY  +  +    +G Q+
Sbjct:    5 DSIIVAVRVRPFNDREKTRNCKLVIEMPDEETTVIRDPKTNDEKRFTYDHSYWSHDGFSEKKNGYLEPTDPH--YADQRRVFEDLGRGVLANAWAGYNCSLFAYGQTGSGKSYSIVGFKNNKGIVPIVCEELFKQIADNKKKNMQFEVFVSMMEIYCEKVRDLLSSTPPPKGGLKVREHPKNGFYVENLTTVPVNSFKEIEAKIEEGTKSRTIAATQMNATSSRAHTIVKITFNQKSSKQAGGTSMKKSEINLVDLAGSERQSAAGTEGDRLKEGIVINQSLTTLGRVIKALHDSQKAKSGKKTQIPYRDSVLTCLLKNALGGNSKTIMIAAISPADINFEETLSTLRFADRAKSIKTNAVVNENQTERALRELREENLRLQSQIQGGTAGD-----ASNEEIEKLRRQLAENQK-------EMEEMEKS--WQQKIAEEAAKHASGASEKVEMEAKKKKMCHLWNLNEDPALTNVIVHFIPVGESVVGNKP---TSSGNFIQMSGLSILPQHVTL-KNDGNNQIHLSPCSEDLDIFINGKPV--HGETQLQQNDRVFFGGNHLYVFNNPTKKGIRTDI-TYENAQAEIAQNHAAALGNRGLGGGSKRDLILEEELMSTLPLVQRANAMATELGRNVKFEIVLVSPEMRGLT---SGLTEIWVKVHNISEDTYFLWEKSRFMNRYYGMQEMYEAKQDGSEDWNMPKERDPFYEPPDSPVFIASSVVFLQSLAYLIDVEEQFPIVDLSGQEIGLLTVGLSPCSTTGKEL--RGEYVEDPDQLIGKNIAFKVKV-ISAVGLPRRILKSNCKYRFFGSKKMTTTATVSGNTPAY-GHEETFQFKPVTKEVADYLANSNLYITFWGTQR 839          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 366.696 bits (940), Expect = 5.723e-107
Identity = 245/642 (38.16%), Postives = 364/642 (56.70%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNK---GIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST---MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNF---DEKNSKKSK--------------------VNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP--TAKNRSNAVW------DWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            SVKVAVR+RPFNQRE    +K ++ + G TT I          +FNFD+SYWS              + P   + +Q++V+ +LG ++L +A  GYN  +FAYGQTGSGKSY+M+G  ++    GI+P +CN+LF  I++ +++ V+Y V+ S +EIY ER++DLL P  +S GNL +RE+  LG +V DL K+ V SY  +   M++G   RT+AAT MN+TSSR+H V T+   Q       N    K S I L+DLAGSERA+ST A G RLKEGA+INKSL+ LG VI+ LA+ ++  K +   +IPYRDSVLT LL+  LGGNSKT M+AALSPADIN+DETLSTLRYADR KQI   A+VNE+P  K+IREL EE          +L   +  KG+   D+Q    + ++  K+      ++   Q SE+  A+I     Q     +E   ++ +                      K P+++N+NEDP ++  L Y+++     VG+ P+   +    + + G  I E H           +++KP +S C   +NG ++     T L    R++ G  +++ + +P    ++R N         DW+  Q E+   +G D+K  + +E +++E+
Sbjct:    3 SVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWS-----------FARNDPH--FITQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNP--NSGGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVI--------KLRHILKDKGIDVTDVQETPGKHKKGPKLPAHVHEQLEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGR-PEA--EHRPDILLSGEAILELHCEFINEDGNVTLTMKPNAS-CY--INGKQV--TTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGIDLK--ADMEKKMLEM 611          

HSP 2 Score: 50.447 bits (119), Expect = 8.378e-6
Identity = 45/164 (27.44%), Postives = 75/164 (45.73%), Query Frame = 3
Query: 1908 MVFEVNAISQEMNKDKKFDVLIIPE------------QAQALSFKEEGKPKVMIRMTSVITSNT--WLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKD-----DPFWEPTSDI-LVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGV 2339
             V E NAIS E+ K  +F   ++ +              + L+ +   K  V I++  +    T  W +E+     R   +++MYE   +    D  P  D     DPF++      +VG A VYL NLL+ + + + + V++ KG  +G + + IEP  KD V
Sbjct:  710 FVKEANAISVELKKKVQFQFALLTDTMYSPLPPDLLPPGEDLTLRPYPKTVVAIQVQDLKNGATHYWSIEK--LKQRLEAMRDMYETDAEMSPADGDPMMDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPVQKDEV 871          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 366.696 bits (940), Expect = 5.723e-107
Identity = 245/642 (38.16%), Postives = 364/642 (56.70%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNK---GIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST---MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNF---DEKNSKKSK--------------------VNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP--TAKNRSNAVW------DWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            SVKVAVR+RPFNQRE    +K ++ + G TT I          +FNFD+SYWS              + P   + +Q++V+ +LG ++L +A  GYN  +FAYGQTGSGKSY+M+G  ++    GI+P +CN+LF  I++ +++ V+Y V+ S +EIY ER++DLL P  +S GNL +RE+  LG +V DL K+ V SY  +   M++G   RT+AAT MN+TSSR+H V T+   Q       N    K S I L+DLAGSERA+ST A G RLKEGA+INKSL+ LG VI+ LA+ ++  K +   +IPYRDSVLT LL+  LGGNSKT M+AALSPADIN+DETLSTLRYADR KQI   A+VNE+P  K+IREL EE          +L   +  KG+   D+Q    + ++  K+      ++   Q SE+  A+I     Q     +E   ++ +                      K P+++N+NEDP ++  L Y+++     VG+ P+   +    + + G  I E H           +++KP +S C   +NG ++     T L    R++ G  +++ + +P    ++R N         DW+  Q E+   +G D+K  + +E +++E+
Sbjct:    3 SVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWS-----------FARNDPH--FITQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNP--NSGGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVI--------KLRHILKDKGIDVTDVQETPGKHKKGPKLPAHVHEQLEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGR-PEA--EHRPDILLSGEAILELHCEFINEDGNVTLTMKPNAS-CY--INGKQV--TTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGIDLK--ADMEKKMLEM 611          

HSP 2 Score: 50.447 bits (119), Expect = 8.378e-6
Identity = 45/164 (27.44%), Postives = 75/164 (45.73%), Query Frame = 3
Query: 1908 MVFEVNAISQEMNKDKKFDVLIIPE------------QAQALSFKEEGKPKVMIRMTSVITSNT--WLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKD-----DPFWEPTSDI-LVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGV 2339
             V E NAIS E+ K  +F   ++ +              + L+ +   K  V I++  +    T  W +E+     R   +++MYE   +    D  P  D     DPF++      +VG A VYL NLL+ + + + + V++ KG  +G + + IEP  KD V
Sbjct:  710 FVKEANAISVELKKKVQFQFALLTDTMYSPLPPDLLPPGEDLTLRPYPKTVVAIQVQDLKNGATHYWSIEK--LKQRLEAMRDMYETDAEMSPADGDPMMDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPVQKDEV 871          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 366.696 bits (940), Expect = 7.034e-107
Identity = 245/642 (38.16%), Postives = 364/642 (56.70%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNK---GIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST---MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNF---DEKNSKKSK--------------------VNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP--TAKNRSNAVW------DWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            SVKVAVR+RPFNQRE    +K ++ + G TT I          +FNFD+SYWS              + P   + +Q++V+ +LG ++L +A  GYN  +FAYGQTGSGKSY+M+G  ++    GI+P +CN+LF  I++ +++ V+Y V+ S +EIY ER++DLL P  +S GNL +RE+  LG +V DL K+ V SY  +   M++G   RT+AAT MN+TSSR+H V T+   Q       N    K S I L+DLAGSERA+ST A G RLKEGA+INKSL+ LG VI+ LA+ ++  K +   +IPYRDSVLT LL+  LGGNSKT M+AALSPADIN+DETLSTLRYADR KQI   A+VNE+P  K+IREL EE          +L   +  KG+   D+Q    + ++  K+      ++   Q SE+  A+I     Q     +E   ++ +                      K P+++N+NEDP ++  L Y+++     VG+ P+   +    + + G  I E H           +++KP +S C   +NG ++     T L    R++ G  +++ + +P    ++R N         DW+  Q E+   +G D+K  + +E +++E+
Sbjct:    3 SVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWS-----------FARNDPH--FITQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNP--NSGGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVI--------KLRHILKDKGIDVTDVQETPGKHKKGPKLPAHVHEQLEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGR-PEA--EHRPDILLSGEAILELHCEFINEDGNVTLTMKPNAS-CY--INGKQV--TTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGIDLK--ADMEKKMLEM 611          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 366.696 bits (940), Expect = 7.034e-107
Identity = 245/642 (38.16%), Postives = 364/642 (56.70%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNK---GIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST---MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNF---DEKNSKKSK--------------------VNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP--TAKNRSNAVW------DWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            SVKVAVR+RPFNQRE    +K ++ + G TT I          +FNFD+SYWS              + P   + +Q++V+ +LG ++L +A  GYN  +FAYGQTGSGKSY+M+G  ++    GI+P +CN+LF  I++ +++ V+Y V+ S +EIY ER++DLL P  +S GNL +RE+  LG +V DL K+ V SY  +   M++G   RT+AAT MN+TSSR+H V T+   Q       N    K S I L+DLAGSERA+ST A G RLKEGA+INKSL+ LG VI+ LA+ ++  K +   +IPYRDSVLT LL+  LGGNSKT M+AALSPADIN+DETLSTLRYADR KQI   A+VNE+P  K+IREL EE          +L   +  KG+   D+Q    + ++  K+      ++   Q SE+  A+I     Q     +E   ++ +                      K P+++N+NEDP ++  L Y+++     VG+ P+   +    + + G  I E H           +++KP +S C   +NG ++     T L    R++ G  +++ + +P    ++R N         DW+  Q E+   +G D+K  + +E +++E+
Sbjct:    3 SVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWS-----------FARNDPH--FITQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDNNNDKDVQYSVEVSYMEIYCERVKDLLNP--NSGGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEESTKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVI--------KLRHILKDKGIDVTDVQETPGKHKKGPKLPAHVHEQLEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGR-PEA--EHRPDILLSGEAILELHCEFINEDGNVTLTMKPNAS-CY--INGKQV--TTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQPIDWKYAQQELLDKQGIDLK--ADMEKKMLEM 611          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0346959)

HSP 1 Score: 392.889 bits (1008), Expect = 8.483e-116
Identity = 261/674 (38.72%), Postives = 365/674 (54.15%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK----DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST----MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSE--EDIQRLRN-------EIEEDLKVGIQFKSEII---------NFQNSEEWQAKIEAADA------QNFDEKNSKKSKVN---------------------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP--VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-----------TAKNRSNAV-------WDWESVQTEIAAAEGFDVK 1865
            SVKVAVR+RPFN RE  R +K II MAG TT I NPK     +++VK FNFDYSYWSHD    D             +++Q  V+ D+G+++L ++ +GYN  +FAYGQTG+GKSY+M+G   E  +GI+P IC +LF  I+    + +KY V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V  Y+ +   +++G   RT+AAT MN TSSR+H V T+ F Q      T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S  K+T     IPYRDS LT LL+  LGGNSKT MIAA+SPADINYDETLSTLRYADR KQI   A+VNE                           D N K + E  E+IQ+LR+       E++E+ ++    KS +I         N   +E    +++A++       + ++EK  +  ++                            K P+++N+NEDP L+  L Y+I+     +G       ++  P  +++ G  I + H   T   K   V++ P   D ++ VNG ++   +   L    R++ G ++++ F NP           T     N V        DW   Q E+   +G D+K
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNE---------------------------DANAKLIRELKEEIQKLRDLLKAEGIEVQEEDELT---KSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLG-----THEANVPQDIQLSGSHILKEHC--TFENKNSTVTLLP-HKDAIIYVNGRKLVEPE--VLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLK 621          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0330003)

HSP 1 Score: 392.889 bits (1008), Expect = 1.062e-115
Identity = 261/674 (38.72%), Postives = 365/674 (54.15%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK----DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST----MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSE--EDIQRLRN-------EIEEDLKVGIQFKSEII---------NFQNSEEWQAKIEAADA------QNFDEKNSKKSKVN---------------------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP--VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-----------TAKNRSNAV-------WDWESVQTEIAAAEGFDVK 1865
            SVKVAVR+RPFN RE  R +K II MAG TT I NPK     +++VK FNFDYSYWSHD    D             +++Q  V+ D+G+++L ++ +GYN  +FAYGQTG+GKSY+M+G   E  +GI+P IC +LF  I+    + +KY V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V  Y+ +   +++G   RT+AAT MN TSSR+H V T+ F Q      T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S  K+T     IPYRDS LT LL+  LGGNSKT MIAA+SPADINYDETLSTLRYADR KQI   A+VNE                           D N K + E  E+IQ+LR+       E++E+ ++    KS +I         N   +E    +++A++       + ++EK  +  ++                            K P+++N+NEDP L+  L Y+I+     +G       ++  P  +++ G  I + H   T   K   V++ P   D ++ VNG ++   +   L    R++ G ++++ F NP           T     N V        DW   Q E+   +G D+K
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNE---------------------------DANAKLIRELKEEIQKLRDLLKAEGIEVQEEDELT---KSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLG-----THEANVPQDIQLSGSHILKEHC--TFENKNSTVTLLP-HKDAIIYVNGRKLVEPE--VLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLK 621          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0113088)

HSP 1 Score: 392.504 bits (1007), Expect = 1.156e-115
Identity = 261/674 (38.72%), Postives = 365/674 (54.15%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK----DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST----MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSE--EDIQRLRN-------EIEEDLKVGIQFKSEII---------NFQNSEEWQAKIEAADA------QNFDEKNSKKSKVN---------------------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP--VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-----------TAKNRSNAV-------WDWESVQTEIAAAEGFDVK 1865
            SVKVAVR+RPFN RE  R +K II MAG TT I NPK     +++VK FNFDYSYWSHD    D             +++Q  V+ D+G+++L ++ +GYN  +FAYGQTG+GKSY+M+G   E  +GI+P IC +LF  I+    + +KY V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V  Y+ +   +++G   RT+AAT MN TSSR+H V T+ F Q      T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S  K+T     IPYRDS LT LL+  LGGNSKT MIAA+SPADINYDETLSTLRYADR KQI   A+VNE                           D N K + E  E+IQ+LR+       E++E+ ++    KS +I         N   +E    +++A++       + ++EK  +  ++                            K P+++N+NEDP L+  L Y+I+     +G       ++  P  +++ G  I + H   T   K   V++ P   D ++ VNG ++   +   L    R++ G ++++ F NP           T     N V        DW   Q E+   +G D+K
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNE---------------------------DANAKLIRELKEEIQKLRDLLKAEGIEVQEEDELT---KSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLG-----THEANVPQDIQLSGSHILKEHC--TFENKNSTVTLLP-HKDAIIYVNGRKLVEPE--VLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLK 621          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0113087)

HSP 1 Score: 392.504 bits (1007), Expect = 1.156e-115
Identity = 261/674 (38.72%), Postives = 365/674 (54.15%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK----DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST----MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSE--EDIQRLRN-------EIEEDLKVGIQFKSEII---------NFQNSEEWQAKIEAADA------QNFDEKNSKKSKVN---------------------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP--VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-----------TAKNRSNAV-------WDWESVQTEIAAAEGFDVK 1865
            SVKVAVR+RPFN RE  R +K II MAG TT I NPK     +++VK FNFDYSYWSHD    D             +++Q  V+ D+G+++L ++ +GYN  +FAYGQTG+GKSY+M+G   E  +GI+P IC +LF  I+    + +KY V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V  Y+ +   +++G   RT+AAT MN TSSR+H V T+ F Q      T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S  K+T     IPYRDS LT LL+  LGGNSKT MIAA+SPADINYDETLSTLRYADR KQI   A+VNE                           D N K + E  E+IQ+LR+       E++E+ ++    KS +I         N   +E    +++A++       + ++EK  +  ++                            K P+++N+NEDP L+  L Y+I+     +G       ++  P  +++ G  I + H   T   K   V++ P   D ++ VNG ++   +   L    R++ G ++++ F NP           T     N V        DW   Q E+   +G D+K
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNE---------------------------DANAKLIRELKEEIQKLRDLLKAEGIEVQEEDELT---KSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLG-----THEANVPQDIQLSGSHILKEHC--TFENKNSTVTLLP-HKDAIIYVNGRKLVEPE--VLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLK 621          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0087079)

HSP 1 Score: 392.889 bits (1008), Expect = 1.581e-115
Identity = 261/674 (38.72%), Postives = 365/674 (54.15%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK----DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST----MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSE--EDIQRLRN-------EIEEDLKVGIQFKSEII---------NFQNSEEWQAKIEAADA------QNFDEKNSKKSKVN---------------------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP--VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-----------TAKNRSNAVW-------DWESVQTEIAAAEGFDVK 1865
            SVKVAVR+RPFN RE  R +K II MAG TT I NPK     +++VK FNFDYSYWSHD    D             +++Q  V+ D+G+++L ++ +GYN  +FAYGQTG+GKSY+M+G   E  +GI+P IC +LF  I+    + +KY V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V  Y+ +   +++G   RT+AAT MN TSSR+H V T+ F Q      T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S  K+T     IPYRDS LT LL+  LGGNSKT MIAA+SPADINYDETLSTLRYADR KQI   A+VNE                           D N K + E  E+IQ+LR+       E++E+ ++    KS +I         N   +E    +++A++       + ++EK  +  ++                            K P+++N+NEDP L+  L Y+I+     +G       ++  P  +++ G  I + H   T   K   V++ P   D ++ VNG ++   +   L    R++ G ++++ F NP           T     N V        DW   Q E+   +G D+K
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNE---------------------------DANAKLIRELKEEIQKLRDLLKAEGIEVQEEDELT---KSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLG-----THEANVPQDIQLSGSHILKEHC--TFENKNSTVTLLP-HKDAIIYVNGRKLVEPE--VLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLK 621          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 410.609 bits (1054), Expect = 1.388e-121
Identity = 276/667 (41.38%), Postives = 381/667 (57.12%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGM-------------SEEDIQRLRN------------EIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILT--RNAKKEN-VSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+    KTF+FDYSYWSH +          PD PS  +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E  +GI+P +C ELF+ I   +NE + Y V+ + +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q       + S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADIN+DETLSTLRYADR KQIK  A++NE+P  K++REL++E  RLK  L  Q   DI    M             S+  +Q + +            E  E LK     +SE I  + +E W+ K+   +A    E+ +  +++                 K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I    RNA     V+++P        VNG R+  N    L   +R++ G ++++ F           K P+A+     V DW   Q E+   +G D+K    +E ++ E+
Sbjct:    1 MSGASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTS----------PDDPS--FASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEELFEKINDNNNEEISYSVEVAYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVSRLKELLRAQGLGDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQERIMSTPGGEEAIERLK-----ESEKIIAELNETWEEKLRKTEAIRM-EREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIFRSERNANGHVIVTLEPCEGS-ETYVNGKRV--NSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPV-DWTFAQRELLEKQGIDMKQE--MEKRLTEM 638          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 410.609 bits (1054), Expect = 1.401e-121
Identity = 276/667 (41.38%), Postives = 381/667 (57.12%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGM-------------SEEDIQRLRN------------EIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILT--RNAKKEN-VSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+    KTF+FDYSYWSH +          PD PS  +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E  +GI+P +C ELF+ I   +NE + Y V+ + +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q       + S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADIN+DETLSTLRYADR KQIK  A++NE+P  K++REL++E  RLK  L  Q   DI    M             S+  +Q + +            E  E LK     +SE I  + +E W+ K+   +A    E+ +  +++                 K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I    RNA     V+++P        VNG R+  N    L   +R++ G ++++ F           K P+A+     V DW   Q E+   +G D+K    +E ++ E+
Sbjct:    1 MSGASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTS----------PDDPS--FASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEELFEKINDNNNEEISYSVEVAYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVSRLKELLRAQGLGDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQERIMSTPGGEEAIERLK-----ESEKIIAELNETWEEKLRKTEAIRM-EREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIFRSERNANGHVIVTLEPCEGS-ETYVNGKRV--NSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPV-DWTFAQRELLEKQGIDMKQE--MEKRLTEM 638          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1aa (kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GENE-100913-3])

