FHA domain-containing protein

Overview
NameFHA domain-containing protein
Smed IDSMED30005492
Length (bp)2385
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FHA domain-containing protein (SMED30005492) t-SNE clustered cells

Violin plots show distribution of expression levels for FHA domain-containing protein (SMED30005492) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FHA domain-containing protein (SMED30005492) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FHA domain-containing protein (SMED30005492) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005492

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005492SMESG000051866.1 SmedASXL_010123SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30005492SMESG000051866.1 SmedASXL_010123SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30005492SMESG000051866.1 dd_Smed_v4_8216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005492SMESG000051866.1 dd_Smed_v4_8216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005492SMESG000051866.1 dd_Smed_v4_8216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FHA domain-containing protein vs. Ensembl Human
Match: KDM5B (lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC:18039])

HSP 1 Score: 56.6102 bits (135), Expect = 2.100e-7
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  CL+P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1523 CPAVSCLQPEGDE-VDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRC 1571          
BLAST of FHA domain-containing protein vs. Ensembl Human
Match: KDM5B (lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC:18039])

HSP 1 Score: 56.6102 bits (135), Expect = 2.127e-7
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  CL+P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1482 CPAVSCLQPEGDE-VDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRC 1530          
BLAST of FHA domain-containing protein vs. Ensembl Human
Match: KDM5B (lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC:18039])

HSP 1 Score: 56.6102 bits (135), Expect = 2.128e-7
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  CL+P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1487 CPAVSCLQPEGDE-VDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRC 1535          
BLAST of FHA domain-containing protein vs. Ensembl Human
Match: KDM5B (lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC:18039])

HSP 1 Score: 56.6102 bits (135), Expect = 2.154e-7
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  CL+P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1442 CPAVSCLQPEGDE-VDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRC 1490          
BLAST of FHA domain-containing protein vs. Ensembl Human
Match: KDM5B (lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC:18039])

HSP 1 Score: 56.6102 bits (135), Expect = 2.173e-7
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  CL+P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1446 CPAVSCLQPEGDE-VDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRC 1494          
BLAST of FHA domain-containing protein vs. Ensembl Celegans
Match: rbr-2 (Lysine-specific demethylase rbr-2 [Source:UniProtKB/Swiss-Prot;Acc:Q23541])

HSP 1 Score: 52.373 bits (124), Expect = 1.754e-6
Identity = 22/63 (34.92%), Postives = 35/63 (55.56%), Query Frame = 2
Query: 1148 DYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLD-EAVEDDESYYCPYCVH*KKSPN 1330
            +++ C AR CL+P G++ ++W+MC+  C  WFH  C+G     + D   Y C  C+    SP 
Sbjct: 1410 EFKSCQARACLKPYGDS-VNWVMCEAGCKNWFHVICLGFTLREINDMHEYRCSSCLDHADSPT 1471          
BLAST of FHA domain-containing protein vs. Ensembl Celegans
Match: rbr-2 (Lysine-specific demethylase rbr-2 [Source:UniProtKB/Swiss-Prot;Acc:Q23541])

HSP 1 Score: 51.9878 bits (123), Expect = 2.107e-6
Identity = 22/63 (34.92%), Postives = 35/63 (55.56%), Query Frame = 2
Query: 1148 DYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLD-EAVEDDESYYCPYCVH*KKSPN 1330
            +++ C AR CL+P G++ ++W+MC+  C  WFH  C+G     + D   Y C  C+    SP 
Sbjct: 1377 EFKSCQARACLKPYGDS-VNWVMCEAGCKNWFHVICLGFTLREINDMHEYRCSSCLDHADSPT 1438          
BLAST of FHA domain-containing protein vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0079231)

HSP 1 Score: 57.3806 bits (137), Expect = 6.031e-8
Identity = 28/77 (36.36%), Postives = 39/77 (50.65%), Query Frame = 2
Query: 1085 NNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLDEA-VEDDESYYCPYCV 1309
            NN      K  +R+       D EEC A  C +P G   +DW+ CD  C +WFH  CVGL+ + ++ D+ Y C  C 
Sbjct: 1731 NNATGGQKKHAQRSQQAAQEDDEEECRAENCHKPTGRE-VDWVQCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCT 1806          
BLAST of FHA domain-containing protein vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0079232)