HSP 1 Score: 403.29 bits (1035), Expect = 2.905e-119
Identity = 268/665 (40.30%), Postives = 372/665 (55.94%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYES--NKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNK----STMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI-----NTKGM----------------------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKK--ENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP----TAKNRSNAV------WDWESVQTEIAAAEGFDVK 1865
            M   SVKVAVR+RPFN RE  + +K II M+G TT I+NPK     K+FNFDYSYWSH +             P  I YASQQ+V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +    +GI+P +C +LF  I   ++ ++ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q      T  ++ K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S  K     + IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P  +++REL++E  RLK  L  Q   DI        GM                            SEE I+RL+             ++E I  + +E W+ K+   +A   D   +  +++                 K P+++N+NEDP ++  L Y+I+     VG+       S   + + G  I+E H   T       E V ++P        VNG R+   + T L   +R++ G S+++ F +P      ++R+          DW   Q E+   +G D+K
Sbjct:    1 MAGASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTIINPKAPKENKSFNFDYSYWSHTS-------------PEDINYASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPLLCEDLFTKINENNDNNMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVMSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDSETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVVSNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKDEVSRLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAGSISSLHDRIMFSPGSEEAIERLK-------------ETEKIIAELNETWEEKLRRTEAIRMDRSEALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDA---SSRQDIVLSGHFIKEEHCTFTSTTGPMGEAVILEPCEG-AETYVNGKRV--TEPTVLKSGNRIILGKSHVFRFNHPEQARQERDRTPCAETPVEPVDWAFAQRELLDKQGIDMK 631          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1aa (kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GENE-100913-3])

HSP 1 Score: 402.519 bits (1033), Expect = 5.954e-119
Identity = 268/668 (40.12%), Postives = 370/668 (55.39%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYES--NKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNK--------STMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI-----NTKGM----------------------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKS---------------KVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKK--ENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP----TAKNRSNAV------WDWESVQTEIAAAEGFDVK 1865
            M   SVKVAVR+RPFN RE  + +K II M+G TT I+NPK     K+FNFDYSYWSH +             P  I YASQQ+V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +    +GI+P +C +LF  I   ++ ++ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q      T  ++ K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  SG+          + IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P  +++REL++E  RLK  L  Q   DI        GM                            SEE I+RL+             ++E I  + +E W+ K+   +A   D +                       K P+++N+NEDP ++  L Y+I+     VG+       S   + + G  I+E H   T       E V ++P        VNG R+   + T L   +R++ G S+++ F +P      ++R+          DW   Q E+   +G D+K
Sbjct:    1 MAGASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTIINPKAPKENKSFNFDYSYWSHTS-------------PEDINYASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPLLCEDLFTKINENNDNNMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVMSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDSETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSGSNKNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKDEVSRLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAGSISSLHDRIMFSPGSEEAIERLK-------------ETEKIIAELNETWEEKLRRTEAIRMDREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDA---SSRQDIVLSGHFIKEEHCTFTSTTGPMGEAVILEPCEG-AETYVNGKRV--TEPTVLKSGNRIILGKSHVFRFNHPEQARQERDRTPCAETPVEPVDWAFAQRELLDKQGIDMK 634          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 387.497 bits (994), Expect = 2.027e-116
Identity = 205/371 (55.26%), Postives = 259/371 (69.81%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLI--XXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+    KTF+FDYSYWSH +          PD PS  +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E  +GI+P +C ELF+ I   +NE + Y V+ + +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q       + S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADIN+DETLSTLRYADR KQIK  A++NE+P
Sbjct:    1 MSGASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTS----------PDDPS--FASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEELFEKINDNNNEEISYSVEVAYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDP 357          

HSP 2 Score: 54.6842 bits (130), Expect = 6.393e-7
Identity = 43/166 (25.90%), Postives = 77/166 (46.39%), Query Frame = 3
Query: 1449 KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKEN----VSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I  R+ +  N    V+++P        VNG R+  N    L   +R++ G ++++ F           K P+A+     V DW   Q E+   +G D+K    +E ++ E+
Sbjct:  497 KTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIF-RSERNANGHVIVTLEPCEGSETY-VNGKRV--NSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPV-DWTFAQRELLEKQGIDMKQE--MEKRLTEM 652          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kcnq4 (potassium channel, voltage gated KQT-like subfamily Q, member 4 [Source:Xenbase;Acc:XB-GENE-5817035])

HSP 1 Score: 512.686 bits (1319), Expect = 6.064e-165
Identity = 312/849 (36.75%), Postives = 480/849 (56.54%), Query Frame = 3
Query:  135 EKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAV--WDWESVQTEIAAAEGFDVK------DRSILE--SQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFI-----HGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQK 2636
            EKD ++K +ISM    T I +PK+  N KTF FD +YWSH  +  ++   +VPDG  S YA Q+ VF DLGQ +L NA  GYN +L AYGQTGSGKSYSMIGY +N+GI+P +C ELF+ IE+   ++ +Y V FSMLEIYNE++ DLL     S G L +RE+++ GF+V  L  VP  SY Q+E+ + QG   RT A+T MNA+SSR+H VIT++F Q++       TK S+I L+DLAGSER  S+ + GDRL+EG  +N SL+ LGNVI+ALA++  G K   IPYRDSVLTKLL++ALGGNS+TVMIAA+SPADI Y+ETLSTLRY      +                                            E+++RL  E E  ++  +Q   E    +  +EW+        Q +     ++  +  +PY++NINEDPQL+G L +FI+     VG+ P         + + G GI   HA    +  K  V +KP     V+ VNG  I  N  T L   DR++ GS++ Y++    A+   + +  +D++  Q+E+AAAEGF V       D S+L      I+++P+V E N +S+E++KD KF+ L +   A   S   + + ++ +++ + IT+  W+  +S FINR+F+++E+Y+++LDG ++ ++  + DPFW+P   I +G A ++LQ+L Y + +     +++ +G EE  + I I PC         +D  I D ++LL +    +I I  L     R++      G ++ ++ Y + +   T    K++    + +      +++   L Y +   ++  ++G+Q+
Sbjct:   18 EKDASSKCVISMKTNCTTICDPKNVGNEKTFKFDLAYWSHSEYLKNTESTLVPDGSYSRYADQKTVFQDLGQGILDNAWQGYNATLLAYGQTGSGKSYSMIGYGTNRGIIPLVCEELFRAIENNQEKNKQYQVTFSMLEIYNEQVTDLLSKTKKS-GGLKVREDQHQGFYVDGLKLVPCESYAQIERLIEQGKKIRTTASTSMNASSSRSHMVITIQFKQIL--LKEDITKQSSINLVDLAGSERQKSSASEGDRLREGTCVNLSLTTLGNVISALAEAAMGKKVLHIPYRDSVLTKLLQSALGGNSRTVMIAAISPADICYEETLSTLRYCKVYVSVS-------------------------------------------EELRRLLAENELRIQT-MQITWEHQLQEARKEWE--------QQYAAITQERRMMQLYPYLLNINEDPQLSGVLKHFIQEGASDVGQDPS------NVITLRGLGILPQHATFINSESK--VFVKPHGKGKVI-VNGVPIVLN--TKLQHLDRIILGSNSAYLYIGFPAERGPDDLCRFDYDFFQSELAAAEGFSVDTLEGKPDPSVLAVFHDFIKLMPLVAEANQMSEELSKDLKFE-LKVKNLALTDSRGYDLQKEISVKVINQITNQVWIWSKSKFINRKFLMEELYQRYLDGGDI-SLDRESDPFWDPVEVIHLGSAHIWLQSLAYCMKLEEQTELLNSEGVEEAILVINITPCSDTERPFGEEDIVI-DPLELLGRKIEFQIHI--LQCLGVRWLKEATNRGIQIGYHFYDVCQCVYTKPVWKNVNPIIDHKLQFVALNVSNVLLSYLQKHALVVDLWGLQE 795          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: KIF1B (kinesin family member 1B [Source:NCBI gene;Acc:100379810])

HSP 1 Score: 409.068 bits (1050), Expect = 5.757e-121
Identity = 278/676 (41.12%), Postives = 376/676 (55.62%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI-NTKGM---------------------------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKS---------------KVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILT--RNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEIL 1904
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+     K+F+FDYSYWSH +           D P   +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E+  GI+P +C +LF+ I   +N+ V + V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q  L    N S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P  K++REL++E  RLK  L  Q   DI ++KG                                   EE I+RL+             +SE I  + +E W+ K+   +A   D +                       K P+++N+NEDP ++  L Y+I+     VG+      DS   + + G  I+E H I    RN+  E +            VNG R+ +  E  L   +R++ G ++++ F           K P+A+  S  V DW   Q E+   +G D+K       Q +EIL
Sbjct:    1 MSGASVKVAVRVRPFNSRELSKESKCIIQMQGNSTSIINPKNPKEAAKSFSFDYSYWSHTS----------QDDP--CFASQSRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEETQAGIIPQLCEDLFEKINDNNNDEVSFSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKRLDIGTNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVTRLKDLLRAQGLGDILDSKGCLTFSSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLK-------------ESEKIIAELNETWEEKLRKTEAIRMDREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGLTRVGQADA---DSRQDIVLSGAHIKEEHCIFRSERNSNGEVIVTLEPGDRSETYVNGKRVVHPVE--LRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPV-DWTFAQRELLEKQGIDMKQEMEKRLQEMEIL 643          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: KIF1B (kinesin family member 1B [Source:NCBI gene;Acc:100379810])

HSP 1 Score: 407.912 bits (1047), Expect = 1.582e-120
Identity = 278/676 (41.12%), Postives = 375/676 (55.47%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI----------------------------------NTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKS---------------KVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILT--RNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEIL 1904
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+     K+F+FDYSYWSH +           D P   +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E+  GI+P +C +LF+ I   +N+ V + V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q  L    N S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P  K++REL++E  RLK  L  Q   DI                                  +T G  EE I+RL+             +SE I  + +E W+ K+   +A   D +                       K P+++N+NEDP ++  L Y+I+     VG+      DS   + + G  I+E H I    RN+  E +            VNG R+ +  E  L   +R++ G ++++ F           K P+A+  S  V DW   Q E+   +G D+K       Q +EIL
Sbjct:    1 MSGASVKVAVRVRPFNSRELSKESKCIIQMQGNSTSIINPKNPKEAAKSFSFDYSYWSHTS----------QDDP--CFASQSRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEETQAGIIPQLCEDLFEKINDNNNDEVSFSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKRLDIGTNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVTRLKDLLRAQGLGDILDTSISSLASSPSSCSLSSQVGLTSVTSIQERIMSTPG-GEEAIERLK-------------ESEKIIAELNETWEEKLRKTEAIRMDREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGLTRVGQADA---DSRQDIVLSGAHIKEEHCIFRSERNSNGEVIVTLEPGDRSETYVNGKRVVHPVE--LRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPV-DWTFAQRELLEKQGIDMKQEMEKRLQEMEIL 642          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: KIF1B (kinesin family member 1B [Source:NCBI gene;Acc:100379810])

HSP 1 Score: 407.912 bits (1047), Expect = 1.690e-120
Identity = 278/676 (41.12%), Postives = 375/676 (55.47%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI----------------------------------NTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKS---------------KVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILT--RNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEIL 1904
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+     K+F+FDYSYWSH +           D P   +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E+  GI+P +C +LF+ I   +N+ V + V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q  L    N S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P  K++REL++E  RLK  L  Q   DI                                  +T G  EE I+RL+             +SE I  + +E W+ K+   +A   D +                       K P+++N+NEDP ++  L Y+I+     VG+      DS   + + G  I+E H I    RN+  E +            VNG R+ +  E  L   +R++ G ++++ F           K P+A+  S  V DW   Q E+   +G D+K       Q +EIL
Sbjct:    1 MSGASVKVAVRVRPFNSRELSKESKCIIQMQGNSTSIINPKNPKEAAKSFSFDYSYWSHTS----------QDDP--CFASQSRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEETQAGIIPQLCEDLFEKINDNNNDEVSFSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKRLDIGTNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVTRLKDLLRAQGLGDILDSTPHSLASSPSSCSLSSQVGLTSVTSIQERIMSTPG-GEEAIERLK-------------ESEKIIAELNETWEEKLRKTEAIRMDREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGLTRVGQADA---DSRQDIVLSGAHIKEEHCIFRSERNSNGEVIVTLEPGDRSETYVNGKRVVHPVE--LRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPV-DWTFAQRELLEKQGIDMKQEMEKRLQEMEIL 642          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: KIF1B (kinesin family member 1B [Source:NCBI gene;Acc:100379810])

HSP 1 Score: 405.986 bits (1042), Expect = 6.409e-120
Identity = 280/684 (40.94%), Postives = 380/684 (55.56%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTS---GNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI--------------------------------NTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKS---------------KVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILT--RNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVK---DRSILESQIIEILP-MVF 1916
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+     K+F+FDYSYWSH +           D P   +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E+  GI+P +C +LF+ I   +N+ V + V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q  L    N S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S     K+  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P  K++REL++E  RLK  L  Q   DI                                +T G  EE I+RL+             +SE I  + +E W+ K+   +A   D +                       K P+++N+NEDP ++  L Y+I+     VG+      DS   + + G  I+E H I    RN+  E +            VNG R+ +  E  L   +R++ G ++++ F           K P+A+  S  V DW   Q E+   +G D+K   ++ + + Q    LP MVF
Sbjct:    1 MSGASVKVAVRVRPFNSRELSKESKCIIQMQGNSTSIINPKNPKEAAKSFSFDYSYWSHTS----------QDDP--CFASQSRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEETQAGIIPQLCEDLFEKINDNNNDEVSFSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKRLDIGTNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVVSFKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVTRLKDLLRAQGLGDILDSNSLASSPSSCSLSSQVGLTSVTSIQERIMSTPG-GEEAIERLK-------------ESEKIIAELNETWEEKLRKTEAIRMDREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGLTRVGQADA---DSRQDIVLSGAHIKEEHCIFRSERNSNGEVIVTLEPGDRSETYVNGKRVVHPVE--LRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPV-DWTFAQRELLEKQGIDMKQEMEKRLEKLQQTHSLPLMVF 650          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif28 (kinesin family member 28 [Source:MGI Symbol;Acc:MGI:2686151])

HSP 1 Score: 543.502 bits (1399), Expect = 2.115e-176
Identity = 325/871 (37.31%), Postives = 504/871 (57.86%), Query Frame = 3
Query:   87 TESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKN-PTAKNRSN-AVWDWESVQTEIAAAEGFDV------------KDRSILE--SQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDY---LSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSI--TKDHLDYFKDGTIIFCVYGIQK 2636
            ++SV+VAVR+RPF+QREK+  ++ +ISM      I +PK+   VKTF FD +YWSHD F+ D + V++P  P+S +A Q  VF D+G+ +L +A  GYN +L AYGQTGSGKSYSMIG+ +NKG++P +C ELF+ IE K  E+++  V FSMLEIYNE+IRDLL     + G L +RE++ LGFFV+ L  VP  +Y Q+EK + QG+  R  A+T MNA+SSR+H +I ++F Q+    +T+ TK S+I ++DLAGSER  S+ + GDRL+EG+ +N SL++LGNVI+ALAD   G K   IPYRDSVLTKLL++ALGGNS+T +IAALSPADI Y+ETLSTLRYA+R K+++N A++N  PL +  R         + A   + P                      + ++G Q     +  Q   EW+ + EA           ++  V   P+++N+NEDPQLTG L +FI      VG+       +   + + G GI + HA       K  V++ P  S C V VNG  +     T L   DR++ GS++ +++   P+ +   + + +D++  Q E AAAEG  V             D SIL      ++++P+V E N +S+E+ K    + L +   A + S   + + +VM+++T   T   W+  ++ FINR+F+++E+Y++FL+  +  ++  +DDPFW+P   + +G A V+LQ L + + +   +  ++  G EE  + I+I PC  +G     +D  I D ++LL K    +  I     +   K     G ++ + IY +  T  T    KS+      E+ + + ++  +++ LDY     +I  ++G+Q+
Sbjct:   14 SDSVRVAVRVRPFSQREKNSGSQCVISMHSGNISIRDPKNEERVKTFTFDLTYWSHDGFQKDEDGVLIPSDPASKFAGQSDVFHDIGRGILDSAWRGYNATLLAYGQTGSGKSYSMIGFGTNKGLIPRVCEELFQAIE-KQKENLEPQVMFSMLEIYNEQIRDLL-SRTKAPGGLRVREDQQLGFFVEGLKWVPCENYAQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIQFKQVF--LDTALTKRSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTSLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCPLARASRAENALLLGFRGAGAAEHPACFWA-----------------EQQLGNQGTWAQLLEQARREWEEQYEAL--------TQEQKMVRILPHLLNVNEDPQLTGVLKFFIHNGSCDVGRA------ASNAICLQGLGISDKHASFVNLDGK--VTVAP-HSKCKVIVNGVPV--TGRTKLQHLDRIILGSNSAFLYVGFPSERGAEDLSRFDYDFFQLERAAAEGVSVATLGCVSPGDDQADPSILAVFQDYVKLMPLVVEANQMSEELKKGLTME-LKVKNLASSDSRGYDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPLEVVHLGSAHVWLQPLAHCMMLEEQVEFLNCDGLEEAVLHIRITPCSPEGWAHGEEDMVI-DPLELLGKRIDFQTHIVRCLGVKWLKEDGSRGIQMGYKIYDLPNTLYTKPVWKSVNP--RIEETVHFAALGASREFLDYLLTNALIVDLWGLQE 839          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif28 (kinesin family member 28 [Source:MGI Symbol;Acc:MGI:2686151])

HSP 1 Score: 543.117 bits (1398), Expect = 3.879e-176
Identity = 325/871 (37.31%), Postives = 504/871 (57.86%), Query Frame = 3
Query:   87 TESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKN-PTAKNRSN-AVWDWESVQTEIAAAEGFDV------------KDRSILE--SQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDY---LSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSI--TKDHLDYFKDGTIIFCVYGIQK 2636
            ++SV+VAVR+RPF+QREK+  ++ +ISM      I +PK+   VKTF FD +YWSHD F+ D + V++P  P+S +A Q  VF D+G+ +L +A  GYN +L AYGQTGSGKSYSMIG+ +NKG++P +C ELF+ IE K  E+++  V FSMLEIYNE+IRDLL     + G L +RE++ LGFFV+ L  VP  +Y Q+EK + QG+  R  A+T MNA+SSR+H +I ++F Q+    +T+ TK S+I ++DLAGSER  S+ + GDRL+EG+ +N SL++LGNVI+ALAD   G K   IPYRDSVLTKLL++ALGGNS+T +IAALSPADI Y+ETLSTLRYA+R K+++N A++N  PL +  R         + A   + P                      + ++G Q     +  Q   EW+ + EA           ++  V   P+++N+NEDPQLTG L +FI      VG+       +   + + G GI + HA       K  V++ P  S C V VNG  +     T L   DR++ GS++ +++   P+ +   + + +D++  Q E AAAEG  V             D SIL      ++++P+V E N +S+E+ K    + L +   A + S   + + +VM+++T   T   W+  ++ FINR+F+++E+Y++FL+  +  ++  +DDPFW+P   + +G A V+LQ L + + +   +  ++  G EE  + I+I PC  +G     +D  I D ++LL K    +  I     +   K     G ++ + IY +  T  T    KS+      E+ + + ++  +++ LDY     +I  ++G+Q+
Sbjct:   14 SDSVRVAVRVRPFSQREKNSGSQCVISMHSGNISIRDPKNEERVKTFTFDLTYWSHDGFQKDEDGVLIPSDPASKFAGQSDVFHDIGRGILDSAWRGYNATLLAYGQTGSGKSYSMIGFGTNKGLIPRVCEELFQAIE-KQKENLEPQVMFSMLEIYNEQIRDLL-SRTKAPGGLRVREDQQLGFFVEGLKWVPCENYAQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIQFKQVF--LDTALTKRSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTSLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCPLARASRAENALLLGFRGAGAAEHPACFWA-----------------EQQLGNQGTWAQLLEQARREWEEQYEAL--------TQEQKMVRILPHLLNVNEDPQLTGVLKFFIHNGSCDVGRA------ASNAICLQGLGISDKHASFVNLDGK--VTVAP-HSKCKVIVNGVPV--TGRTKLQHLDRIILGSNSAFLYVGFPSERGAEDLSRFDYDFFQLERAAAEGVSVATLGCVSPGDDQADPSILAVFQDYVKLMPLVVEANQMSEELKKGLTME-LKVKNLASSDSRGYDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPLEVVHLGSAHVWLQPLAHCMMLEEQVEFLNCDGLEEAVLHIRITPCSPEGWAHGEEDMVI-DPLELLGKRIDFQTHIVRCLGVKWLKEDGSRGIQMGYKIYDLPNTLYTKPVWKSVNP--RIEETVHFAALGASREFLDYLLTNALIVDLWGLQE 839          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif28 (kinesin family member 28 [Source:MGI Symbol;Acc:MGI:2686151])