HSP 1 Score: 57.3806 bits (137), Expect = 6.031e-8
Identity = 28/77 (36.36%), Postives = 39/77 (50.65%), Query Frame = 2
Query: 1085 NNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLDEA-VEDDESYYCPYCV 1309
            NN      K  +R+       D EEC A  C +P G   +DW+ CD  C +WFH  CVGL+ + ++ D+ Y C  C 
Sbjct: 1731 NNATGGQKKHAQRSQQAAQEDDEEECRAENCHKPTGRE-VDWVQCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCT 1806          
BLAST of FHA domain-containing protein vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0307070)

HSP 1 Score: 57.3806 bits (137), Expect = 6.031e-8
Identity = 28/77 (36.36%), Postives = 39/77 (50.65%), Query Frame = 2
Query: 1085 NNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLDEA-VEDDESYYCPYCV 1309
            NN      K  +R+       D EEC A  C +P G   +DW+ CD  C +WFH  CVGL+ + ++ D+ Y C  C 
Sbjct: 1731 NNATGGQKKHAQRSQQAAQEDDEEECRAENCHKPTGRE-VDWVQCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCT 1806          
BLAST of FHA domain-containing protein vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0345336)

HSP 1 Score: 57.3806 bits (137), Expect = 6.031e-8
Identity = 28/77 (36.36%), Postives = 39/77 (50.65%), Query Frame = 2
Query: 1085 NNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLDEA-VEDDESYYCPYCV 1309
            NN      K  +R+       D EEC A  C +P G   +DW+ CD  C +WFH  CVGL+ + ++ D+ Y C  C 
Sbjct: 1731 NNATGGQKKHAQRSQQAAQEDDEEECRAENCHKPTGRE-VDWVQCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCT 1806          
BLAST of FHA domain-containing protein vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0307071)

HSP 1 Score: 57.3806 bits (137), Expect = 6.031e-8
Identity = 28/77 (36.36%), Postives = 39/77 (50.65%), Query Frame = 2
Query: 1085 NNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLDEA-VEDDESYYCPYCV 1309
            NN      K  +R+       D EEC A  C +P G   +DW+ CD  C +WFH  CVGL+ + ++ D+ Y C  C 
Sbjct: 1731 NNATGGQKKHAQRSQQAAQEDDEEECRAENCHKPTGRE-VDWVQCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCT 1806          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: kdm5bb (lysine (K)-specific demethylase 5Bb [Source:NCBI gene;Acc:415256])

HSP 1 Score: 60.4622 bits (145), Expect = 8.469e-9
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D   C A  CL+P+GE  +DW+ CD C +WFH  CVG+   +  +E Y C  C
Sbjct: 1390 DSEEDMTLCPAESCLQPEGEE-VDWVQCDCCNRWFHMICVGVSAELAAEEDYMCVSC 1445          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: kdm5bb (lysine (K)-specific demethylase 5Bb [Source:NCBI gene;Acc:415256])

HSP 1 Score: 60.4622 bits (145), Expect = 8.670e-9
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D   C A  CL+P+GE  +DW+ CD C +WFH  CVG+   +  +E Y C  C
Sbjct: 1439 DSEEDMTLCPAESCLQPEGEE-VDWVQCDCCNRWFHMICVGVSAELAAEEDYMCVSC 1494          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: kdm5bb (lysine (K)-specific demethylase 5Bb [Source:NCBI gene;Acc:415256])

HSP 1 Score: 60.4622 bits (145), Expect = 8.914e-9
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D   C A  CL+P+GE  +DW+ CD C +WFH  CVG+   +  +E Y C  C
Sbjct: 1458 DSEEDMTLCPAESCLQPEGEE-VDWVQCDCCNRWFHMICVGVSAELAAEEDYMCVSC 1513          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: kdm5ba (lysine (K)-specific demethylase 5Ba [Source:ZFIN;Acc:ZDB-GENE-030131-5379])