HSP 1 Score: 399.823 bits (1026), Expect = 1.533e-123
Identity = 198/364 (54.40%), Postives = 271/364 (74.45%), Query Frame = 3
Query:   87 TESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            ++SV+VAVR+RPF+QREK+  ++ +ISM      I +PK+   VKTF FD +YWSHD F+ D + V++P  P+S +A Q  VF D+G+ +L +A  GYN +L AYGQTGSGKSYSMIG+ +NKG++P +C ELF+ IE K  E+++  V FSMLEIYNE+IRDLL     + G L +RE++ LGFFV+ L  VP  +Y Q+EK + QG+  R  A+T MNA+SSR+H +I ++F Q+    +T+ TK S+I ++DLAGSER  S+ + GDRL+EG+ +N SL++LGNVI+ALAD   G K   IPYRDSVLTKLL++ALGGNS+T +IAALSPADI Y+ETLSTLRYA+R K+++N A++N  P
Sbjct:   14 SDSVRVAVRVRPFSQREKNSGSQCVISMHSGNISIRDPKNEERVKTFTFDLTYWSHDGFQKDEDGVLIPSDPASKFAGQSDVFHDIGRGILDSAWRGYNATLLAYGQTGSGKSYSMIGFGTNKGLIPRVCEELFQAIE-KQKENLEPQVMFSMLEIYNEQIRDLL-SRTKAPGGLRVREDQQLGFFVEGLKWVPCENYAQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIQFKQVF--LDTALTKRSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTSLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCP 373          

HSP 2 Score: 144.05 bits (362), Expect = 1.641e-34
Identity = 121/477 (25.37%), Postives = 226/477 (47.38%), Query Frame = 3
Query: 1575 VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKN-PTAKNRSN-AVWDWESVQTEIAAAEGFDVK------------DRSILE--SQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDY---LSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSI--TKDHLDYFKDGTIIFCVYGIQKDSKHQPSGNNKTPNQTKIKVSMEYERNKMKTENVLSQAL-ANRQARKIERLKQLCLDWSNKPTEEQKFDP-------LLRSVSAICFSSENKFKVISTIIAK 2918
            + + G GI + HA       K  V++ P  S C V VNG  +     T L   DR++ GS++ +++   P+ +   + + +D++  Q E AAAEG  V             D SIL      ++++P+V E N +S+E+ K    + L +   A + S   + + +VM+++T   T   W+  ++ FINR+F+++E+Y++FL+  +  ++  +DDPFW+P   + +G A V+LQ L + + +   +  ++  G EE  + I+I PC  +G     +D  I D ++LL K    +  I     +   K     G ++ + IY +  T  T    KS+      E+ + + ++  +++ LDY     +I  ++G+Q      P G  +T  +   +V  +    +  ++  L++AL    Q   + R + L L     P ++Q   P       +L+ +  +  SS +K K     I K
Sbjct:  407 ICLQGLGISDKHASFVNLDGK--VTVAP-HSKCKVIVNGVPV--TGRTKLQHLDRIILGSNSAFLYVGFPSERGAEDLSRFDYDFFQLERAAAEGVSVATLGCVSPGDDQADPSILAVFQDYVKLMPLVVEANQMSEELKKGLTME-LKVKNLASSDSRGYDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPLEVVHLGSAHVWLQPLAHCMMLEEQVEFLNCDGLEEAVLHIRITPCSPEGWAHGEEDMVI-DPLELLGKRIDFQTHIVRCLGVKWLKEDGSRGIQMGYKIYDLPNTLYTKPVWKSVNP--RIEETVHFAALGASREFLDYLLTNALIVDLWGLQAQKLDNPEGATRTAAREAKQVCAQ----QASSDAQLARALKVFYQGMGVARGQLLRLRRCRPPEDDQMLRPFVHQQSQMLKDLEDLLESSLHKLKADVAFIVK 869          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif1b (kinesin family member 1B [Source:MGI Symbol;Acc:MGI:108426])

HSP 1 Score: 409.453 bits (1051), Expect = 3.776e-121
Identity = 276/677 (40.77%), Postives = 377/677 (55.69%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIX--XXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGM---------------------------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAIL---TRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEIL 1904
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK+     K+F+FDYSYWSH +          P+ P   +ASQ +V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G   ES  GI+P +C ELF+ I    NE + Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q  +    N S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +   K T  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P  K++REL+EE  RLK  L  Q   DI    M                                  EE I+RL+             +SE I  + +E W+ K+   +A    E+ +  +++                 K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H +      N  +  V+++P        VNG R+ +     L   +R++ G ++++ F           K P+A+  S  V DW   Q E+   +G D+K       Q +EIL
Sbjct:    1 MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTS----------PEDP--CFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKQDPETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLNSQVGLTSVTSIQERIMSTPGGEEAIERLK-------------ESEKIIAELNETWEEKLRKTEAIRM-EREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCLFRSERSNTGEVIVTLEPCERS-ETYVNGKRVAH--PVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPV-DWTFAQRELLEKQGIDMKQEMEKRLQEMEIL 642          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif1c (kinesin family member 1C [Source:MGI Symbol;Acc:MGI:1098260])

HSP 1 Score: 375.941 bits (964), Expect = 5.194e-120
Identity = 201/372 (54.03%), Postives = 259/372 (69.62%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYE--SNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG-NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  ++AK ++SM G TT I+NPK + +  K+F FDYSYWSH +  ++  Q          +ASQQ+V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +    +GIVP +C +LF  +    +  + Y V+ S +EIY ER+RDLL P   S+G+L +RE+  LG +VQDL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q      T   + K S I L+DLAGSERADS+ A G RLKEGA+INKSL+ LG VI+ALAD  S   KS  IPYRDSVLT LLK  LGGNS+T MIAALSPADINY+ETLSTLRYADR KQI+  A++NE+P
Sbjct:    1 MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHTS--VEDPQ----------FASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVPQLCEDLFSRVNVNQSAQLSYSVEVSYMEIYCERVRDLLNP--KSRGSLRVREHPILGPYVQDLSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRSHDQLTGLDSEKVSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADLQSKKRKSDFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAVINEDP 358          
BLAST of Kinesin-like protein vs. UniProt
Match: sp|F8WLE0|KIF28_RAT (Kinesin-like protein KIF28P OS=Rattus norvegicus OX=10116 GN=Kif28p PE=2 SV=1)

HSP 1 Score: 545.043 bits (1403), Expect = 5.126e-176
Identity = 328/878 (37.36%), Postives = 504/878 (57.40%), Query Frame = 3
Query:   72 LEVMPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKN-PTAKNRSN-AVWDWESVQTEIAAAEGFDV------------KDRSILE--SQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDY---LSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKH 2648
            L V  T+SV+VAVR+RPF+QREK+  ++ +ISM  ++  I +PKDA  VKTF FD +YWSHD F+ D + V++P  P+S +A Q  VF D+G+ +L +A  GYN +L AYGQTGSGKSYSMIGY +NKGI+P +C ELF+ IE K  ES++  V FSMLEIYNE+IRDLL     + G L +RE++ LGFFV+ L  VP     Q+EK + QG+  R  A+T MNA+SSR+H +I + F Q+    +T+ TK S+I ++DLAGSER  S+ + GDRL+EG+ +N SL+ LGNVI+ALAD   G K   IPYRDSVLTKLL++ALGGNS+T +IAALSPADI Y+ETLSTLRYA+R K+++N A++N  PL +  R                L       G +E        +     ++G       +  Q   EW+        Q +     ++  V   P+++N+NEDPQLTG L +FI      VG+       +   + +   GI + HA  T    K  V++ P  +  V+ VNG  +  +  T L   DR++ GS++ +++   P+ +   +   +D++  Q E AAAEG  V             D SIL      I+++P+V E N +S+E+ K  K + L +   A + S   + + +VM+++T   T   W+  ++ FINR+F+++E+Y++FL+  +  ++  +DDPFW+P   + +G A V+LQ+L + + +   +  ++ +G EE  + I+I PC  +G     +D  I D ++LL K    +I I     +   K     G ++ + +Y +  T  T    +S+          +   ++++ L+Y     ++  ++G+Q+   H
Sbjct:    9 LPVPRTDSVRVAVRVRPFSQREKNSGSQCVISMHARSITIRDPKDAELVKTFTFDLAYWSHDGFQKDEDGVLIPSDPTSKFAGQSDVFHDIGRGILDSAWQGYNATLLAYGQTGSGKSYSMIGYGANKGIIPRVCEELFQAIE-KQKESLEAQVMFSMLEIYNEQIRDLL-SRTKAPGGLRVREDQRLGFFVEGLKWVPCEDSVQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIRFKQVF--LDTALTKQSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTNLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCPLVRASRAENA------------LLLGFGGAGAAEHSACFWAEQ-----QLGTWGTWAQLLEQARREWE--------QQYMALAQEQQMVKILPHLLNVNEDPQLTGVLKFFIHNGSCEVGRA------ASNAICLQSLGISDKHASFTNMDGK--VTVAPHITGKVI-VNGVPV--SSRTKLQHLDRIILGSNSAFLYIGFPSERGAEDLGRFDYDFFQMERAAAEGVSVDMLGTASPGDDQADPSILAVFQDYIKLMPLVVEANQMSEELKKGLKME-LKVKNLASSDSRGCDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPVEVLHLGSAHVWLQSLAHRMMLEEQVEFLNCEGLEEAVLHIQITPCSPEGWAHGEEDTVI-DPLELLGKRIDFQIHIVQCLGVKWLKEDATRGIQLGYKVYDLPNTLYTKPVWQSVNPRVEESVHFAALGVSREFLNYLLTNALVVDLWGLQEGCAH 843          
BLAST of Kinesin-like protein vs. UniProt
Match: sp|D3YXS5|KIF28_MOUSE (Kinesin-like protein KIF28P OS=Mus musculus OX=10090 GN=Kif28p PE=3 SV=1)

HSP 1 Score: 543.888 bits (1400), Expect = 1.183e-175
Identity = 325/871 (37.31%), Postives = 504/871 (57.86%), Query Frame = 3
Query:   87 TESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKN-PTAKNRSN-AVWDWESVQTEIAAAEGFDV------------KDRSILE--SQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDY---LSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSI--TKDHLDYFKDGTIIFCVYGIQK 2636
            ++SV+VAVR+RPF+QREK+  ++ +ISM      I +PK+   VKTF FD +YWSHD F+ D + V++P  P+S +A Q  VF D+G+ +L +A  GYN +L AYGQTGSGKSYSMIG+ +NKG++P +C ELF+ IE K  E+++  V FSMLEIYNE+IRDLL     + G L +RE++ LGFFV+ L  VP  +Y Q+EK + QG+  R  A+T MNA+SSR+H +I ++F Q+    +T+ TK S+I ++DLAGSER  S+ + GDRL+EG+ +N SL++LGNVI+ALAD   G K   IPYRDSVLTKLL++ALGGNS+T +IAALSPADI Y+ETLSTLRYA+R K+++N A++N  PL +  R         + A   + P                      + ++G Q     +  Q   EW+ + EA           ++  V   P+++N+NEDPQLTG L +FI      VG+       +   + + G GI + HA       K  V++ P  S C V VNG  +     T L   DR++ GS++ +++   P+ +   + + +D++  Q E AAAEG  V             D SIL      ++++P+V E N +S+E+ K    + L +   A + S   + + +VM+++T   T   W+  ++ FINR+F+++E+Y++FL+  +  ++  +DDPFW+P   + +G A V+LQ L + + +   +  ++  G EE  + I+I PC  +G     +D  I D ++LL K    +  I     +   K     G ++ + IY +  T  T    KS+      E+ + + ++  +++ LDY     +I  ++G+Q+
Sbjct:    9 SDSVRVAVRVRPFSQREKNSGSQCVISMHSGNISIRDPKNEERVKTFTFDLTYWSHDGFQKDEDGVLIPSDPASKFAGQSDVFHDIGRGILDSAWRGYNATLLAYGQTGSGKSYSMIGFGTNKGLIPRVCEELFQAIE-KQKENLEPQVMFSMLEIYNEQIRDLL-SRTKAPGGLRVREDQQLGFFVEGLKWVPCENYAQIEKLVEQGSKIRMTASTNMNASSSRSHMLIAIQFKQVF--LDTALTKRSSINMVDLAGSERQRSSGSEGDRLREGSRVNLSLTSLGNVISALADLAMGKKVLHIPYRDSVLTKLLQSALGGNSRTTLIAALSPADICYEETLSTLRYAERAKKVRNRAVINTCPLARASRAENALLLGFRGAGAAEHPACFWA-----------------EQQLGNQGTWAQLLEQARREWEEQYEAL--------TQEQKMVRILPHLLNVNEDPQLTGVLKFFIHNGSCDVGRA------ASNAICLQGLGISDKHASFVNLDGK--VTVAP-HSKCKVIVNGVPV--TGRTKLQHLDRIILGSNSAFLYVGFPSERGAEDLSRFDYDFFQLERAAAEGVSVATLGCVSPGDDQADPSILAVFQDYVKLMPLVVEANQMSEELKKGLTME-LKVKNLASSDSRGYDLQKEVMVKVTKQGTHEVWIWSKAKFINRKFLMEELYQRFLESRD-SHVAQEDDPFWDPLEVVHLGSAHVWLQPLAHCMMLEEQVEFLNCDGLEEAVLHIRITPCSPEGWAHGEEDMVI-DPLELLGKRIDFQTHIVRCLGVKWLKEDGSRGIQMGYGIYDLPNTLYTKPVWKSVNP--RIEETVHFAALGASREFLDYLLTNALIVDLWGLQE 834          
BLAST of Kinesin-like protein vs. UniProt
Match: sp|Q9NGQ2|KIF1_DICDI (Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 2.849e-119
Identity = 240/536 (44.78%), Postives = 339/536 (63.25%), Query Frame = 3
Query:   96 VKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK----------DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIES---KSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ--LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXX--XXXXXXXXXXXXXXXXXGQLPKDINTKGMS---EEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSK------VNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIY--GPGIQEAHAIL 1619
            V+VAVR+RPFN REK+RNA+LI+ M  ++T +  P            A++ K+F+FDYSYWS+D+           + P   +ASQ  V+ DLG++VL NA +G+NCS+FAYGQTGSGKSYSM+GY   KGI+P IC ELF+ I+S    SNE   Y    S +EIYNE+++DLL P N+  G L +R N + G +V+DL K+ V S+ +++  M++G+  RT+A+T MNATSSR+H V T+ F Q  + K+  T+  + S I L+DLAGSERA+ST ATG RLKEGA+INKSLS LG VI+ALA++++  K+  +PYRDSVLT LLK  LGGNSKT+MIAA+SPADINY+E+LSTLRYAD  K+IK VA+VNE+   K     +   E  R  +   GQ   + ++K M+   +E +  L  +IE+  K+  +          ++ W+ K+  A+A   D   + K        V+  P++IN+NEDP ++ +L Y+++  K  +G+      DS  P  I   G  I + H I 
Sbjct:    3 VQVAVRVRPFNSREKERNAELIVQMNNKSTILTRPSALRANPLAAPTADDEKSFSFDYSYWSYDS-----------NDPH--FASQSTVYNDLGKEVLKNAWDGFNCSIFAYGQTGSGKSYSMMGYGEEKGIIPLICEELFQRIQSTPSNSNEQTIYKTTVSYMEIYNEKVKDLLNPNNNKTGGLKVRNNPSTGPYVEDLSKLAVKSFSEIDMLMDEGSKARTVASTNMNATSSRSHAVFTIVFTQSKIDKTRGTAIDRVSKISLVDLAGSERANSTGATGVRLKEGANINKSLSTLGKVISALAENSTSKKAVFVPYRDSVLTYLLKETLGGNSKTIMIAAISPADINYEESLSTLRYADSAKKIKTVAVVNEDAQSKLIRELQGEVERLRAMMDQGGQYHAN-DSKLMNSDYDETVSTLNEKIEQYEKLMAEL---------NKSWEEKLSEAEAIREDRMAALKDMGVAIKVVSSIPHLINLNEDPLMSESLIYYVKEGKTRIGR-----SDSEIPQDIILNGLNIHKEHCIF 510          

HSP 2 Score: 60.4622 bits (145), Expect = 1.107e-7
Identity = 76/285 (26.67%), Postives = 137/285 (48.07%), Query Frame = 3
Query: 1869 RSILESQIIEILPMVFEVNAISQEMNKD-----KKFDVLIIPEQAQALSFKEE---GKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPF-WEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQ----LLKKPYSVKISIDYLSLFKTRFIHGSK-----VKFNI-----YLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQP 2654
            RS L ++I  I+  + E NAIS  +NK      K + V   P+Q  + + + E    K +++I+ T   T  + L+    F++R ++++E+Y+   DG     +P  +DPF +  T D L+G++ VYL+N LY +     + ++D  G ++G +++ +     D +T   +  ++E+       LL K   + I  +  S     FI  +K     +KFN       ++D TF T+       S F  +K I   S+T+  ++  +   + F + G  K SK QP
Sbjct:  706 RSKLLNKISFIILSLNEANAISSTLNKKINLSLKLYSVFPEPDQI-SDNIEPEIDWRKTQILIKATDSSTGESTLVTDQDFVDRIYLMRELYQN--DGRLDTELP--EDPFQFTFTKDSLIGVSHVYLKNTLYLVESNRPVPILDENGNQKGYLNLLVSSSSTD-ITESERGLYLENPSNNKSLLLGKNLEITIGFEGFS----EFIDENKFSDVFIKFNFPNQNGTIVD-TFLTEPQPI---SAFIDQKRIVITSLTESLINLLQTQYVSFEIRG-HKKSKQQP 975          
BLAST of Kinesin-like protein vs. UniProt
Match: sp|B7ZC32|KIF28_HUMAN (Kinesin-like protein KIF28P OS=Homo sapiens OX=9606 GN=KIF28P PE=3 SV=2)

HSP 1 Score: 382.874 bits (982), Expect = 1.888e-115
Identity = 194/366 (53.01%), Postives = 262/366 (71.58%), Query Frame = 3
Query:   81 MPTESVKV--AVRLRPFNQREKDRNAKLIISMAGQTTRIV-NPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVN 1169
            MPT+SV    AVR+RPF+QREK+  +K +ISM  +TT    +PK+  +VKTF FD +YWSH+ F+ D + V++   PS  +A Q+ VF DLG+ +L +A  GYN +L AYGQTGSGKSYSMIG+   +GI+PT+C ELF+ IE++     ++ V FSMLEIY E IRDLL       G L IRE++ LGF+V+ L  VP  +Y Q+E+ M QGT  RT A+T MNA+SSR+H VIT++F Q+    + +   S  I L+DLA SER  S+ + GDRL+EG+ +N SL+ LG+VI+ LAD+  G K   IPYRDSVLTKLL++ALGGNS+T ++AA+SPADI Y+ETLSTLRYA+R ++I+N A+ N
Sbjct:    1 MPTQSVDSVKAVRVRPFSQREKNSGSKCVISMHSRTTTTTQDPKNPEHVKTFTFDLAYWSHNGFQRDKDGVLISADPSRKFAGQRDVFHDLGRGILDSAWQGYNATLLAYGQTGSGKSYSMIGFGCKQGIIPTVCEELFRAIENQGRNQ-EHQVMFSMLEIYKEIIRDLL-SRTKKPGGLRIREDQQLGFYVEGLKSVPCENYAQIERLMEQGTKIRTTASTNMNASSSRSHLVITIQFKQVFLDRDLTKQSS--INLVDLARSERQKSSGSEGDRLREGSCVNLSLTNLGSVISVLADAAMGKKVLHIPYRDSVLTKLLQSALGGNSRTALVAAVSPADICYEETLSTLRYAERERKIRNRAVAN 362          

HSP 2 Score: 158.688 bits (400), Expect = 3.299e-38
Identity = 120/426 (28.17%), Postives = 211/426 (49.53%), Query Frame = 3
Query: 1422 KNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAV--WDWESVQTEIAAAEGFDV------------KDRSILES--QIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDY---LSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSIT--KDHLDYFKDGTIIFCVYGIQK 2636
            +NSK   +  FP+++N++EDPQLT  L YFI+      G  P                I + HA  T    K  V++ P  S C V VNG  I     T L   DRL+ GS++ Y++    ++  S  +  +D++  Q E AAAEG                  S+L +    I+++P+V E N +S+E  K    + L +   A + S   + + +V++++T   +   W+  ++ FINR+F++QE+Y++FLDG++   +   DDPFW+P   + +G A ++LQ+L Y + +   +  ++  G EE  +   I PC   G T   +D  I D ++LL K    +I I     ++  K     G+++ + IY +  T  T    KS+      E+ + + ++T  ++ L+Y +   +I  ++G+Q+
Sbjct:  373 ENSKLLPMMTFPHLLNLSEDPQLTRVLKYFIQ-----AGTQPAPCPRPALSPPHPALRISDKHASFTNADGK--VTVTP-HSKCKVAVNGVPI--TTRTKLQHLDRLILGSNSTYLYVGFPSEWGSEDLSRFDYDFFQLERAAAEGASADKLGAADGGDGKAGPSVLAAFQDYIKLMPLVSEANQMSEEPKKGLNME-LKVKNLASSDSRGYDLQKEVLVKVTHHGSHEVWIWSKAKFINRKFLMQELYQRFLDGDH-GPVARDDDPFWDPVEVVRLGSAHIWLQSLAYCMKLEEQVEFLNCDGLEEAVLHTCIAPCSPTGQTHGEEDVVI-DPLELLGKRMDFQIHIVRCLGVNWMKEDAKRGTQIGYRIYDLPNTIYTKPVWKSVNP--QIEETVQFAALTASQEFLNYLRTNALIVDLWGLQE 783          
BLAST of Kinesin-like protein vs. UniProt
Match: sp|A1ZAJ2|KIF1A_DROME (Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.159e-114
Identity = 261/674 (38.72%), Postives = 365/674 (54.15%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK----DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST----MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSE--EDIQRLRN-------EIEEDLKVGIQFKSEII---------NFQNSEEWQAKIEAADA------QNFDEKNSKKSKVN---------------------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP--VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-----------TAKNRSNAV-------WDWESVQTEIAAAEGFDVK 1865
            SVKVAVR+RPFN RE  R +K II MAG TT I NPK     +++VK FNFDYSYWSHD    D             +++Q  V+ D+G+++L ++ +GYN  +FAYGQTG+GKSY+M+G   E  +GI+P IC +LF  I+    + +KY V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V  Y+ +   +++G   RT+AAT MN TSSR+H V T+ F Q      T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S  K+T     IPYRDS LT LL+  LGGNSKT MIAA+SPADINYDETLSTLRYADR KQI   A+VNE                           D N K + E  E+IQ+LR+       E++E+ ++    KS +I         N   +E    +++A++       + ++EK  +  ++                            K P+++N+NEDP L+  L Y+I+     +G       ++  P  +++ G  I + H   T   K   V++ P   D ++ VNG ++   +   L    R++ G ++++ F NP           T     N V        DW   Q E+   +G D+K
Sbjct:    3 SVKVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFNFDYSYWSHDHHDAD-------------FSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDLFTRIQDTETDDLKYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNE---------------------------DANAKLIRELKEEIQKLRDLLKAEGIEVQEEDELT---KSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLG-----THEANVPQDIQLSGSHILKEHC--TFENKNSTVTLLP-HKDAIIYVNGRKLVEPE--VLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLK 621          
BLAST of Kinesin-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15729630 (tr|R7U173|R7U173_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223727 PE=3 SV=1)

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 462/973 (47.48%), Postives = 650/973 (66.80%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXX--XXXXXXXXXXXXXXXXXGQLP----KDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSE--EWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP-VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAV---WDWESVQTEIAAAEGFD------VKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDG-ENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQPSGNN------------KTP--NQTKIKVSME-YERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKV 2897
            M  ESVKVAVR+RPFNQREKDR AKLII M G+ T I NP      K F FD+SYWSHD F+ D   ++ P G S+ Y+SQ+ VF DLGQ VL NA  GYN SLFAYGQTGSGKSYSM+GY  NKGIVP  C+E+FKTI+    ++ ++ V FSMLEIYNE++RDLL   N  KG L +R+N  +GF+VQDL KVPVGSY+++E+RM QGT++RT+A+TQMNATSSRAHTV+T+ F+Q+IK  +    KSS + L+DLAGSERADST ATGDRLKEGA+INKSLSALGNVI+ALAD +SGNK  ++PYRDSVLTKLL+NALGGNSKT+MIAALSPADINYDETLSTLRYADR K+IKN A+VNENP+++     +   E  +  +   GQ+P    + ++ +G+S E+I ++R E+EE+++  +    E++     E   W+ K+ AA+ ++  E      K NK  ++ N+NEDP L G ++++ +  +  +G+     D  V P V + G  I + HA++T+N  K    ++P       KVNG  +       L+  DR++FGS+++Y+F NPT K+ S  +    DWE  Q EIA A+GFD       KD+ I + Q++EILPMV EVNA+S+E++K + F+V+++   AQ  +   +   KVM++M +++  NTWL ER  F+NRRF++Q++Y+++LDG E++  I  ++DPFWEPT D+L+G A V+LQ+L YG+     L + DYKG+EEG+IS+ + PC + G  LD +D F+++  +LL KPY  K+SI    + K RF  G ++K+ +Y  +K  ET   K +L   FN  ++ ++ S+T+DHL +F +  I F VYG+Q+DS   P  N             +TP  N+     S++  E  ++K+E +L Q   +R  +K +R++++C +W  K   E+ FD LLRSVSA+  SS  K + 
Sbjct:    1 MSGESVKVAVRVRPFNQREKDRGAKLIIGMNGKQTTIKNPDSKEGPKNFAFDFSYWSHDEFEADEEGILQPTG-SNKYSSQRLVFNDLGQGVLNNAFEGYNTSLFAYGQTGSGKSYSMVGYGPNKGIVPITCDEMFKTIQGNQEQNKRFEVTFSMLEIYNEQVRDLLNKDNP-KGGLQVRQNPKIGFYVQDLKKVPVGSYKEIERRMEQGTASRTVASTQMNATSSRAHTVVTITFDQIIKGDSGETKKSSVMNLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADQSSGNKKVLVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLSTLRYADRAKKIKNKAVVNENPVDRLIRELKEENEKLKQMMTGGGQMPLEGSQAMSQEGLSAEEIDKMRKEMEEEIRAQLMANQEMLAGAEGEGPSWEEKLAAANTESMTEAAVPDRK-NKEAHLTNLNEDPLLAGVVFHYFKDGETTIGR----KDADVKPDVILSGLSIMKNHAVITKN--KAEYELRPGMPGAKTKVNGAPL--TGPLTLTHKDRVLFGSNHMYVFCNPTKKDSSADLPDTIDWEFAQKEIAQAKGFDTGAAGLTKDQQIAQEQVLEILPMVSEVNAVSEELDKHRTFEVVLVSAAAQEGALGTQKGTKVMVKMKNLLNGNTWLWERGKFMNRRFLVQDLYQRWLDGDEDVQKIKKEEDPFWEPTEDVLIGNANVFLQSLAYGLDFDDRLAITDYKGQEEGSISVHVAPCTQTGKPLD-EDYFVDNPSELLGKPYHFKVSIRSAEIKKARFSKGIQIKYRVYTNEKITETKMIKGNLSPKFNHSEIFTFSSVTEDHLLFFDNQCITFSVYGVQEDSVADPKLNKMSTKELRQMEHFQTPSTNRRGTVFSLDSSETGQLKSELMLLQKKFDRLEQKEKRMQEICREWEKKAEAEKDFDGLLRSVSAVANSSGTKLRT 961          
BLAST of Kinesin-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23916954 (tr|K1QTK9|K1QTK9_CRAGI Kinesin-related protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10022253 PE=3 SV=1)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 479/979 (48.93%), Postives = 662/979 (67.62%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANN-VKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLG-FFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXI-QLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAA--DAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP-VKIYGPGIQEAHAILTRNAKKENVSIKPLS-SDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP----TAKNRSNAVWDWESVQTEIAAAEGFDV------KDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQ-ALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFE--TDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQP--------------SGNNKTPNQTKIKVSM-----EYERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKV 2897
            MP ESVKVAVR+RPFNQREKDR+AKLII M GQ T I NP+  N   K+F+FDYSYWSHD F+  S+ V+ P G SS YASQ++VF DLGQ VL NA  GYNCSLFAYGQTGSGKSYSM+GY  NKGIVP  C+E+FKT++  ++ + ++ V FSMLEIYNE++RDLL   N  KG L +R+N  LG F+V++L +VPVGSY ++EKR +QGT++RT+A+T MNATSSRAHTV+T+ F+Q+IKS + S TK S++  L+DLAGSERADST ATGDRLKEGA+INKSLSALGNVI+ALAD + G K   M+PYRDSVLTKLL+NALGGNSKT+MIAALSPADINYDETLSTLRYADR K+IKN A+VNENPL+K+IREL+EENERLK A+ G         G++ E++ ++R ++EED++  +     +I  +N++ W  K+  A  + +  D   +  S+ +K  Y+IN+NEDP L+G + +F+ + +  VG+     D S  P + + G  IQ+ HA++    KK  + I+ +S S    K+NG  +   K   L   DR++FGS+++Y+  NP    TA N       WE  Q EIA  +GF        K++ I++ Q++EILPMV EVNA+S+E+NK K F+V++I   AQ      +    KV ++M +++  NTWL ER  FI RR++IQE+Y+KFLDGEN+ NIP + DPFWEPT D+L+G + ++LQ+L Y +     LN+ DYKG+EEG + +K+EPCD  G  +D ++ F++D  +LL KPY  K++++  ++ K+RF  G  VK+++    K  E  T T K +L   FN  KVIS P + +++LD+F+ G I   +YGIQ+D+   P              +  N T N +  + +M       + + +KTE VL Q    R  +K  R++Q+C +WS KP  E++F+P  R+VSA+  S+  + K 
Sbjct:    1 MPDESVKVAVRVRPFNQREKDRSAKLIIKMQGQMTTIANPETPNEEPKSFSFDYSYWSHDGFQEKSDGVLEPAGGSS-YASQRRVFEDLGQGVLDNAFEGYNCSLFAYGQTGSGKSYSMVGYGQNKGIVPITCDEMFKTMDKNADPNKRFEVTFSMLEIYNEQVRDLLSKDNP-KGGLNVRQNPKLGLFYVENLKRVPVGSYAEIEKRTDQGTASRTVASTNMNATSSRAHTVVTITFDQIIKSESGSETKKSSVMNLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSMGTKKKIMVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLSTLRYADRAKKIKNKAVVNENPLDKLIRELKEENERLKKAMEGGGVVMQEGAGLTPEELDKMRKQMEEDIRAQLMANQAMI-AENAQSWDDKLAEARTETEKIDVGGADNSRKSKEAYLINLNEDPMLSGVICHFLNSGETSVGR----KDASPVPNICLSGLSIQKQHAVIFN--KKGVIEIESVSGSGSKTKINGIPLTGRKA--LCHKDRILFGSNHMYVLMNPLKPETADNSLPKEITWEYAQKEIAQVKGFATGSAGLSKEQQIVQEQVLEILPMVSEVNAVSEELNKQKSFEVVLISAAAQEGGDITQSHASKVTVKMKNLLNGNTWLWERGKFITRRYLIQELYQKFLDGENISNIPKEQDPFWEPTEDVLIGTSNLFLQSLSYCLDFEDTLNISDYKGQEEGHLKVKLEPCDNKGKPID-EEAFVDDPHELLNKPYHFKLTVENANIHKSRFSKGIMVKYSVKNNGKVEEVKTPTVKNTLTPTFNHSKVISIPKLKQENLDFFESGCITLSIYGIQEDTMPDPKLLKLNTRELRQMENMENSTANASGRRATMFGNEIASDTSHLKTEVVLLQRKYERLQQKERRMQQICEEWSKKPDGEKQFEPFYRAVSAVANSTGTRLKT 967          
BLAST of Kinesin-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23513323 (tr|A0A210QN17|A0A210QN17_MIZYE Kinesin-like protein KLP6 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14092 PE=3 SV=1)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 461/1023 (45.06%), Postives = 668/1023 (65.30%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANN-VKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLG-FFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQ-LIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALAD-STSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXX--XXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNS-EEWQAKIEAADAQNFDEKN--SKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP-VKIYGPGIQEAHAILTRNAKKENVSIKPL-SSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP----TAKNRSNAVWDWESVQTEIAAAEGFD------VKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQ-----ALSFKEEG-------KPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDK----TFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQPSGNNKTPNQTKIKVSME------------------YERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKVISTIIAKGAILSKGTIKNKNQMKVNSSAP 2984
            MP E VKVAVR+RPFNQREKDR A L+I M+GQ T I NP+  N   K F+FDYSYWSHD   +++ + ++   P S YASQ++VF DLGQ VL NA  GYNCSLFAYGQTGSGKSYSM+GY +N+GIVP  C+ELFKT+ + ++ + ++ V FSMLEIYNE++RDLL   N  KG L +R+N  LG F+V+ L KVPVGSY ++EKRM+QGT++RT+A+T MNATSSRAHTV+++ F+Q+IKS   S TK S++  L+DLAGSERADST ATGDRLKEGA+INKSLSALGNVI+ALAD ST   K  ++PYRDSVLTKLL+NALGGNSKT+MIAALSPADINYDETLSTLRYADR K+IKN A++NENP++K     +   +  +  +   G +     + GMS E++ R++ E+EE+++  +     ++   +S E+W AK+ AA ++  + K   S+  + ++ PY+IN+NEDP L+G + +F++T K  VG+     D    P V + G  IQ+ HA++T   K  N+ IKP   S    KVNG  + + K   LS  DR++FGS+++Y+  NP    TA      V DWE  Q EIA  +GF        KD+ I + Q++E+LPMV EVNA+S+E++K K F+V++I   AQ       +  +EG         +VM++MT+++ SNTWL +R  F+NRR++IQ++Y++FLDG+++  +  ++DPFWEP  ++L+G A  +LQ+L Y +     L + DYKG+EEGT+ + + PCD  G T D +  F+E+  +LL KP+  K+ +    + K+RF  G +V+F++   +K      +T   K SL   FNF KV+S   + K HLD+F+ G++ F VYG+Q+D+  +P+ +  T  + + + +M+                   +++ +K E VL Q    R  +K  R++++C +W  K   E++F+P  R+VSA  FS+  + K    ++ +   L K T K+++ +    ++P
Sbjct:    1 MPEEGVKVAVRVRPFNQREKDRKANLMIKMSGQMTSIANPETPNEEPKKFSFDYSYWSHDGM-VETAEGVLQATPGSSYASQREVFEDLGQGVLDNAFEGYNCSLFAYGQTGSGKSYSMVGYGANRGIVPITCDELFKTMATNADANKRFEVTFSMLEIYNEQVRDLLSREN-PKGGLQVRQNPKLGYFYVEGLKKVPVGSYAEIEKRMDQGTASRTVASTNMNATSSRAHTVVSITFDQIIKSEVGSETKKSSVMNLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSTGSKKKIVVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLSTLRYADRAKKIKNKAVINENPMDKIIRELKEENDRLKKAMESGGMIE---GSAGMSPEELTRMKKEMEEEIRSQLMANQAMLMENDSKEDWDAKLRAAQSETDELKGAVSQNKRRSQEPYLINLNEDPMLSGVICHFLDTEKTTVGR----KDAQPLPDVCLSGLSIQKLHAVITN--KNGNIEIKPAPGSASKTKVNGLPLNDTKV--LSHKDRILFGSNHMYVIMNPKRTDTADKNLPNVIDWEFAQKEIAEIKGFATHSLGLTKDQLIAQEQVLELLPMVSEVNAVSEELDKRKTFEVVLISAAAQEGVASVTAAGQEGVDVNSSNGTRVMVKMTNLLNSNTWLWQRGKFLNRRYLIQDLYQRFLDGDDLSKVSKEEDPFWEPPEEVLIGTANAFLQSLSYALDFEDQLMITDYKGQEEGTLDVTVAPCDAKGKTSDDE-TFVENPNELLNKPFYFKVFVRKAEINKSRFSKGVRVQFSMPFSNKKEPENVQTPIIKNSLSPEFNFSKVLSVNKVQKKHLDFFELGSLTFYVYGLQEDTLPEPNLSKLTTKELRQRNNMKENADTGVRRKTLFGNDIASDQSHLKAEVVLLQRKHERLVQKERRIQEICKEWEKKQEAERQFEPFYRAVSAAAFSTGTRLKTRVQMLNQMLRLQKATRKDESSVPSQLNSP 1009          
BLAST of Kinesin-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17544349 (tr|A7SL10|A7SL10_NEMVE Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g245960 PE=3 SV=1)

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 452/992 (45.56%), Postives = 640/992 (64.52%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLG-FFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXX-IQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAA-DAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAV---WDWESVQTEIAAAEGF-------DVKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQPSGNNKTPNQ---------------TKIKVSMEYERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKVISTIIAKGAILSKGTIKNKNQMKV 2969
            M  ESVKVAVR+RPFN REKDR +K+ + M    T+I +P++ N   K F FD+SYWSHD F+ D N  + P+ P   YA Q+KVF DLG  VL NA  G+NCSLFAYGQTG+GKSYSM+GY  NKGIVP  C+ELFK + + ++ +VKY V FSMLEIYNE++RDLL   N+ KG L +R+N   G F+VQ+L KV VGSYE++E+R  +GT+NRT+AATQMNATSSRAHTV+T+ F+Q++K+ +   TK S+ I L+DLAGSERADST ATGDRLKEGA+INKSLSALGNVI+ALAD + G K  ++PYRDSVLTKLL+NALGGNSKT+MIAALSPADINYDETL TLRYADR K+IKN A+VNENP++K+IREL+EENERLK ++ G +P  ++  GMS E+I+R+R ++EE++K  +      +N ++   W  K++ + D  +  E    + K+N  P+I+N+NEDP L+G + +FIE  +V +G        S+      G  IQ+ HA++T   K   ++IKP +S    KVNG  +    ET L   DR++FGS+++Y   NP  K ++       DW+  Q EIA A+GF         K++ + + Q++E+LP+V E+NA+S+E++K K F+V+++   AQ          KVM++M +++  N WL +R  F+NRRF++QEMY+KF+D E++ N+P ++DPFWEP  D+L+G A V+LQ+L Y +     L   DYKG EE +I + + PC + G +LD +D F+++   LL KP+  K++I    + K RF  G  +K+     ++  +TDT   +L   FN  KV S PSI++ HL++F++G I F VYG Q+DS   P  +  T  +               T   V  +   +++K E +L +    R   K +RL+ +C D+  K   ++ +D   R + A  F    + K     +       KG+  N  Q+K 
Sbjct:    1 MSGESVKVAVRVRPFNSREKDRGSKVCLDMIDALTQIRDPENPNAPPKEFTFDFSYWSHDGFREDENGYLHPEDPK--YADQRKVFDDLGAGVLRNAFEGFNCSLFAYGQTGAGKSYSMVGYGVNKGIVPITCDELFKQMATNTDATVKYQVSFSMLEIYNEQVRDLLC-KNNPKGGLQVRQNPKEGSFYVQNLKKVAVGSYEEIERRTEEGTANRTVAATQMNATSSRAHTVVTIAFDQIMKNESGQETKKSSIINLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSLGKKKVLVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLGTLRYADRAKKIKNKAVVNENPMDKLIRELKEENERLKKSMEGGIP--LSAAGMSPEEIERMRKQMEEEIKAQL-----AMNNESMMSWDDKLQQSRDEGSSSEVQEMQQKLNSVPHIVNLNEDPLLSGVVKHFIEQEEVTIGNKKAEPQPSIV---FSGLSIQKQHAVIT--IKDSEITIKPGTSGAKTKVNGLPL--TGETPLKHMDRILFGSNHMYYLFNPKNKEKNEGSPDRVDWDFAQKEIAEAKGFSTGSGSGQTKEQQLAQEQVLELLPLVSEINAVSEELDKQKTFEVVLVSGAAQG---NIGTGTKVMVKMKNLLNENVWLWDRGKFLNRRFLMQEMYQKFMDSEDI-NVPKEEDPFWEPPEDVLIGTANVFLQSLAYALDFDDKLTATDYKGSEEASIFVNVSPCTQTGKSLD-EDYFVDEPKDLLGKPFHYKVTIRSADIHKARFNKGVYIKYKCLGDEEFTQTDTKANTLSPEFNNSKVFSIPSISEKHLEWFENGCITFMVYGRQEDSIPDPRLSKMTTKELRQMDHIKGPQMGPRTGTIVGADVNVSQLKAETILMKRQLERLQNKEKRLQNICDDFEKK--SDKDYDKFYREIRAAAFYKPGQLKYKVNQLNALMKNQKGSTANGGQVKT 968          
BLAST of Kinesin-like protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16044709 (tr|T1FAR0|T1FAR0_HELRO Kinesin motor domain-containing protein OS=Helobdella robusta OX=6412 GN=20205909 PE=3 SV=1)