HSP 1 Score: 56.225 bits (134), Expect = 1.809e-7
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYCV 1309
            +S  D+  CSA+ C +P+G   ++W+ CD  C QWFHQ CVG+     ++E Y C  C 
Sbjct: 1415 DSEEDWSVCSAKRCQQPEGNE-VNWVQCDGSCNQWFHQVCVGVSAEQAENEDYICVSCA 1472          
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Match: kdm5ba (lysine (K)-specific demethylase 5Ba [Source:ZFIN;Acc:ZDB-GENE-030131-5379])

HSP 1 Score: 56.225 bits (134), Expect = 1.824e-7
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYCV 1309
            +S  D+  CSA+ C +P+G   ++W+ CD  C QWFHQ CVG+     ++E Y C  C 
Sbjct: 1414 DSEEDWSVCSAKRCQQPEGNE-VNWVQCDGSCNQWFHQVCVGVSAEQAENEDYICVSCA 1471          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: lamp2 (lysosomal-associated membrane protein 2 [Source:Xenbase;Acc:XB-GENE-962456])

HSP 1 Score: 54.6842 bits (130), Expect = 7.086e-7
Identity = 26/71 (36.62%), Postives = 38/71 (53.52%), Query Frame = 2
Query: 1097 TNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            + A+ S     +  S+ D   C A  C+ P+G+  +DW+ CD  C +WFHQ CVGL     + E Y C +C
Sbjct: 1406 SRASDSQSSFTSDESDDDDAFCPADRCMEPEGDE-VDWVQCDGNCNRWFHQVCVGLSAETAEKEDYICTHC 1475          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: lamp2 (lysosomal-associated membrane protein 2 [Source:Xenbase;Acc:XB-GENE-962456])

HSP 1 Score: 54.6842 bits (130), Expect = 7.939e-7
Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  C+ P+G+  +DW+ CD  C +WFHQ CVGL     + E Y C +C
Sbjct: 1457 CPADRCMEPEGDE-VDWVQCDGNCNRWFHQVCVGLSAETAEKEDYICTHC 1505          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: lamp2 (lysosomal-associated membrane protein 2 [Source:Xenbase;Acc:XB-GENE-962456])

HSP 1 Score: 54.6842 bits (130), Expect = 8.051e-7
Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  C+ P+G+  +DW+ CD  C +WFHQ CVGL     + E Y C +C
Sbjct: 1430 CPADRCMEPEGDE-VDWVQCDGNCNRWFHQVCVGLSAETAEKEDYICTHC 1478          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: lamp2 (lysosomal-associated membrane protein 2 [Source:Xenbase;Acc:XB-GENE-962456])

HSP 1 Score: 54.6842 bits (130), Expect = 8.087e-7
Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  C+ P+G+  +DW+ CD  C +WFHQ CVGL     + E Y C +C
Sbjct: 1471 CPADRCMEPEGDE-VDWVQCDGNCNRWFHQVCVGLSAETAEKEDYICTHC 1519          
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Match: lamp2 (lysosomal-associated membrane protein 2 [Source:Xenbase;Acc:XB-GENE-962456])

HSP 1 Score: 54.6842 bits (130), Expect = 8.189e-7
Identity = 22/50 (44.00%), Postives = 30/50 (60.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  C+ P+G+  +DW+ CD  C +WFHQ CVGL     + E Y C +C
Sbjct: 1430 CPADRCMEPEGDE-VDWVQCDGNCNRWFHQVCVGLSAETAEKEDYICTHC 1478          
BLAST of FHA domain-containing protein vs. Ensembl Mouse
Match: Kdm5b (lysine (K)-specific demethylase 5B [Source:MGI Symbol;Acc:MGI:1922855])

HSP 1 Score: 56.9954 bits (136), Expect = 1.123e-7
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  CL+P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1487 CPAVSCLQPEGDE-VDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRC 1535          
BLAST of FHA domain-containing protein vs. Ensembl Mouse
Match: Kdm5a (lysine (K)-specific demethylase 5A [Source:MGI Symbol;Acc:MGI:2136980])