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 458/1000 (45.80%), Postives = 638/1000 (63.80%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDA--NNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLG-FFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXX-XXXXXXXXXXXXXXXXGQLPKDIN-TKGMSEEDIQRLRNEIEEDLKVGIQFKSEII--NFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP-VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETN-LSDNDRLVFGSSNLYIFKNPTAKNRS---NAVWDWESVQTEIAAAEGFDV--------KDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKE--EGKP-KVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGE-NMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIY--LIDKTFETDTNKKS---LESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQPS-GNNKTPNQTKIKVSMEY------ERNK------------------MKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKVISTIIAK 2918
            M  E+VKVAVR+RPFNQREKDRNAKL+I M G  T I NP DA     K F FDYSYWSHD +  DS+  + P G SS YASQ+ VF DLG+ VL NA  GYNCSLFAYGQTGSGKSYS+IGY  NKGIVP  C ELFKTI+S  + S +Y V FSMLEIYNE++RDLL    S KG L +R+N   G F+VQ L +VPVGSY +++KRM QGT++RTI +T MNAT SRAHT++T+ F+Q I+SG + N KSST+ L+DLAGSERADST ATGDRLKEGA+INKSLSALGNVI+ALADS+SG K  ++PYRDS+LTKLL+NALGGNSKT+MIAALSPADINYDET+STLRYADR K+IKN AI+NE+P++++      E     +   +G++ + I  TK MS E+I++L+ ++  +    ++   E I  + Q  + W  K+E A A++F   N  +    K P+++NINED  L+G +++F+      +G+     D    P +   G  I + HA + + +      ++P+     VKVNG  I   +E + L+ NDR++FGS++LY+F NP  K +S   +    WE  Q EIA A+GF          +D+ I + Q++E+LP+V EVNA+S+EMNK K FDV+++     AL   E    +P KVM++M  ++T N WL ER  F+NRRFI+Q++Y+  LDG+ +++ IP  +DPFWEP  D+L+G A ++LQ+L Y +    ++ + ++KG +EGT+ + I PC  +G  L   + ++E   +L+ KPY  KI +  L L  +R  HG  V++N+    I +T +TD  K +     + FN   +IS+PS+TK H+++F++G + FCVY +Q D K  P      T    K++ + E       ER K                  +K+E +L Q    R   K  RL++LC +WS K  E++ F+     ++A+ FSS  K K    +I +
Sbjct:    1 MGDETVKVAVRVRPFNQREKDRNAKLVIEMRGNMTLISNP-DAPKEEPKKFTFDYSYWSHDGYSTDSDGTLRPAGNSSKYASQKTVFDDLGRGVLKNAFEGYNCSLFAYGQTGSGKSYSLIGYGPNKGIVPITCGELFKTIDSNKDASKRYEVSFSMLEIYNEQVRDLLT-KESPKGGLPVRQNPQFGSFYVQGLKQVPVGSYVEIDKRMQQGTASRTIGSTDMNATRSRAHTLVTITFDQFIRSGASENKKSSTMNLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADSSSGKKKIVVPYRDSILTKLLQNALGGNSKTIMIAALSPADINYDETVSTLRYADRAKRIKNKAIINEDPMDRLIRELREENERLKEQIKSGKIIEQIEVTKEMSPEEIEKLKKQMMLEAMDKLKVNQEKIEASVQKEKAWSKKLELARAESFININDDRKL--KEPHLMNINEDLLLSGVVFHFLNKGVSRIGR----KDAKPAPDICFSGLSIMKHHADIVKLSDG-TFELRPMEG-AKVKVNGQPI---REAHVLNYNDRVLFGSNHLYVFINPLDKPKSRDADVTVTWEMAQMEIAQAQGFTTTSDMSALSRDKQITQEQVLELLPIVSEVNALSEEMNKYKTFDVVLL-----ALDAYEGINARPTKVMVQMKDLLTQNVWLWERGKFLNRRFIMQDLYQTMLDGDLDIETIPNDEDPFWEPVEDMLLGHANIFLQSLAYLLDFEDSIPIRNFKGDDEGTLKVHILPCSSNGRNL-GDEHYVEQPKELVGKPYHFKILVKSLELHDSRHKHGLYVRYNVRGESIVQT-KTDAGKNTSGCTLATFNHSHIISFPSVTKQHVEFFENGCVTFCVYAVQVDCKPNPKLAKMSTKELRKLESTDELSEKKFSERRKSMMMMMMTSSVTSPDASQLKSEVLLLQRKCERLESKERRLQELCREWSKKSEEDKIFEVFFGQINALAFSSGRKLKTRVKMITQ 980          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif1ab (kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GENE-070912-480])

HSP 1 Score: 395.971 bits (1016), Expect = 7.469e-117
Identity = 267/673 (39.67%), Postives = 370/673 (54.98%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYES--NKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTS--------GNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI-----NTKGM-------------------------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEK----------NSKKSKVNKF-----PYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP-VKIYGPGIQEAHAILTRN--AKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVK 1865
            M   SVKVAVR+RPFN RE  + +K II M+G TT I+NPK     K+FNFDYSYWSH +             P  I +A Q++V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +    +GI+P +C +LF  I   ++ ++ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  +G +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q     +T  +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  S            + IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P  +++REL+EE  RLK  L  Q   DI        GM                               SEE I+RL+             ++E I  + +E W+ K+   +A   + +                V  F     P+++N+NEDP ++  L Y+I+     VG+     D S    + + G  I+E H + T +  A  E V +     D    VNG R+   + T L   +R++ G S+++ F           + P A+     V DW   Q E+   +G D+K
Sbjct:    1 MAGASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTILNPKQPKENKSFNFDYSYWSHTS-------------PEDINFACQKQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPLLCEDLFTKINDNNDNNMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDSDTDNTLEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSLPNKNKKKKKAESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSALSSRAGSISSLHDRIMFSPGSEEAIERLK-------------ETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITKVGR----EDASCRQDIVLSGHFIEEEHCLFTSSTGASGEGVVVLEPCKDAETYVNGKRV--TEPTVLRSGNRIIMGKSHVFRFNDPEQARQERERTPCAETPVEPV-DWAFAQRELLEKQGIDMK 638          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: KIF1C (kinesin-like protein KIF1C [Source:NCBI gene;Acc:103042456])

HSP 1 Score: 372.089 bits (954), Expect = 1.536e-116
Identity = 200/369 (54.20%), Postives = 255/369 (69.11%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDA-NNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYES--NKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXX--XXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALAD--STSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            SVKVAVR+RPFN RE  R+AK +I M G+TT I NPK    + K F FDYSYWSH             D P+  +A Q++V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +    +GI+P +C +LFK     ++  + Y V+ S +EIY ER+RDLL P   S GNL +RE+  +G +V+DL K+ V +Y  +   M+ G   RT+AAT MN TSSR+H V T+ F Q  +   TS    K S I L+DLAGSERADS+ A G RLKEGA+INKSL+ LG VI+ALAD  S+   KS  IPYRDSVLT LLK  LGGNS+T MIAALSPADINY+ETLSTLRYADR KQI+  AI+NE+P
Sbjct:    4 SVKVAVRVRPFNNRESSRDAKCVIQMQGKTTCITNPKQPKESAKNFTFDYSYWSH----------TTEDDPN--FACQRRVYLDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEPDQQGIIPQMCEDLFKRTSENTDPDLSYSVEVSYMEIYCERVRDLLNP--KSGGNLRVREHPIMGPYVEDLSKLAVTTYSDITHLMDCGNKARTVAATNMNETSSRSHAVFTIIFTQRRRDQLTSLDTEKVSKISLVDLAGSERADSSGAKGMRLKEGANINKSLTTLGKVISALADMQSSKKKKSEFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRAKQIRCNAIINEDP 358          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:103027085])

HSP 1 Score: 378.252 bits (970), Expect = 5.453e-113
Identity = 204/372 (54.84%), Postives = 258/372 (69.35%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK-DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALAD-STSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  + +K II M G +T I+NPK    + K+F+FDYSYWSH +          PD P+  +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E  +GI+P +C +LF+ I    N+ + Y V+ + +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q      T  S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ S    KS  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQIK  A++NE+P
Sbjct:    1 MSGASVKVAVRVRPFNSREISKESKCIIQMQGNSTTILNPKAPKESPKSFSFDYSYWSHTS----------PDDPT--FASQNRVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPQLCEDLFEKINDNINDEISYSVEVAYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDTETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDP 358          

HSP 2 Score: 53.1434 bits (126), Expect = 1.703e-6
Identity = 42/164 (25.61%), Postives = 73/164 (44.51%), Query Frame = 3
Query: 1449 KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILT--RNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I    RNA  + + +          VNG R+       L   +R++ G ++++ F           K PTA+     V DW   Q E+   +G D+K    +E ++ E+
Sbjct:  484 KTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRV--MAAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPTAETPVEPV-DWTFAQRELLEKQGIDMKQE--MEKRLTEM 639          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: KIF1C (kinesin-like protein KIF1C [Source:NCBI gene;Acc:103042456])

HSP 1 Score: 374.015 bits (959), Expect = 5.001e-111
Identity = 200/368 (54.35%), Postives = 255/368 (69.29%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDAN-NVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYES--NKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXX--XXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALAD-STSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            SVKVAVR+RPFN RE  R+AK +I M G+TT I NPK    + K F FDYSYWSH   + D N           +A Q++V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +    +GI+P +C +LFK     ++  + Y V+ S +EIY ER+RDLL P   S GNL +RE+  +G +V+DL K+ V +Y  +   M+ G   RT+AAT MN TSSR+H V T+ F Q  +   TS    K S I L+DLAGSERADS+ A G RLKEGA+INKSL+ LG VI+ALAD S+   KS  IPYRDSVLT LLK  LGGNS+T MIAALSPADINY+ETLSTLRYADR KQI+  AI+NE+P
Sbjct:   16 SVKVAVRVRPFNNRESSRDAKCVIQMQGKTTCITNPKQPKESAKNFTFDYSYWSHTTQEDDPN-----------FACQRRVYLDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEPDQQGIIPQMCEDLFKRTSENTDPDLSYSVEVSYMEIYCERVRDLLNP--KSGGNLRVREHPIMGPYVEDLSKLAVTTYSDITHLMDCGNKARTVAATNMNETSSRSHAVFTIIFTQRRRDQLTSLDTEKVSKISLVDLAGSERADSSGAKGMRLKEGANINKSLTTLGKVISALADMSSKKKKSEFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRAKQIRCNAIINEDP 370          

HSP 2 Score: 53.9138 bits (128), Expect = 1.158e-6
Identity = 40/150 (26.67%), Postives = 73/150 (48.67%), Query Frame = 3
Query: 1455 PYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKEN---VSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTA----KNRSNAVW------DWESVQTEIAAAEGFDVK 1865
            P+++N+NEDP ++  L Y+I+     VG+  K +D     +++ G  I+E H +   N        V+++PL       VNG  I   +   L   +R+V G ++++ F +P      + RS+++       DW   Q E+   +G D+K
Sbjct:  518 PHLVNLNEDPLMSECLLYYIKEGVTRVGQ--KDVD-----IRLSGQFIKEQHCVFYCNTNHNGEVVVTLEPLEG-AETYVNGIEI--TEPMALKQGNRIVMGKNHVFRFNHPEQARLERERSSSMEQQGEPVDWSYAQKELLENQGIDIK 657          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif1aa (kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GENE-100913-3])

HSP 1 Score: 377.096 bits (967), Expect = 3.960e-110
Identity = 204/380 (53.68%), Postives = 259/380 (68.16%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYES--NKGIVPTICNELFKTIESKSNE-SVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNK--------STMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  + +K II M+G TT I+NPK     K+FNFDYSYWSH +             P  I YASQQ V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +    +GI+P +C +LF  I   +N+ S+ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q      T  ++ K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  SG           + IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P
Sbjct:    1 MAGASVKVAVRVRPFNSREMSKESKCIIQMSGNTTTILNPKVPKETKSFNFDYSYWSHTS-------------PEDINYASQQLVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEKDQQGIIPLLCEDLFTKINDSNNDNSMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDSETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSGANKNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDP 365          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009202.1 (pep scaffold:Pmarinus_7.0:GL476573:157904:241529:1 gene:ENSPMAG00000008319.1 transcript:ENSPMAT00000009202.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 358/874 (40.96%), Postives = 520/874 (59.50%), Query Frame = 3
Query:   87 TESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDAN-NVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESK---SNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ-LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG-NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEA---ADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKI--YGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTA-------KNRSNAVWDWESVQTEIAA------AEGFDVKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWE-PTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQ 2633
            TE++KVAVR+RPFN+REK R A +IISM G TTRI+ P+  + +VKTF FDYSYWSHD F    N  + P+  +  +A Q++VF+DLG+ +L NA NGYNCSLFAYGQTGSGK+YS++G  +NKGI+P  C  LF+ IE K   + E  ++ V  SM+EIYNE++RDLL P +  +G L IRE  + GFFV++LL VPVGSY  ++ R+ +GT NRTIAAT MNATSSRAHT++ + F Q  +  G  +  KSSTI ++DLAGSERA +T A  +RLKEG  IN+SLS LGNVI ALAD   G  KST++P+RDSVLTKLLKNALGGNSKT+MIAALSPAD+NY+ETLSTLR+ DR K I+  A+VNE+P  +++REL++EN RL+     +L    +   +S        +  E++       + E+ +   S  W+ ++ +   A  Q   E+   + K    P++ N+NEDP L G L +FI    + +G        S  P  I  +G G+   HA +     K+ V I   S +  V +NG  +   +   L+ NDRL+ G+S LY+  +P A        ++    +D    Q EIA       A G +  D +++   ++ +LP ++E N I +E+ K  +F+V++   +      K  G  +V ++MT + +   +L+    F+ RRF++QEMY+++L G++ D +P   DPFWE P S + VG+  V LQ L + + ++    V+D  G+++G + + I+PCD DG     + Q + D  +L+ K   + I I         F   +  +F ++  D+  ET     S   Y NFEK   +  +T++ LDY     +   V G Q
Sbjct:    4 TENIKVAVRVRPFNEREKTRGASIIISMEGNTTRIIKPRSGDADVKTFTFDYSYWSHDGFVALDNGYLAPE--NEQFADQKRVFSDLGEGILENAWNGYNCSLFAYGQTGSGKTYSVVGGSANKGILPLFCERLFEDIERKQESAAEGTEFQVSLSMVEIYNEQVRDLLNPQSGRQGGLRIREKVDHGFFVENLLTVPVGSYGDIDSRIQEGTRNRTIAATHMNATSSRAHTIVAITFVQKAMSDGGHTLQKSSTINIVDLAGSERAGNTGAARERLKEGCMINQSLSTLGNVIKALADQGKGVQKSTVLPFRDSVLTKLLKNALGGNSKTIMIAALSPADVNYEETLSTLRFVDRAKAIRVQAVVNESPTSRLVRELQQENMRLQ-----ELLSQASYGALSNHSWNPCASSWEQN-------RREMEHMAMS--WEQRLASERLAHQQKLKEEKELREKRKTIPHLWNLNEDPALNGLLCHFIPEGSLSIGN-----GKSENPAGIILHGVGVLPHHASVN---NKDGVIILAPSPEARVLINGCPL--TQPALLNHNDRLLLGASQLYVLYDPKAVSVDSGGDHKQTVTFD--KAQEEIACNSGLCMAVGGNSSDDALIWEDLLSLLPALWEGNGIGEELGKGTRFEVVLTASEGHG---KHAGLTQVRVKMTHLASGLEFLLRPREFLGRRFLMQEMYQRYLQGDDWD-LPRDKDPFWECPESTVSVGVVQVALQPLSHQLAVSETYPVLDCHGQKQGHLRVLIQPCDSDGA---PKRQQVGDPNELIGKQLHLLIRILGARGIPEHFTK-THCRFKLFCEDED-ETAEVASSNPDY-NFEKTFFFNPVTEEFLDYIAKSVLTIEVCGTQ 839          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009206.1 (pep scaffold:Pmarinus_7.0:GL476573:157919:195746:1 gene:ENSPMAG00000008319.1 transcript:ENSPMAT00000009206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 422.165 bits (1084), Expect = 1.674e-136
Identity = 218/372 (58.60%), Postives = 275/372 (73.92%), Query Frame = 3
Query:   96 VKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDAN-NVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIES-----KSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ-LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG-NKST---MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            +KVAVR+RPFN+REK R A +IISM G TTRI+ P+  + +VKTF FDYSYWSHD F    N  + P+     +A Q++VF+DLG+ +L NA NGYNCSLFAYGQTGSGK+YS++G  +NKGI+P  C  LF+ IE        + ++   V  SM+EIYNE++RDLL P +  +G L IRE  + GFFV++LL VPVGSY  ++ R+ +GT NRTIAAT MNATSSRAHT++ + F Q  +  G  +  KSSTI ++DLAGSERA +T A  +RLKEG  IN+SLS LGNVI ALAD   G  KST   ++P+RDSVLTKLLKNALGGNSKT+MIAALSPAD+NY+ETLSTLR+ DR K I+  A+VNE+P
Sbjct:    2 IKVAVRVRPFNEREKTRGASIIISMEGNTTRIIKPRSGDADVKTFTFDYSYWSHDGFVALDNGYLAPENEQ--FADQKRVFSDLGEGILENAWNGYNCSLFAYGQTGSGKTYSVVGGSANKGILPLFCERLFEDIERNVEHITGDMALVCNVSLSMVEIYNEQVRDLLNPQSGRQGGLRIREKVDHGFFVENLLTVPVGSYGDIDSRIQEGTRNRTIAATHMNATSSRAHTIVAITFVQKAMSDGGHTLQKSSTINIVDLAGSERAGNTGAARERLKEGCMINQSLSTLGNVIKALADQGKGVQKSTALVLLPFRDSVLTKLLKNALGGNSKTIMIAALSPADVNYEETLSTLRFVDRAKAIRVQAVVNESP 371          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif16bb (kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GENE-070424-241])

HSP 1 Score: 331.257 bits (848), Expect = 4.817e-96
Identity = 186/377 (49.34%), Postives = 233/377 (61.80%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPK---------DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG-------NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNEN 1175
            SVKVAVR+RP NQREK   AK II M G+ T I N K             +K F +DYSY+S              D  S  +ASQ+ V+ D+G DVL  A  GYN  +FAYGQTGSGKSY+M+G   + G++P IC  L++ +    +    Y  + S LEIYNER+RDLL   +S   NL +RE+   G +V+DL K  V +Y  VE+ M  G  NRT AAT MN  SSR+H + T++F Q            S I L+DLAGSERAD+T ATG RLKEG +INKSL  LGNVI++LAD +          K   +PYRDSVLT LLK++LGGNSKT+MIA +SPAD+NY ETLSTLRYA+R K I N   +NE+
Sbjct:    3 SVKVAVRVRPMNQREKGLEAKFIIQMEGKKTVITNLKTPEGSTGDVSRERLKEFTYDYSYFS-------------VDKRSPQFASQEMVYKDIGMDVLDAAFEGYNACIFAYGQTGSGKSYTMMGNPGDLGLIPRICEGLYRGVSQHISSGASYRTEVSYLEIYNERVRDLLRRKSSKSFNLRVREHPKEGPYVEDLSKHLVQNYSDVEELMEAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFDAEMPRETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISSLADLSLSSSSPQGRKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIINKPTINED 366          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005274.1 (pep scaffold:Pmarinus_7.0:GL482849:195:11973:-1 gene:ENSPMAG00000004797.1 transcript:ENSPMAT00000005274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.514 bits (628), Expect = 4.177e-74
Identity = 140/292 (47.95%), Postives = 190/292 (65.07%), Query Frame = 3
Query:  315 ASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNR---TIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG-NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            + Q+ VF  LG  +L NA  GYN  +FAYGQTGSGKSYSM+G     G+ P +C  LF+ +   S +   + V+ S +EIYNE++RDLL P    + +L +RE+K LG +V  L ++ V +++ V      G+  R    + + ++ A+ ++     TL       +  TS  K S + L+DLAGSERA  T A GDRLKEG++INKSLS LG VI+ALAD  +G NK+  +PYRDS LT LLK+ LGGNS+T M+A +SPA  NY+ETLSTLRYADR K+I N A+VNE+P
Sbjct:    1 SGQEVVFHALGDGILDNAFQGYNACIFAYGQTGSGKSYSMMGSAEQPGLTPRLCGALFERVSRLSRDDHSFKVEVSYMEIYNEKVRDLLDP-KGGRQSLKVREHKLLGPYVDGLSQLAVRTFQHVNNLYKIGSKFRPGHRVTSREL-ASCNQGWWGXTLTQTLTDLASGTSGEKVSRLSLVDLAGSERASKTGAAGDRLKEGSNINKSLSTLGLVISALADQAAGKNKNKFVPYRDSALTWLLKDNLGGNSRTAMVATVSPAADNYEETLSTLRYADRAKRIVNHAVVNEDP 290          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 254.988 bits (650), Expect = 6.198e-74
Identity = 162/372 (43.55%), Postives = 223/372 (59.95%), Query Frame = 3
Query:   90 ESVKVAVRLRPFNQREKDRNAKLIISM---AGQTTRIVNPK-DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESN---KGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHT--VITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            E+V+V VR RP N RE   + + +I++   AGQ   I NP+ +A+  +TF FD  Y   DA ++D            IY   ++ F  L   VL     G+N ++FAYGQTG+GK+Y+M G  S+   +G++P     +F  I    N+ V   V+ S LEIY E IRDLL    S +  L +RE  + G  V+DL      S  ++E  M  G  NR++ AT MN  SSR+H   VIT+E ++L  +   S+ +   + L+DLAGSER   T A G+RLKE   IN SLSALGNVI+AL D     KST +PYRDS LT+LL+++LGGN++TVM+A + PA  NYDE+L+TLRYA+R K I+N   VNE+P
Sbjct:   18 ETVRVVVRCRPMNPRESAASYESVITIDVRAGQVA-IRNPRANADPARTFTFDAVYGG-DAKQLD------------IY---EESFRPLVDSVLC----GFNGTIFAYGQTGTGKTYTMEGVRSDPERRGVIPNSFEHIFTHISRSQNQPVPE-VRASYLEIYQEEIRDLLSRDQSRR--LELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSEL-GADGESHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVD----GKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRNRPRVNEDP 360          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 215.698 bits (548), Expect = 6.790e-59
Identity = 132/295 (44.75%), Postives = 180/295 (61.02%), Query Frame = 3
Query:  315 ASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQ---VEKRMN---QGTSNRTIAATQMNATSSRAHTVITLEF---NQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNE 1172
            +SQ +V+ +    +L + ++G+N ++FAYG TG GK+Y++ G  S  GI+     ELF  I    +E   + +  S LEIYNERIRDLL P   SK  L IRE+       Q+ +KV   SY     VE  M+   QG  NRT + T+ N  SSR+H V+ +     N+L+   +     +  + +IDLAGSERA +T   G RL EGA+IN+SL ALGN I AL     G++S  IPYRDS LT+LLK +LGGN KTVMI  +SP+  +YDETL+TL+YA+R K+IK   I N+
Sbjct:  163 SSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKITDLKDEK-DFEISLSYLEIYNERIRDLLKPETPSK-RLVIRED------TQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFAT--LSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALC-LNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQ 446          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 184.496 bits (467), Expect = 4.981e-48
Identity = 135/394 (34.26%), Postives = 205/394 (52.03%), Query Frame = 3
Query:   96 VKVAVRLRPFNQREKDRNAKLIISMAG-QTTRIV-----NPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIG---------------YESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLV------PA-NSSKGNLAIRENKN--LGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQ-----LIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNE 1172
            + V VR R  N+RE +  + ++IS  G Q   I+     +   +++ KT+ FD  + +                     + Q+ VF    ++ +   ++GYNC++FAYGQTG+GK+Y+M G                  + GI+P +  +LFK + S + E   Y V+ S LE+YNE ++DLL       PA N  K  + I +N N      V+ + ++ + S  +    + QG+  R +AAT+ N  SSR+HTV T+  N + +         + ++     L+DLAGSE  + + A   R +E   INKSL  LG VI AL D      S  IPYR+S LT+LL+++LGG +KT +IA +SPA I+ +ET STL YA R K IKN   VN+
Sbjct:   53 IHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAE--------------------SDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKE---YSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD-----HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 418          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 162.54 bits (410), Expect = 1.133e-41
Identity = 101/284 (35.56%), Postives = 165/284 (58.10%), Query Frame = 3
Query:  330 VFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAI-------RENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVA 1160
            VF ++GQ ++ ++++GYN  +FAYGQTGSGK+++M+      GI+P+  + +F  I     +   Y V    +EIYNE I DLL   N++K + +I        + +     + ++    + S E VE  + +    R+ A+T  N  SSR+H++  +  +    +  T      T+ L+DLAGSER + ++  GDRL+E  +INKSLS LG+VI AL    S  +   IP+R+S LT LL+ +L G+SKT+M   +SP+  + +ETL++LR+A +V   + V+
Sbjct:  451 VFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLN--PGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSG--SNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRH--IPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRLVS 727          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 142.51 bits (358), Expect = 2.213e-35
Identity = 125/389 (32.13%), Postives = 178/389 (45.76%), Query Frame = 3
Query:  165 SMAGQTTRIVNPKDANNVKT--------FNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTI-ESKSNESVKYGVQFSMLEIYNERIRDLL------------VPAN--SSKGN-------LAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAAL--------------------------ADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAI 1163
            S  G  T + +P    N KT        F FD+ + SH                     +  +V+    + ++   + G+N ++FAYG TGSGK+++M G E   G++P   + LF  I E   N   K+ V  S LEIYNERI DLL             P+    SK N       L IR++   G  V  L +    S E++ + +  G  +R I  T  NA SSR+H ++ +       +     ++SST+ L DLAGSERA   +   +R KEG+ INKSL ALG VI+ L                          A +   + S  IPYRDS LT+LL+ AL G+S    I  +   +    ET++TLR+A R    KNVA+
Sbjct:  135 SHHGSNTFVRDPWFITNDKTIVHEEIGEFKFDHVFASH--------------------CTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTS--TNVKNGTSRSSTLSLCDLAGSERATGQQ---ERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRA---KNVAL 495          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: SMY1 (Kinesin-like myosin passenger-protein; interacts with Myo2p and enhances its interaction with Sec4p during transport of secretory vesicles; controls actin cable structure and dynamics [Source:SGD;Acc:S000001562])

HSP 1 Score: 136.732 bits (343), Expect = 1.299e-33
Identity = 106/295 (35.93%), Postives = 159/295 (53.90%), Query Frame = 3
Query:  315 ASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVK---YGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMN--QGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADS-TEAT--GDRLKEGASINKSLSALGNVIAAL-------ADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKN 1154
            A+Q+ V   L   ++ + +NGYN ++  YG + SGKSYS+IG + ++GI+P IC  LF T+E   NE  K   + V     EIY E+  DLLVP    K     R +  +   ++D+    VGSYE +   +   Q   NR     +     SR+H V  L   Q  ++      K+S++ L+DL G+E+ D  TE+T   D LK+   +N+S+ AL N + +L       A S  G+ S+   YR+S LT++LK++LGGN KT +I  L+    N   TLSTL + D ++QI N
Sbjct:   85 ATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSKESEGILPNICKTLFDTLE--KNEETKGDSFSVSVLAFEIYMEKTYDLLVPLPERKPLKLHRSSSKMDLEIKDICPAHVGSYEDLRSYIQAVQNVGNRMACGDK--TERSRSHLVFQLHVEQ--RNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKK---LNQSIEALKNTVRSLSMKERDSAYSAKGSHSS--AYRESQLTEVLKDSLGGNRKTKVI--LTCFLSNVPTTLSTLEFGDSIRQINN 366          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO35613 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL10])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 452/992 (45.56%), Postives = 640/992 (64.52%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNV-KTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLG-FFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXX-IQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAA-DAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAV---WDWESVQTEIAAAEGF-------DVKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQPSGNNKTPNQ---------------TKIKVSMEYERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKVISTIIAKGAILSKGTIKNKNQMKV 2969
            M  ESVKVAVR+RPFN REKDR +K+ + M    T+I +P++ N   K F FD+SYWSHD F+ D N  + P+ P   YA Q+KVF DLG  VL NA  G+NCSLFAYGQTG+GKSYSM+GY  NKGIVP  C+ELFK + + ++ +VKY V FSMLEIYNE++RDLL   N+ KG L +R+N   G F+VQ+L KV VGSYE++E+R  +GT+NRT+AATQMNATSSRAHTV+T+ F+Q++K+ +   TK S+ I L+DLAGSERADST ATGDRLKEGA+INKSLSALGNVI+ALAD + G K  ++PYRDSVLTKLL+NALGGNSKT+MIAALSPADINYDETL TLRYADR K+IKN A+VNENP++K+IREL+EENERLK ++ G +P  ++  GMS E+I+R+R ++EE++K  +      +N ++   W  K++ + D  +  E    + K+N  P+I+N+NEDP L+G + +FIE  +V +G        S+      G  IQ+ HA++T   K   ++IKP +S    KVNG  +    ET L   DR++FGS+++Y   NP  K ++       DW+  Q EIA A+GF         K++ + + Q++E+LP+V E+NA+S+E++K K F+V+++   AQ          KVM++M +++  N WL +R  F+NRRF++QEMY+KF+D E++ N+P ++DPFWEP  D+L+G A V+LQ+L Y +     L   DYKG EE +I + + PC + G +LD +D F+++   LL KP+  K++I    + K RF  G  +K+     ++  +TDT   +L   FN  KV S PSI++ HL++F++G I F VYG Q+DS   P  +  T  +               T   V  +   +++K E +L +    R   K +RL+ +C D+  K   ++ +D   R + A  F    + K     +       KG+  N  Q+K 
Sbjct:    1 MSGESVKVAVRVRPFNSREKDRGSKVCLDMIDALTQIRDPENPNAPPKEFTFDFSYWSHDGFREDENGYLHPEDPK--YADQRKVFDDLGAGVLRNAFEGFNCSLFAYGQTGAGKSYSMVGYGVNKGIVPITCDELFKQMATNTDATVKYQVSFSMLEIYNEQVRDLLC-KNNPKGGLQVRQNPKEGSFYVQNLKKVAVGSYEEIERRTEEGTANRTVAATQMNATSSRAHTVVTIAFDQIMKNESGQETKKSSIINLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSLGKKKVLVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLGTLRYADRAKKIKNKAVVNENPMDKLIRELKEENERLKKSMEGGIP--LSAAGMSPEEIERMRKQMEEEIKAQL-----AMNNESMMSWDDKLQQSRDEGSSSEVQEMQQKLNSVPHIVNLNEDPLLSGVVKHFIEQEEVTIGNKKAEPQPSIV---FSGLSIQKQHAVIT--IKDSEITIKPGTSGAKTKVNGLPL--TGETPLKHMDRILFGSNHMYYLFNPKNKEKNEGSPDRVDWDFAQKEIAEAKGFSTGSGSGQTKEQQLAQEQVLELLPLVSEINAVSEELDKQKTFEVVLVSGAAQG---NIGTGTKVMVKMKNLLNENVWLWDRGKFLNRRFLMQEMYQKFMDSEDI-NVPKEEDPFWEPPEDVLIGTANVFLQSLAYALDFDDKLTATDYKGSEEASIFVNVSPCTQTGKSLD-EDYFVDEPKDLLGKPFHYKVTIRSADIHKARFNKGVYIKYKCLGDEEFTQTDTKANTLSPEFNNSKVFSIPSISEKHLEWFENGCITFMVYGRQEDSIPDPRLSKMTTKELRQMDHIKGPQMGPRTGTIVGADVNVSQLKAETILMKRQLERLQNKEKRLQNICDDFEKK--SDKDYDKFYREIRAAAFYKPGQLKYKVNQLNALMKNQKGSTANGGQVKT 968          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO42435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C9])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 357/863 (41.37%), Postives = 508/863 (58.86%), Query Frame = 3
Query:  126 NQREKDRNAKLIISMAGQTTRIVNPK-DANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVK--YGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIX-XXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTS----GNKS-TMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKI---EAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAVW------DWESVQTEIAAAEGFDV-------KDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWE-PTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQK 2636
            N RE  RNA LII+M G +T I +P       K F FD+SYWSHDAFK ++   +    P   YA Q+KVF DLG  VL NA  GYNCSLFAYGQTGSGKSYSM+GY +NKGIVP  C ELFK + +K NE  K  Y V  SMLEIYNE+ RDLL P  + KG L +R++ N GF+V+ L+ VPV SY  ++ R+ +GT NRT+AAT MNATSSRAHT++ + F Q  K     + TK+S + L+DLAGSERA+ST ATGDRLKEG++IN+SLS LGN I  L   +     G K  ++IP+RDSVLTKLLKNALGGNSKT+MIAALSPADINY+ETLSTLR+ADR K IK  A+VNE+P                         D   + + EE+  RL ++I+   K G+  +++    Q  + W+ ++   EA+     +++  +K       +  N+NEDPQL+  + +F+      +G       D    + + G GI   HA ++  +    + I P SS   + VNG  I    ET L  NDR++FGSSNL++  +P    ++           ++  Q EIA   GFD+       K+  +L+  +I+++PMV E  A+++E+ K  +F+V+++  QA+ L   +EG+ +V +RM S+     W+ +R+ F NR+F++QEMY+ +++GE+ D  P + DPFWE   +D+++G A VYLQ L Y I    ++ + D+KG E G + ++  PC K G      D FIED  +L+ K     + I Y      RF   +  KF  Y+  +  +T   + ++   +NF K+ S+  +TK   DY  +  ++  V+G QK
Sbjct:   15 NSRENARNATLIINMVGNSTEIKDPAMPEAEPKKFAFDFSYWSHDAFKENAEGYLEATEPR--YADQKKVFDDLGVGVLENAWKGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPIFCEELFKEVNAKKNEGSKAEYQVALSMLEIYNEQTRDLLNPGGNKKGGLKVRQHPNRGFYVESLMTVPVSSYTDIDNRIGEGTRNRTVAATNMNATSSRAHTIVAINFIQKAKNEAGQNMTKTSVVNLVDLAGSERAESTGATGDRLKEGSAINQSLSTLGNCIKGLLSHSPTRALGRKMFSVIPFRDSVLTKLLKNALGGNSKTIMIAALSPADINYEETLSTLRFADRAKAIKTKAVVNESPT------------------------DKLIRELREEN-ARLLDQIK---KGGVLKRNQEEMEQVKKSWEERLLETEASYKAKEEQERREKEMRKTTAHFWNLNEDPQLSNMIAHFMHAGSHKIGSRKA---DPPADITLSGLGILTDHATVSNTSNV--LKILP-SSGAKLMVNGKPI--TMETELHHNDRVMFGSSNLFVVHHPVELGKACKSGVTLQKITYDMAQEEIAQNSGFDMDKAGGKSKEDLLLQEDLIQLVPMVNEATAMAEELGKKVRFEVMLVSPQARGL---KEGRTEVKVRMHSLEDDAEWVWDRNKFFNRKFLMQEMYQNYVEGEDWDK-PQELDPFWEDDETDVMIGRAIVYLQFLAYKIEFEESVAITDHKGNELGKLQVEAFPCTKSGNEDIDDDDFIEDPEELVGKELFFNLKIPYARGLPQRFGGKTFCKFMFYIDKEYTKTPVIEGTINPNYNFTKMFSFVPVTKQFQDYLVNSNLVIEVWGKQK 835          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO44751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT6])

HSP 1 Score: 540.036 bits (1390), Expect = 3.401e-179
Identity = 328/764 (42.93%), Postives = 470/764 (61.52%), Query Frame = 3
Query:  123 FNQREKDRNAKLIISMAGQTTRIVNPKDANN-VKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVK--YGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIX-XXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEI----INFQNSEE--------WQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPT-AKNRSNAVWD--WESVQTEIAAAEGFDVKDRSIL-------------ESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWE-PTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKI 2315
             N+RE+ R+AKLI+ M G TT + +P   N+  K+F FDYSYWSHD F+ D    +    P+  YA Q++V+ D+G+ VL NA  GYN +LFAYGQTGSGKS+S++GY +NKGIVP  C+E+FK I++K  E  +  Y V FSMLEIYNE++RDLL P++S +G L +R++   GF+ + L  +PV SY+++E RM  GT NRT+AATQMNATSSRAHT++ + F Q  K +      K+S I L+DLAGSERADST ATGDRLKEGA+IN+SLSALGNVI+AL D  +G K+  +PYRDSVLT LLKNAL GNSKT MIAA+SPADINYDETLSTLRYADR KQIK  A VNE+P E                   +L +D+  +    E +  +    E+  K+ +    +     +N  NS +        W+ K++ +  ++ D K  +K K    P++ N+N DPQLTG + + ++  K  +G       D    + + G  IQ+ H I+     K  +++ P   D  V +NG  +  ++E  L   DRL+ GSSNL++F +P  A N  N + D  +E  Q EIA   G +V +   +             E  ++++LPMV + NAIS E+++   F+V+++  +A+  S   EGKP+  + M ++ T   WL  R+ FINR+F+++EMYE + +GE    +P + DPF E P + +++G   V +++L Y + M   LN+ DYKGR+ G +++ I
Sbjct:    1 HNKRERARDAKLIVEMKGPTTMLTDPAAPNDDPKSFTFDYSYWSHDGFEEDDTGYLKGTQPN--YADQRRVYEDVGKTVLQNAWEGYNSTLFAYGQTGSGKSWSIVGYGANKGIVPIFCDEMFKGIDAKKAEGSQDQYEVLFSMLEIYNEKVRDLLNPSSSKQG-LRVRQHPKKGFYAEGLKTLPVSSYQEIEDRMEDGTRNRTVAATQMNATSSRAHTIVGVTFTQKSKNAAGEETAKTSVINLVDLAGSERADSTGATGDRLKEGAAINQSLSALGNVISALVDKANG-KAVRVPYRDSVLTSLLKNALAGNSKTAMIAAISPADINYDETLSTLRYADRAKQIKTTATVNEDPTE-------------------KLIRDLQEQ---NEKLMEMLKAAEKGGKITLTDDDDDEEEGLNMANSAKEMEDMNKNWEDKVKESQLESRD-KEEEKRKRQATPHLWNLNPDPQLTGMIVHLLDDGKNRIGNKKA---DPPADIVLNGLNIQDVHCIINNEGGK--ITVTP-DGDAKVLLNGEPV--SEEEELHHFDRLMLGSSNLFVFHHPKEADNSKNKMEDFTYEMAQEEIARNSGIEVDESKGMRTGSGSRERTGRGEEDMVDLLPMVEQANAISMELDRKVAFEVVLMSAKARGES---EGKPEPYVCMKNLDTGLEWLWPRNKFINRKFLMEEMYENYEEGEEW-RLPDERDPFTESPDAQVMIGCVDVSMESLGYVLDMREQLNIADYKGRDVGVLNVSI 725          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO33740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRC2])

HSP 1 Score: 353.214 bits (905), Expect = 4.879e-110
Identity = 189/380 (49.74%), Postives = 242/380 (63.68%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDAN---------NVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSN--ESVKYGVQFSMLEIYNERIRDLLVPANSSKG--NLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKS-----TMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            SVKVAVR+RP N RE +  AK II M G+ TRI N K  N          VK F+FDYSYWS              D  S  + +Q++VF DLG DV+  A  GYN  +FAYGQTGSGK+Y+M+G+  + G++P IC  +F  +   SN  + V +  + S LEIY ER+RDLL P    +   +L +RE+   G +VQDL K  V  Y  +E  M QG S+R  A+T MN  SSR+H + T+ F Q           +S I L+DLAGSERAD+T ATG+RLKEGA+INKSL  LG VI+ALAD+++G+ S       IPYRDSVLT LLK++LGGNSKT+MIA +SPAD+NY ET+STLRYA+R K I N   +NE+P
Sbjct:    3 SVKVAVRVRPLNNRENNMGAKTIIEMEGKKTRIYNVKGTNVTGEGERKNYVKDFSFDYSYWS-------------VDERSRHFVNQERVFKDLGTDVVKAAFEGYNACIFAYGQTGSGKTYTMMGHNGDTGLIPRICENMFHRMTENSNADDGVSFRTEVSYLEIYQERVRDLLRPPTKGRAAHSLRVREHPKEGPYVQDLTKHLVSDYAAIEHLMEQGNSHRVTASTGMNDVSSRSHAIFTMNFTQAKFDMELPCETASKINLVDLAGSERADATGATGERLKEGANINKSLVTLGTVISALADASTGHGSHGSHHKFIPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYAETMSTLRYANRAKNIMNKPTINEDP 369          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO38591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK0])