HSP 1 Score: 52.7582 bits (125), Expect = 2.479e-6
Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 2
Query: 1097 TNANKSMKRNVNLNSNYDY---EE-------CSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLDEAVEDDESYYCPYCVH*KKSPN 1330
            +   K  ++ +++ S YD+   EE       C+A+ C RP  +  +DW+ CD  C +WFHQ CVG+   + ++E Y C  C   K+ P+
Sbjct: 1579 STEKKRERKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCKDK-VDWVQCDGGCDEWFHQVCVGVSAEMAENEDYICINCAK-KQGPD 1665          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6IQX0|KD5BB_DANRE (Lysine-specific demethylase 5B-B OS=Danio rerio OX=7955 GN=kdm5bb PE=2 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 6.601e-8
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D   C A  CL+P+GE  +DW+ CD C +WFH  CVG+   +  +E Y C  C
Sbjct: 1439 DSEEDMTLCPAESCLQPEGEE-VDWVQCDCCNRWFHMICVGVSAELAAEEDYMCVSC 1494          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5F3R2|KDM5B_CHICK (Lysine-specific demethylase 5B OS=Gallus gallus OX=9031 GN=KDM5B PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.865e-7
Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYCVH*KKSP 1327
            C A  CL+P+GE  +DW+ CD  C QWFHQ CVG+   + + E Y C  C   K SP
Sbjct: 1465 CPAVTCLQPEGEE-VDWVQCDGSCNQWFHQVCVGISPEMAEKEDYICASCAG-KGSP 1519          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VMJ7|KDM5_DROME (Lysine-specific demethylase lid OS=Drosophila melanogaster OX=7227 GN=lid PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 6.046e-7
Identity = 28/77 (36.36%), Postives = 39/77 (50.65%), Query Frame = 2
Query: 1085 NNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLDEA-VEDDESYYCPYCV 1309
            NN      K  +R+       D EEC A  C +P G   +DW+ CD  C +WFH  CVGL+ + ++ D+ Y C  C 
Sbjct: 1731 NNATGGQKKHAQRSQQAAQEDDEEECRAENCHKPTGRE-VDWVQCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCT 1806          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80Y84|KDM5B_MOUSE (Lysine-specific demethylase 5B OS=Mus musculus OX=10090 GN=Kdm5b PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.855e-7
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  CL+P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1487 CPAVSCLQPEGDE-VDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRC 1535          
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UGL1|KDM5B_HUMAN (Lysine-specific demethylase 5B OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=3)