HSP 1 Score: 347.051 bits (889), Expect = 2.053e-101
Identity = 244/611 (39.93%), Postives = 356/611 (58.27%), Query Frame = 3
Query:   96 VKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANN--------VKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTV--ITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNK----STMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFD------EKNSKKSKVNKFPYIININEDPQLTGTL-YYFIETSKVIVGKLPKLMDDSVTP-VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP----TAKNRSNAVWDWESVQTEIAAAE 1850
            VKVAVR+RP N+RE D  +K+++ M    T I+ P   N+        V  F FD+ +WS DA K             + +A+Q KV+  LG DVL NA  GYN  +FAYGQTGSGK+Y+M+G   +KGI+P +C  LF+ I    N  + Y V+ S +EIYNE++RDLL P   S  +L +RE+K +G +V+ L K+ V S+E +E  M +G  +RT+AAT+MN  SSR+H V  I L   +      +   K S + L+DLAGSERA  T A GDRLKEG++IN+SL  LG VI++LA+ ++G      +  +PYRDSVLT LLK+ LGGNSKTVM+A +SP+  NY+ETLSTLRYADR K+I N A+VNE+P  +IIRELREE ERLK  L  ++      +   E +IQ + +E  E+L      K   ++++  E+   KI+    +  +      + +    + NKF Y++N+N DP +   L YY  E SK  VG+L    D + TP +++ G GI   H  +  + ++  V + P S +    VNG  +   + T L   DR+++G+++ +    P    +++ +     D+ S Q E+   E
Sbjct:    5 VKVAVRVRPLNRREIDLGSKVVVDMEENQT-ILLPSRGNDRKQAKVRMVHNFAFDHCFWSIDAAK-------------TKFAAQDKVYECLGSDVLENAFEGYNACIFAYGQTGSGKTYTMMGAGEDKGIIPRLCVNLFRGISQNDNHDITYKVEVSYIEIYNEKVRDLLCPRGGS-ASLRVREHKVMGPYVEGLTKLVVSSFEDIEAIMMEGNKSRTVAATRMNTESSRSHAVFNILLARTEYDHQTESIGEKVSKLSLVDLAGSERACKTGAEGDRLKEGSNINRSLVTLGQVISSLAEQSAGKHGKKGAHFVPYRDSVLTWLLKDNLGGNSKTVMVATISPSADNYEETLSTLRYADRAKKIVNHAVVNEDPNARIIRELREEVERLKHLLQSKIAGFPIQEETGELEIQEMISE-NENL-----MKECTMSWEQKEKQTEKIQQERHKALEDMGISIQSSGIGVEKNKF-YLVNLNADPAMNELLVYYLKEHSK--VGRL----DANHTPDIQLGGLGILPEHCEM--DIEENEVYLTP-SPNARTFVNGRDV--KERTLLRHGDRILWGNNHFFRINCPRPPGSSEQQPEQQVDFMSAQQELMMHE 582          

HSP 2 Score: 51.9878 bits (123), Expect = 1.433e-6
Identity = 38/168 (22.62%), Postives = 78/168 (46.43%), Query Frame = 3
Query: 1875 ILESQIIEILPMVFEVNAISQEMNKDKKFDV-LIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKD-----DPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISI---KIEPCDKDGVTLDS 2351
            +L+ ++++   +V E N +S+EMNKD  F V L IP  +        G    +  +    +  T +       N+ + ++E+Y + ++    + +P  D     D F+E     L+G+  V+L+ LL+ +   Y   ++  +G   G + +   ++  CD + V  D+
Sbjct:  676 VLKEEVLKANTLVREANQLSEEMNKDTDFAVTLQIPTSSLTFGKSRSGYSSEVAIVVKHKSRGTQIWSLDKLSNKIYDMRELYNQCIE----EGVPFNDKVDDTDLFFEVECHTLIGVCNVFLECLLHDVSHEYAAPIISQQGEVCGRLKVEVSRVTGCDNESVGSDA 839          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1aa (kinesin-like protein KIF1A [Source:NCBI gene;Acc:101166041])

HSP 1 Score: 409.838 bits (1052), Expect = 2.517e-121
Identity = 272/673 (40.42%), Postives = 377/673 (56.02%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNK---GIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG--------NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI-----NTKGM----------------------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKL--PKLMDDSVTPVKIYGPGIQEAHAILTRNA--KKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVK 1865
            M   SVKVAVR+RPFN RE  + +K II M G TT I +PK A +VK+FNFDYSYWSH +             P  + YASQ +V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +  K   GI+P +C +LF+ I   ++ S+ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  +G +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q      T  ++ K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  SG           + IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P  +++REL++E  RLK  L  Q   DI        GM                            SEE I+RL+             ++E I  + +E W+ K+   +A    E+ +  +++                 K P+++N+NEDP ++  L Y+I+     VG+L   K  D     + + G  IQ+ H   T +     E V ++P        VNG R+   + T L   +R++ G S+++ F           + P A+  S  V DW   Q E+   +G D+K
Sbjct:    1 MAGASVKVAVRVRPFNSREIGKESKCIIQMTGNTTTISHPKQAKDVKSFNFDYSYWSHTS-------------PEDVNYASQMQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQDVKDQQGIIPLLCEDLFRKISDNTDNSMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKAESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKDEVSRLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAGSIASLHDRIMFSPGSEEAIERLK-------------ETEKIIAELNETWEEKLRKTEAIRM-EREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGMTRVGRLDASKHQD-----IGLSGHFIQDEHCTFTSSTGPTGETVVLEPCEG-AETYVNGKRV--TEPTVLRSGNRIILGKSHVFRFNHPAQARAERERTPCAETPSEPV-DWAFAQRELLEKQGIDMK 635          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:101174185])

HSP 1 Score: 397.512 bits (1020), Expect = 6.831e-117
Identity = 273/676 (40.38%), Postives = 375/676 (55.47%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANN-VKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTI-ESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIX--XXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALAD-STSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI------------------NTKGM---------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAIL--TRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            M   SVKVAVR+RPFN RE  + +K II M G TT I+NPK      KTF+FDYSYWSH            P+ PS  +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E  +GI+P +C +LF+ I E  + E + Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q       + S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ S    KS  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR K IK  A++NE+P  K++R+L++E  RLK  L  Q   DI                  N  G+                EE I+RL+             +SE I  + +E W+ K+   +A    E+ +  +++                 K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I    RNA  + + +          VNG R+ +     L   +R++ G ++++ F           K P+A+     V DW   Q E+   +G D+K    +E ++ E+
Sbjct:    1 MSGASVKVAVRVRPFNSREIGKESKCIIQMQGNTTTILNPKAPKEPAKTFSFDYSYWSH----------TTPEDPS--FASQNRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPMLCEDLFEKINEDNNKEELSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDNQTDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKNIKCNAVINEDPNNKLVRDLKDEVARLKELLRAQGLGDILDTPIGSLTASPSSGALCNQGGLQSVTSIQERIMSTPGGEEAIERLK-------------ESEKIIAELNETWEEKLRKTEAIRM-EREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVED--AIQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPV-DWTFAQRELLEKQGIDMKQE--MEKRLTEM 640          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:101174185])

HSP 1 Score: 390.193 bits (1001), Expect = 1.650e-114
Identity = 273/682 (40.03%), Postives = 375/682 (54.99%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANN-VKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGY--ESNKGIVPTICNELFKTI-ESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIX--XXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALAD-------STSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDI------------------NTKGM---------------SEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVN----------------KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILT--RNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEI 1901
            M   SVKVAVR+RPFN RE  + +K II M G TT I+NPK      KTF+FDYSYWSH            P+ PS  +ASQ +V+ D+G+++L +A  GYN  +FAYGQTG+GKSY+M+G   E  +GI+P +C +LF+ I E  + E + Y V+ S +EIY ER+RDLL P N  KGNL +RE+  LG +V+DL K+ V SY  +   M+ G   RT+AAT MN TSSR+H V T+ F Q       + S  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+       S    KS  IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR K IK  A++NE+P  K++R+L++E  RLK  L  Q   DI                  N  G+                EE I+RL+             +SE I  + +E W+ K+   +A    E+ +  +++                 K P+++N+NEDP ++  L Y+I+     VG+        +    + G  I+E H I    RNA  + + +          VNG R+ +     L   +R++ G ++++ F           K P+A+     V DW   Q E+   +G D+K    +E ++ E+
Sbjct:    1 MSGASVKVAVRVRPFNSREIGKESKCIIQMQGNTTTILNPKAPKEPAKTFSFDYSYWSH----------TTPEDPS--FASQNRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEEGQEGIIPMLCEDLFEKINEDNNKEELSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDNQTDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKNIKCNAVINEDPNNKLVRDLKDEVARLKELLRAQGLGDILDTPIGSLTASPSSGALCNQGGLQSVTSIQERIMSTPGGEEAIERLK-------------ESEKIIAELNETWEEKLRKTEAIRM-EREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIV---LSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVED--AIQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPV-DWTFAQRELLEKQGIDMKQE--MEKRLTEM 646          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1aa (kinesin-like protein KIF1A [Source:NCBI gene;Acc:101166041])

HSP 1 Score: 379.793 bits (974), Expect = 5.120e-111
Identity = 202/380 (53.16%), Postives = 260/380 (68.42%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNK---GIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG--------NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  + +K II M G TT I +PK A +VK+FNFDYSYWSH +             P  + YASQ +V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +  K   GI+P +C +LF+ I   ++ S+ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  +G +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q      T  ++ K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  SG           + IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P
Sbjct:    1 MAGASVKVAVRVRPFNSREIGKESKCIIQMTGNTTTISHPKQAKDVKSFNFDYSYWSHTS-------------PEDVNYASQMQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQDVKDQQGIIPLLCEDLFRKISDNTDNSMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKAESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDP 365          

HSP 2 Score: 58.9214 bits (141), Expect = 2.818e-8
Identity = 44/154 (28.57%), Postives = 72/154 (46.75%), Query Frame = 3
Query: 1449 KFPYIININEDPQLTGTLYYFIETSKVIVGKL--PKLMDDSVTPVKIYGPGIQEAHAILTRNA--KKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVK 1865
            K P+++N+NEDP ++  L Y+I+     VG+L   K  D     + + G  IQ+ H   T +     E V ++P        VNG R+   + T L   +R++ G S+++ F           + P A+  S  V DW   Q E+   +G D+K
Sbjct:  504 KTPHLVNLNEDPLMSECLLYYIKDGMTRVGRLDASKHQD-----IGLSGHFIQDEHCTFTSSTGPTGETVVLEPCEG-AETYVNGKRV--TEPTVLRSGNRIILGKSHVFRFNHPAQARAERERTPCAETPSEPV-DWAFAQRELLEKQGIDMK 648          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif1aa (kinesin-like protein KIF1A [Source:NCBI gene;Acc:101166041])

HSP 1 Score: 379.407 bits (973), Expect = 1.012e-110
Identity = 202/380 (53.16%), Postives = 260/380 (68.42%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSI-YASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNK---GIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXX--XXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG--------NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            M   SVKVAVR+RPFN RE  + +K II M G TT I +PK A +VK+FNFDYSYWSH +             P  + YASQ +V+ D+G+++L++A  GYN  +FAYGQTG+GKSY+M+G +  K   GI+P +C +LF+ I   ++ S+ Y V+ S +EIY ER+RDLL P N  KGNL +RE+  +G +V+DL K+ V SY  ++  M+ G   RT+AAT MN TSSR+H V  + F Q      T  ++ K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+  SG           + IPYRDSVLT LL+  LGGNS+T M+AALSPADINYDETLSTLRYADR KQI+  A++NE+P
Sbjct:    1 MAGASVKVAVRVRPFNSREIGKESKCIIQMTGNTTTISHPKQAKDVKSFNFDYSYWSHTS-------------PEDVNYASQMQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQDVKDQQGIIPLLCEDLFRKISDNTDNSMSYSVEVSYMEIYCERVRDLLNPKN--KGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKAESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDP 365          

HSP 2 Score: 59.3066 bits (142), Expect = 2.591e-8
Identity = 44/154 (28.57%), Postives = 72/154 (46.75%), Query Frame = 3
Query: 1449 KFPYIININEDPQLTGTLYYFIETSKVIVGKL--PKLMDDSVTPVKIYGPGIQEAHAILTRNA--KKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIF-----------KNPTAKNRSNAVWDWESVQTEIAAAEGFDVK 1865
            K P+++N+NEDP ++  L Y+I+     VG+L   K  D     + + G  IQ+ H   T +     E V ++P        VNG R+   + T L   +R++ G S+++ F           + P A+  S  V DW   Q E+   +G D+K
Sbjct:  504 KTPHLVNLNEDPLMSECLLYYIKDGMTRVGRLDASKHQD-----IGLSGHFIQDEHCTFTSSTGPTGETVVLEPCEG-AETYVNGKRV--TEPTVLRSGNRIILGKSHVFRFNHPAQARAERERTPCAETPSEPV-DWAFAQRELLEKQGIDMK 648          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000017296.1 (SMESG000017296.1)

HSP 1 Score: 1952.95 bits (5058), Expect = 0.000e+0
Identity = 985/991 (99.39%), Postives = 987/991 (99.60%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQPSGNNKTPNQTKIKVSMEYERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKVISTIIAKGAILSKGTIKNKNQMKVNSSAPGGAKTSNTRSQQDINNSEVCSIM 3053
            MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVK FNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVL NAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIKSGNTSNTKSSTIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPLEKIIRELREENERLKLALNGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYN+NVMDYKGREEGTISIKIEPCDKDGVTLDSQDQF ED+MQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQPSGNNKTPNQTKIKVSMEYERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKVISTIIAKGAILSKGTIKNKNQMKVNSSAPGGAKT NTRSQQDINNSEVCSIM
Sbjct:    1 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKAFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLNNAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIKSGNTSNTKSSTIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPLEKIIRELREENERLKLALNGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNVNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFFEDSMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKHQPSGNNKTPNQTKIKVSMEYERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKVISTIIAKGAILSKGTIKNKNQMKVNSSAPGGAKTRNTRSQQDINNSEVCSIM 991          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000050123.1 (SMESG000050123.1)

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 439/962 (45.63%), Postives = 595/962 (61.85%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXX-XGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQ----NFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKV-----IVGKLPKLMDDS----------------------VTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-TAKNRSN--AVWDWESVQTEIAAAEGFDVKDRSILESQIIEILPMVFEVNAISQEM-NKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGIQKDSKH--------QPSGNNKTPNQTKIK----VSMEYERNKMKTENVLSQALANRQARKIERLKQLCLDWSNKPT 2822
            M  ESVKVAVR+RPFNQREKDR AKL I M G TT I NP+++ + K F FDYSYWSHD F  DSN  ++PDGP+S YASQ+ VF DLG+ VL NA  GYNCSLFAYGQTGSGKSYSM+GY +NKGIVP IC+ELFK +E  S++S++Y V FSMLEIYNE +RDLL      KG L +R+    GFFVQ L K+PVGSY+++E RM QGTS+RT+A T MNATSSRAHTV+ + F+Q+ +S  +   KSS + L+DLAGSERADST ATGDRLKEGA+INKSLS LGNVI+ALAD ++G K T++PYRDSVLTKLL+NALGGNSKTVMIAALSPADINYDETL TLRYADR KQIKN AIVNENP+EK++REL+ ENERLK AL +G LP+ +N +G+S +++  LR EI E+ K  +   SEII  ++ + W A++E A  +    + +EKN +  K +K  +++N+NEDPQL+G + +++ T K+     I GK     DD                       +  + + G  I   HAI+ R   + + +I+P  +    K+NG  +    E  L+  DR++FGS ++Y+F +P   K   N   + DWE  Q EIA A+GF  ++                 V  +++ M NK+  F                                  W+ ER  F++RR+++QEMY++FL+ +++       DPFWEPT ++L+G A V+LQ L + +     + +++Y+G EEG IS+ I P   +G  +D +D F++D   LL + Y   I I  + L   ++  G KV+F I+  +K+FET+T+K S  + FN+ KVIS+  IT++HLDYF  G I F ++  Q DS            +   K P   +I     V    E  K+KT+  +      R  RK  +LK +   +SN  T
Sbjct:    1 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEMNSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKN-EADKRSKLHHLLNLNEDPQLSGIIVHYL-TEKLTLISRISGKEEIDTDDEDLELQKKSKHKKKVKSKPEKIEMNTIVLKGLSISNRHAIIER-KDEHSFTIRPALAGAKTKLNGNTL--TSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTEN-----------------VKGLTKVMDNKNGNF----------------------------------WIWERGKFMSRRYLMQEMYQQFLEDKSLKETISSKDPFWEPTGEVLIGTANVFLQALAFNLDFEDKIPILNYEGNEEGFISVSISPSTSNGRVID-EDNFVDDPKSLLTRTYHFLIGIASVELHNAKYTIGIKVRFRIFKDEKSFETETSKGSKSAVFNYNKVISFARITQEHLDYFLTGYITFRIFVNQDDSNKNVIRLDLLDANSTMKRPENRRISVIPLVDASEEIMKLKTDLTIITRKLERLERKDRKLKMVS--YSNSKT 903          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000050123.1 (SMESG000050123.1)

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 363/679 (53.46%), Postives = 472/679 (69.51%), Query Frame = 3
Query:   81 MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXX-XGQLPKDINTKGMSEEDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQ----NFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKV-----IVGKLPKLMDDS----------------------VTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP-TAKNRSN--AVWDWESVQTEIAAAEGFDV-------KDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQ 1991
            M  ESVKVAVR+RPFNQREKDR AKL I M G TT I NP+++ + K F FDYSYWSHD F  DSN  ++PDGP+S YASQ+ VF DLG+ VL NA  GYNCSLFAYGQTGSGKSYSM+GY +NKGIVP IC+ELFK +E  S++S++Y V FSMLEIYNE +RDLL      KG L +R+    GFFVQ L K+PVGSY+++E RM QGTS+RT+A T MNATSSRAHTV+ + F+Q+ +S  +   KSS + L+DLAGSERADST ATGDRLKEGA+INKSLS LGNVI+ALAD ++G K T++PYRDSVLTKLL+NALGGNSKTVMIAALSPADINYDETL TLRYADR KQIKN AIVNENP+EK++REL+ ENERLK AL +G LP+ +N +G+S +++  LR EI E+ K  +   SEII  ++ + W A++E A  +    + +EKN +  K +K  +++N+NEDPQL+G + +++ T K+     I GK     DD                       +  + + G  I   HAI+ R   + + +I+P  +    K+NG  +    E  L+  DR++FGS ++Y+F +P   K   N   + DWE  Q EIA A+GF         KD+ +++ QI+EILPM+ EVNAIS+E+ K K F+++++P  AQ
Sbjct:    1 MSDESVKVAVRVRPFNQREKDRLAKLTIDMQGNTTIITNPENSTDKKVFTFDYSYWSHDEFVEDSNGFLIPDGPNSRYASQKSVFEDLGKSVLENAFIGYNCSLFAYGQTGSGKSYSMVGYGANKGIVPVICDELFKKMEMNSSDSMRYEVTFSMLEIYNENVRDLLSKEAQPKGGLPVRQTPFQGFFVQGLKKIPVGSYKEIESRMEQGTSSRTVAMTNMNATSSRAHTVVIITFDQITQSNGSDIRKSSIMNLVDLAGSERADSTGATGDRLKEGANINKSLSVLGNVISALADLSNGKKKTIVPYRDSVLTKLLQNALGGNSKTVMIAALSPADINYDETLGTLRYADRAKQIKNKAIVNENPVEKLLRELKVENERLKQALNSGNLPQTVNIQGLSSDEVSELRREIMEEFKAQMSANSEIIAAEDPKIWNARLEEARKEVAIISKEEKN-EADKRSKLHHLLNLNEDPQLSGIIVHYL-TEKLTLISRISGKEEIDTDDEDLELQKKSKHKKKVKSKPEKIEMNTIVLKGLSISNRHAIIERK-DEHSFTIRPALAGAKTKLNGNTL--TSECPLTHKDRILFGSHHMYLFIDPENVKENKNLPKLIDWEYAQNEIAHADGFGTENVKGLTKDQQVVQQQILEILPMISEVNAISEELEKSKTFEIILVPPNAQ 674          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000071604.1 (SMESG000071604.1)