HSP 1 Score: 56.6102 bits (135), Expect = 1.022e-6
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            C A  CL+P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1487 CPAVSCLQPEGDE-VDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRC 1535          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A448X4P3 (FHA domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS21437 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.430e-51
Identity = 83/148 (56.08%), Postives = 114/148 (77.03%), Query Frame = 2
Query:   80 MSILQFIWVGDLDETKTQRLQNPQALSFDRCHPKKMIVRQDKKETRIGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEIIDKPGP 523
            M+ +  +W+GDLD+ K Q   +  ++S ++  PK++ ++  +KE RIGR NSK PPDY +ES +++RMISRNH TIERLSKG  MLYDHS+NGTY+N+ RV GG ILKH D++CFGH+NGAN+KPGE+V+ F +DLKY+VE +  P P
Sbjct:    1 MTSVSLVWIGDLDQDKRQ-AASYNSISNEKYRPKRIELKPSQKEIRIGRINSKNPPDYPIESCINSRMISRNHATIERLSKGGCMLYDHSMNGTYINYTRVTGGAILKHGDIICFGHLNGANLKPGETVSSFYSDLKYKVE-LSTPSP 146          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: Q86EM5 (Clone ZZD192 mRNA sequence OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 1.939e-49
Identity = 82/146 (56.16%), Postives = 110/146 (75.34%), Query Frame = 2
Query:   80 MSILQFIWVGDLDETKTQRLQNPQALSFDRCHPKKMIVRQDKKETRIGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEIIDKP 517
            MS +   W+GDLD+ K ++     + S D+  PKK+ ++  +KE RIGR N+K+PPDY +ES +++RMISRNH TIER +KG  +LYDHS+NGTYVN+ RV+GG  LKH D+VCFGH+NGAN+KPGE V  F +DLKYRVE+ + P
Sbjct:    1 MSTVTLRWIGDLDQDKREQAGCVSS-SSDQYRPKKIELKPGQKEIRIGRINTKIPPDYPIESCINSRMISRNHATIERSAKGGSILYDHSMNGTYVNYTRVLGGVTLKHGDIVCFGHLNGANLKPGEPVALFYSDLKYRVELSESP 145          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A419QEC0 (FHA domain-containing protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CSKR_12889s PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.008e-49
Identity = 83/144 (57.64%), Postives = 109/144 (75.69%), Query Frame = 2
Query:   80 MSILQFIWVGDLDETKTQRLQNPQALSFDRCHPKKMIVRQDKKETRIGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEIID 511
            MS +   W+GDLD+ K ++     + S D+  PKK+ ++  +KE RIGR N+K PPDY +ES ++NRMISRNH TIER ++G  +LYDHS+NGTYVN+ RVIGG  LKH D+VCFGH+NGAN+KPGE V+ F +DLKYRVE+ D
Sbjct:    1 MSTVTLRWIGDLDQDKREQAGCVSS-SSDQYRPKKIELKPGQKEIRIGRINTKNPPDYPIESCINNRMISRNHATIERSARGGSILYDHSMNGTYVNYTRVIGGVTLKHGDIVCFGHLNGANLKPGEKVSLFYSDLKYRVELSD 143          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A2H1C0L0 (FHA domain protein OS=Fasciola hepatica OX=6192 GN=D915_12156 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 3.574e-49
Identity = 91/161 (56.52%), Postives = 119/161 (73.91%), Query Frame = 2
Query:   80 MSILQFIWVGDLDETKTQRLQNPQALSFDRCHPKKMIVRQDKKETRIGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEIIDKPGPIHEK---SGSVRK 553
            MS +   W+GDLD+ K ++     + S D+  PKK+ ++  +KE RIGR N+KMPPDY +ES +++RMISRNH TIER +KG  MLYDHS+NGTYVN+ RVIGG  LKH D+VCFGH+NGAN+KPGE V+ F +DLKY+VE+ D P P  E    +GSV+K
Sbjct:    1 MSTVTLRWIGDLDQDKREQAGCVSS-SSDQYRPKKIELKPGQKEIRIGRINTKMPPDYPIESCINSRMISRNHATIERSAKGGSMLYDHSMNGTYVNYTRVIGGVTLKHGDIVCFGHLNGANLKPGEKVSLFYSDLKYQVELSDAP-PSKETPANTGSVKK 159          

HSP 2 Score: 65.0846 bits (157), Expect = 2.458e-7
Identity = 44/127 (34.65%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  881 ESRFNDLSVRKRKSGNENNSNPKPGFKKSHESKRPM--KGDEDRRMLSSAVKDRKLHLNQKSHSKPKYSDNNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCV 1255
            E+  N  SV+KRKS   ++ +     ++S E        G++ +R  SSA          KSH K K + ++ + +       + N   +YD EECSARPC +P  +  IDWI CDKCT W+HQ  +
Sbjct:  149 ETPANTGSVKKRKSHMAHSGSTVSSTQRSEEDDDASGDSGNDAKRSKSSAPS------TNKSHGKEKRTKSSKSKSGTDDADASGNEMFHYDTEECSARPCKQPQ-DIAIDWIQCDKCTLWYHQDFI 268          
BLAST of FHA domain-containing protein vs. TrEMBL
Match: A0A5K3FSW1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 3.828e-49
Identity = 83/143 (58.04%), Postives = 108/143 (75.52%), Query Frame = 2
Query:   80 MSILQFIWVGDLDETKTQRLQNPQA-LSFDRCHPKKMIVRQDKKETRIGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEI 505
            MS +  +WVGDL++ K  R+ N    +S +R  PK + +++ +KE RIGR NS  PP Y +ES ++ RMISRNH TIERL+ G +MLYDHS+NGTYVN++RV GG  LKH D+VCFGH+NGAN+KPGE VTPF +DLKY+V I
Sbjct:    1 MSTVSLLWVGDLNQDK--RMANASMKISDERYRPKLIELKEGQKEIRIGRLNSTNPPHYLIESCINKRMISRNHATIERLANGGFMLYDHSMNGTYVNYMRVSGGVTLKHGDIVCFGHLNGANLKPGEDVTPFFSDLKYQVYI 141          
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Match: kdm5ba (lysine (K)-specific demethylase 5Ba [Source:ZFIN;Acc:ZDB-GENE-030131-5379])