HSP 1 Score: 414.846 bits (1065), Expect = 1.916e-129
Identity = 293/836 (35.05%), Postives = 477/836 (57.06%), Query Frame = 3
Query:  168 MAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIES-----KSNESVKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQ-LIXXXXXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENPXXXXXXXXXXXXXXXXXXXXGQLPKDINTKGMSEEDIQ--RLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNSKKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTP---VKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNPTAKNRSNAVWD--WESVQTEIAA-AEGFDVKDRSILESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVMIRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFWEPTS-DILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDKDGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIYLIDKTFETDTNK-KSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYG 2627
            M GQ T+I   K  +  + F FD S+WS D F +D N    PD PS  Y  Q+ +F  LG+++L NA  GYNC+LFAYGQTGSGK+YS++GY +NKGIVP +C ELF  I+S     K+NE+  + V   +LE+YNE ++DLL P  SSK  L+I++N   GF+    + + V +Y+++ +++     NRTIA+T MN TSSRAHTV+T++FNQ +    N   TK S I L+DLAGSE+   + A GDRL E   IN+SLS LG+ + AL++     K   +P+R+SVLTKLL NALGGNSKTV++A +SP + NY+ET+STLR+A+R K +   A +N +  +KII+ L+E+N RL      Q+ K++  +G+ +  ++  ++  ++++ +K   Q  SEI    + +  QAK E    +   E+   K K+ + P+I N+N+DP L   L YF E    IVG    ++D++ +    ++I G  I   HA    +  ++ V I+P+S+   + +NG +I N  E  L+  DR++FG+S  + F +P   N + AV +   +  + EI   ++ F   +   L  ++ + LP V EVN +++EMN+   ++++I  E     ++ +E   KV +R+      N + +    F +RRF+I +MY +F++G    +     DPF    S  + +G + + L  L++ + +  +L ++++K +E G + ++I  C+K+   +    + IE     +     ++I+I      +  F   SK+       ++ F+T  +K   L+S F+ E  I   ++ K  LDY  +G +   V+G
Sbjct:    1 MNGQITKI---KYEDKERQFKFDNSFWSTDGFIVDENGYAKPDLPS--YVDQRGLFEKLGRNILNNAWEGYNCTLFAYGQTGSGKTYSVMGYYANKGIVPIMCEELFLGIDSKISTLKANEN--FQVLLGVLEVYNENLKDLLNP--SSKEYLSIKDNSEKGFYAHGQIMLRVNNYKEILQKIEFSNKNRTIASTNMNKTSSRAHTVVTIQFNQTMANDKNCLTTKKSLIHLVDLAGSEKVKKSGAEGDRLFEARKINQSLSFLGDCLRALSE-----KHNHVPFRNSVLTKLLMNALGGNSKTVLLATISPCESNYEETMSTLRFAERAKTVTTNAKINVSETDKIIKSLKEDNLRLL-----QIVKELEERGIEKNSVENTKIIAQLQDQIKRNSQEVSEISRSYSEQLDQAKAELEKQKR--EEEIHKLKLKQHPHIYNLNDDPSLNKVLIYFFEKPLTIVGSSKFIVDETKSEKIDIEINGLNILPKHAEFRNDCDQKTVFIRPISNSN-ISINGEQITN--EIKLNHLDRILFGNSFFFFFYDPRIIN-ATAVKEPTIDDARMEITKRSDDFKKMENDRLLEELSKYLPFVEEVNTVAKEMNRKVIYNLVIFQENLPGYNYSDES--KVFVRVFDTNKRNEYFIGLDEFSDRRFVIMDMYNEFIEGVVDISNSSSTDPFLPNESYPVCIGFSSIILVPLVHYLNINEDLKILNFKCQEMGNLIVEIVLCEKNWNQIPEITKNIE-----INDDVHIRINIKEFMFLQNSFFGFSKIFCRFKFQNRWFQTKKSKIIELKSNFSDEFKIQLKNLDKIELDYLTNGELNLEVWG 804          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000071414.1 (SMESG000071414.1)

HSP 1 Score: 339.347 bits (869), Expect = 2.881e-97
Identity = 194/380 (51.05%), Postives = 254/380 (66.84%), Query Frame = 3
Query:   93 SVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFNFDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGYNCSLFAYGQTGSGKSYSMIGYESN---KGIVPTICNELFKTIES----KSNES--VKYGVQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSYEQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIXXX--XXXXXXXXXIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSGNKST-------MIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYADRVKQIKNVAIVNENP 1178
            SVKVAVR+RPFN RE  R+AK IISM G TT I  P      K+F FDYSY S      DSN           + +QQ+V+ DLG+D L +A+ GYN  + AYGQTG+GKSYSM+G   +   +GI+P +C  LFK ++      S+E+  +++ ++ S +EIY ER+RDLL P N  K NL +RE+  LG +V+DL K  V S++ + + ++ G  +RT+AAT MN TSSR+H V T+  +Q I       +  K S I L+DLAGSERADST A G RLKEGA+INKSL+ LG VI+ALA+ +S +KST        IP+RDSVLT LL+  LGGNSKT M+ A+SPADINY+ETLS+LRYADR KQI   A++NE+P
Sbjct:    3 SVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSS--ICPTDSN-----------FVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKN--KNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDP 367          

HSP 2 Score: 64.3142 bits (155), Expect = 5.494e-10
Identity = 42/159 (26.42%), Postives = 81/159 (50.94%), Query Frame = 3
Query: 1449 KFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVKIYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSDNDRLVFGSSNLYIFKNP----------TAKNRSNAVWDWESVQTEIAAAEGFDVKDRSILESQII 1895
            K P ++N+NED  +   L Y+++  +  VG+ P++++ S   + + G  I   H +   N + E+V++  +  D    VNG RI  ++ T+L  +DRL+FG ++++ F NP          T +       DW     E+   +G D+  R  +E++++
Sbjct:  484 KRPNLVNLNEDALMAECLVYYLKDGETKVGQ-PEIVNSSKMDIHLSGDCIMPMHCVF--NCEGEHVTLTAIG-DAECYVNGKRI--HESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDL--RKEMETRLV 634          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF1B1.340e-12140.92kinesin family member 1B [Source:HGNC Symbol;Acc:H... [more]
KIF1A3.689e-12053.83kinesin family member 1A [Source:HGNC Symbol;Acc:H... [more]
KIF1B1.059e-11555.38kinesin family member 1B [Source:HGNC Symbol;Acc:H... [more]
KIF1B1.059e-11555.38kinesin family member 1B [Source:HGNC Symbol;Acc:H... [more]
KIF1A2.938e-11440.89kinesin family member 1A [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-60.000e+040.58Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
unc-1045.723e-10738.16Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1045.723e-10738.16Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1047.034e-10738.16Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1047.034e-10738.16Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1048.483e-11638.72gene:FBgn0267002 transcript:FBtr0346959[more]
unc-1041.062e-11538.72gene:FBgn0267002 transcript:FBtr0330003[more]
unc-1041.156e-11538.72gene:FBgn0267002 transcript:FBtr0113088[more]
unc-1041.156e-11538.72gene:FBgn0267002 transcript:FBtr0113087[more]
unc-1041.581e-11538.72gene:FBgn0267002 transcript:FBtr0087079[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1b1.388e-12141.38kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif1b1.401e-12141.38kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif1aa2.905e-11940.30kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
kif1aa5.954e-11940.12kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
kif1b2.027e-11655.26kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnq46.064e-16536.75potassium channel, voltage gated KQT-like subfamil... [more]
KIF1B5.757e-12141.12kinesin family member 1B [Source:NCBI gene;Acc:100... [more]
KIF1B1.582e-12041.12kinesin family member 1B [Source:NCBI gene;Acc:100... [more]
KIF1B1.690e-12041.12kinesin family member 1B [Source:NCBI gene;Acc:100... [more]
KIF1B6.409e-12040.94kinesin family member 1B [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif282.115e-17637.31kinesin family member 28 [Source:MGI Symbol;Acc:MG... [more]
Kif283.879e-17637.31kinesin family member 28 [Source:MGI Symbol;Acc:MG... [more]
Kif281.533e-12354.40kinesin family member 28 [Source:MGI Symbol;Acc:MG... [more]
Kif1b3.776e-12140.77kinesin family member 1B [Source:MGI Symbol;Acc:MG... [more]
Kif1c5.194e-12054.03kinesin family member 1C [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F8WLE0|KIF28_RAT5.126e-17637.36Kinesin-like protein KIF28P OS=Rattus norvegicus O... [more]
sp|D3YXS5|KIF28_MOUSE1.183e-17537.31Kinesin-like protein KIF28P OS=Mus musculus OX=100... [more]
sp|Q9NGQ2|KIF1_DICDI2.849e-11944.78Kinesin-related protein 1 OS=Dictyostelium discoid... [more]
sp|B7ZC32|KIF28_HUMAN1.888e-11553.01Kinesin-like protein KIF28P OS=Homo sapiens OX=960... [more]
sp|A1ZAJ2|KIF1A_DROME1.159e-11438.72Kinesin-like protein unc-104 OS=Drosophila melanog... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157296300.000e+047.48tr|R7U173|R7U173_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|239169540.000e+048.93tr|K1QTK9|K1QTK9_CRAGI Kinesin-related protein 1 O... [more]
gnl|BL_ORD_ID|235133230.000e+045.06tr|A0A210QN17|A0A210QN17_MIZYE Kinesin-like protei... [more]
gnl|BL_ORD_ID|175443490.000e+045.56tr|A7SL10|A7SL10_NEMVE Predicted protein OS=Nemato... [more]
gnl|BL_ORD_ID|160447090.000e+045.80tr|T1FAR0|T1FAR0_HELRO Kinesin motor domain-contai... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1ab7.469e-11739.67kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GEN... [more]
KIF1C1.536e-11654.20kinesin-like protein KIF1C [Source:NCBI gene;Acc:1... [more]
kif1b5.453e-11354.84kinesin family member 1B [Source:NCBI gene;Acc:103... [more]
KIF1C5.001e-11154.35kinesin-like protein KIF1C [Source:NCBI gene;Acc:1... [more]
kif1aa3.960e-11053.68kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009202.10.000e+040.96pep scaffold:Pmarinus_7.0:GL476573:157904:241529:1... [more]
ENSPMAT00000009206.11.674e-13658.60pep scaffold:Pmarinus_7.0:GL476573:157919:195746:1... [more]
kif16bb4.817e-9649.34kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000005274.14.177e-7447.95pep scaffold:Pmarinus_7.0:GL482849:195:11973:-1 ge... [more]
kif3ca6.198e-7443.55kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP36.790e-5944.75Kinesin-related antiparallel sliding motor protein... [more]
KIP14.981e-4834.26Kinesin-related motor protein; required for mitoti... [more]
KAR31.133e-4135.56Minus-end-directed microtubule motor; functions in... [more]
KIP22.213e-3532.13Kinesin-related motor protein involved in mitotic ... [more]
SMY11.299e-3335.93Kinesin-like myosin passenger-protein; interacts w... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356130.000e+045.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424350.000e+041.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447513.401e-17942.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337404.879e-11049.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385912.053e-10139.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1aa2.517e-12140.42kinesin-like protein KIF1A [Source:NCBI gene;Acc:1... [more]
kif1b6.831e-11740.38kinesin family member 1B [Source:NCBI gene;Acc:101... [more]
kif1b1.650e-11440.03kinesin family member 1B [Source:NCBI gene;Acc:101... [more]
kif1aa5.120e-11153.16kinesin-like protein KIF1A [Source:NCBI gene;Acc:1... [more]
kif1aa1.012e-11053.16kinesin-like protein KIF1A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017296.10.000e+099.39SMESG000017296.1[more]
SMESG000050123.10.000e+045.63SMESG000050123.1[more]
SMESG000050123.10.000e+053.46SMESG000050123.1[more]
SMESG000071604.11.916e-12935.05SMESG000071604.1[more]
SMESG000071414.12.881e-9751.05SMESG000071414.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005493 ID=SMED30005493|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3133bp
CAACAATACTTAATTCCCGAAGGTGATAATAACGAATTTATCAATGAAAA
ATATTTGTCTATAATCACAATTTAGAAGTAATGCCTACCGAGTCAGTTAA
AGTTGCCGTGAGATTACGTCCGTTCAACCAGAGAGAAAAAGACAGAAATG
CGAAACTTATTATTAGTATGGCGGGTCAAACAACCAGAATTGTTAACCCA
AAGGATGCAAATAATGTGAAAACATTCAATTTTGATTATTCATATTGGTC
TCATGATGCATTCAAAATAGACTCCAATCAAGTAATGGTTCCTGACGGCC
CCTCAAGCATTTATGCCAGTCAACAAAAGGTGTTTGCCGATTTAGGGCAA
GACGTTCTGATTAATGCCGTTAATGGATATAACTGCTCCCTATTTGCGTA
TGGGCAGACTGGGTCGGGGAAGTCATATTCCATGATTGGTTATGAAAGCA
ATAAGGGTATCGTACCAACAATATGTAATGAACTCTTCAAAACAATTGAA
TCAAAGTCAAATGAATCTGTGAAATACGGAGTCCAATTCTCAATGCTTGA
AATCTACAATGAACGTATTCGTGACCTCCTCGTTCCTGCTAATTCGTCCA
AAGGAAATCTAGCAATTCGGGAAAATAAAAATTTGGGATTTTTTGTCCAG
GATCTCCTTAAAGTTCCAGTTGGTAGTTATGAGCAAGTTGAAAAACGAAT
GAATCAAGGGACATCGAATAGAACAATTGCTGCTACCCAAATGAACGCTA
CCAGTAGTCGAGCACATACTGTTATAACCCTTGAATTCAATCAACTAATC
AAGTCAGGAAACACTTCTAACACGAAAAGTTCTACCATTCAACTAATTGA
TCTTGCTGGGTCAGAAAGAGCTGATAGTACAGAAGCTACGGGTGACAGAT
TAAAAGAAGGAGCTAGCATTAACAAGTCGTTATCTGCACTGGGAAATGTT
ATTGCGGCTTTGGCGGATTCCACCAGTGGAAACAAAAGCACTATGATCCC
CTACAGAGATTCTGTCTTGACGAAACTGCTTAAAAACGCTCTTGGTGGTA
ACAGCAAAACCGTGATGATTGCTGCGTTATCTCCCGCTGACATCAACTAC
GATGAAACTCTCAGTACGTTACGTTATGCAGACAGAGTAAAGCAAATAAA
AAATGTTGCGATTGTAAATGAAAATCCCCTGGAGAAAATAATAAGAGAAC
TGAGAGAAGAAAACGAGAGATTGAAATTGGCCCTTAACGGTCAGCTGCCG
AAGGACATCAATACAAAAGGCATGTCGGAAGAAGACATTCAGAGGCTGAG
AAATGAAATCGAAGAAGATTTGAAAGTGGGAATCCAGTTTAAATCCGAAA
TTATTAATTTTCAGAATTCTGAAGAATGGCAAGCAAAAATTGAGGCAGCG
GATGCGCAAAATTTCGACGAAAAGAATTCGAAGAAATCAAAAGTTAACAA
GTTTCCGTACATCATCAATATCAATGAAGATCCTCAACTCACAGGCACTC
TATATTATTTTATTGAAACTTCAAAAGTGATCGTTGGTAAACTGCCCAAA
CTTATGGATGATTCAGTGACACCTGTGAAAATTTACGGCCCCGGAATACA
GGAGGCTCATGCAATTTTAACGCGAAATGCTAAAAAGGAAAATGTATCAA
TCAAACCGCTATCTTCGGATTGCGTTGTTAAAGTAAACGGATATCGAATA
GGAAACAACAAGGAAACAAATCTTTCGGACAATGATCGCTTGGTTTTTGG
CAGTTCAAATCTCTACATATTCAAGAATCCAACTGCTAAGAATAGGTCCA
ATGCCGTTTGGGATTGGGAGTCTGTACAAACTGAAATAGCAGCGGCAGAA
GGTTTTGATGTGAAAGATAGGAGCATCCTGGAATCTCAAATCATCGAGAT
TTTGCCTATGGTGTTTGAAGTGAATGCAATTTCCCAGGAAATGAACAAAG
ATAAAAAATTTGATGTGCTCATTATTCCAGAACAAGCTCAAGCTCTTTCT
TTCAAGGAAGAAGGAAAGCCAAAGGTAATGATTAGGATGACTAGTGTGAT
CACTAGCAATACCTGGCTAATGGAGCGCAGCCATTTCATCAATAGGAGGT
TTATTATTCAAGAAATGTACGAAAAGTTTTTAGATGGAGAAAATATGGAT
AATATCCCTTGCAAGGATGATCCATTTTGGGAACCTACCTCGGACATTTT
GGTTGGAATCGCTCCAGTATATCTGCAGAATCTTTTATATGGAATTGGAA
TGACTTACAATTTAAATGTCATGGATTATAAAGGGCGAGAAGAAGGCACT
ATATCCATTAAAATTGAACCTTGCGACAAGGATGGTGTGACTCTCGATTC
ACAAGATCAATTTATCGAGGATGCAATGCAGTTATTGAAAAAGCCATATT
CAGTGAAGATTTCAATAGATTACCTCTCACTATTCAAGACCAGATTTATT
CATGGCAGCAAAGTCAAATTCAACATTTACTTGATTGACAAAACTTTTGA
AACAGACACAAATAAAAAAAGTTTGGAATCTTATTTCAACTTTGAGAAAG
TTATTAGTTGGCCGTCAATCACCAAGGATCATCTGGACTATTTCAAGGAC
GGAACAATTATATTTTGCGTCTATGGCATTCAAAAAGACTCGAAACATCA
ACCAAGTGGCAATAACAAAACACCGAACCAGACTAAGATTAAGGTTTCTA
TGGAATACGAACGGAACAAAATGAAAACCGAAAATGTGCTGTCACAAGCT
CTTGCTAATAGGCAGGCAAGAAAAATTGAGAGATTGAAACAACTGTGTCT
TGATTGGTCCAATAAACCAACCGAAGAACAGAAGTTTGATCCTCTCCTTC
GATCAGTTTCCGCTATTTGCTTTAGCTCTGAAAATAAGTTCAAAGTTATC
TCTACGATAATTGCAAAAGGCGCGATTTTATCCAAAGGAACAATAAAAAA
TAAAAACCAAATGAAAGTCAACAGTTCTGCGCCAGGAGGCGCCAAAACAA
GCAACACGCGGAGCCAGCAAGACATTAACAACAGCGAAGTTTGCTCCATA
ATGTAATCGGATATCATTTTTGTTTTCCTTCTAACTGAAATTATCTTATC
AGAATCTTTATTTTTTTTAAATATTTGGAGTCG
back to top

protein sequence of SMED30005493-orf-1

>SMED30005493-orf-1 ID=SMED30005493-orf-1|Name=SMED30005493-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=992bp
MPTESVKVAVRLRPFNQREKDRNAKLIISMAGQTTRIVNPKDANNVKTFN
FDYSYWSHDAFKIDSNQVMVPDGPSSIYASQQKVFADLGQDVLINAVNGY
NCSLFAYGQTGSGKSYSMIGYESNKGIVPTICNELFKTIESKSNESVKYG
VQFSMLEIYNERIRDLLVPANSSKGNLAIRENKNLGFFVQDLLKVPVGSY
EQVEKRMNQGTSNRTIAATQMNATSSRAHTVITLEFNQLIKSGNTSNTKS
STIQLIDLAGSERADSTEATGDRLKEGASINKSLSALGNVIAALADSTSG
NKSTMIPYRDSVLTKLLKNALGGNSKTVMIAALSPADINYDETLSTLRYA
DRVKQIKNVAIVNENPLEKIIRELREENERLKLALNGQLPKDINTKGMSE
EDIQRLRNEIEEDLKVGIQFKSEIINFQNSEEWQAKIEAADAQNFDEKNS
KKSKVNKFPYIININEDPQLTGTLYYFIETSKVIVGKLPKLMDDSVTPVK
IYGPGIQEAHAILTRNAKKENVSIKPLSSDCVVKVNGYRIGNNKETNLSD
NDRLVFGSSNLYIFKNPTAKNRSNAVWDWESVQTEIAAAEGFDVKDRSIL
ESQIIEILPMVFEVNAISQEMNKDKKFDVLIIPEQAQALSFKEEGKPKVM
IRMTSVITSNTWLMERSHFINRRFIIQEMYEKFLDGENMDNIPCKDDPFW
EPTSDILVGIAPVYLQNLLYGIGMTYNLNVMDYKGREEGTISIKIEPCDK
DGVTLDSQDQFIEDAMQLLKKPYSVKISIDYLSLFKTRFIHGSKVKFNIY
LIDKTFETDTNKKSLESYFNFEKVISWPSITKDHLDYFKDGTIIFCVYGI
QKDSKHQPSGNNKTPNQTKIKVSMEYERNKMKTENVLSQALANRQARKIE
RLKQLCLDWSNKPTEEQKFDPLLRSVSAICFSSENKFKVISTIIAKGAIL
SKGTIKNKNQMKVNSSAPGGAKTSNTRSQQDINNSEVCSIM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR027417P-loop_NTPase
IPR008984SMAD_FHA_dom_sf
IPR001752Kinesin_motor_dom
IPR000253FHA_dom
IPR019821Kinesin_motor_CS
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 367..387
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 458..575
e-value: 6.9E-21
score: 76.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 960..991
NoneNo IPR availablePANTHERPTHR24115:SF586KINESIN-LIKE PROTEINcoord: 31..868
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 99..120
score: 65.83
coord: 306..327
score: 61.78
coord: 252..270
score: 50.61
coord: 219..236
score: 43.75
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 3..364
e-value: 2.3E-158
score: 542.1
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 11..356
e-value: 5.0E-105
score: 351.1
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 5..356
score: 112.042
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 1..367
e-value: 6.2E-139
score: 464.8
IPR000253Forkhead-associated (FHA) domainPFAMPF00498FHAcoord: 501..557
e-value: 1.6E-6
score: 28.3
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 459..564
e-value: 1.63325E-9
score: 53.9294
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 31..868
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 251..262
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..385
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 458..565