HSP 1 Score: 58.9214 bits (141), Expect = 1.976e-8
Identity = 25/58 (43.10%), Postives = 36/58 (62.07%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D+  CSA+ CL+P+G   ++W+ CD  C QWFHQ CVG+     ++E Y C  C
Sbjct: 1340 DSEEDWSVCSAKRCLQPEGNE-VNWVQCDGSCNQWFHQVCVGVSAEQAENEDYICVNC 1396          
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Match: kdm5bb (lysine-specific demethylase 5B-B-like [Source:NCBI gene;Acc:103026437])

HSP 1 Score: 53.1434 bits (126), Expect = 1.248e-6
Identity = 22/57 (38.60%), Postives = 30/57 (52.63%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D   C A  C +P G+  + W+ CD C QWFH  CVG+   +  +E Y C  C
Sbjct: 1404 DSEEDMILCPAESCRQPAGDE-VYWVQCDCCNQWFHMVCVGVSAKMAAEEDYVCVSC 1459          
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Match: kdm5bb (lysine-specific demethylase 5B-B-like [Source:NCBI gene;Acc:103026437])

HSP 1 Score: 52.7582 bits (125), Expect = 1.604e-6
Identity = 22/57 (38.60%), Postives = 30/57 (52.63%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D   C A  C +P G+  + W+ CD C QWFH  CVG+   +  +E Y C  C
Sbjct: 1451 DSEEDMILCPAESCRQPAGDE-VYWVQCDCCNQWFHMVCVGVSAKMAAEEDYVCVSC 1506          
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Match: kdm5bb (lysine-specific demethylase 5B-B-like [Source:NCBI gene;Acc:103026437])

HSP 1 Score: 52.7582 bits (125), Expect = 1.607e-6
Identity = 22/57 (38.60%), Postives = 30/57 (52.63%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D   C A  C +P G+  + W+ CD C QWFH  CVG+   +  +E Y C  C
Sbjct: 1470 DSEEDMILCPAESCRQPAGDE-VYWVQCDCCNQWFHMVCVGVSAKMAAEEDYVCVSC 1525          
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Match: kdm5bb (lysine-specific demethylase 5B-B-like [Source:NCBI gene;Acc:103026437])

HSP 1 Score: 52.7582 bits (125), Expect = 1.653e-6
Identity = 22/57 (38.60%), Postives = 30/57 (52.63%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S  D   C A  C +P G+  + W+ CD C QWFH  CVG+   +  +E Y C  C
Sbjct: 1414 DSEEDMILCPAESCRQPAGDE-VYWVQCDCCNQWFHMVCVGVSAKMAAEEDYVCVSC 1469          
BLAST of FHA domain-containing protein vs. Ensembl Nematostella
Match: EDO34883 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN37])

HSP 1 Score: 53.9138 bits (128), Expect = 2.311e-7
Identity = 22/50 (44.00%), Postives = 31/50 (62.00%), Query Frame = 2
Query: 1160 CSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGL-DEAVEDDESYYCPYC 1306
            C+A  C RP GE  + W+ CD+C +W+H  C+GL  E  E  +SY+C  C
Sbjct: 1003 CAAASCSRPIGEE-VGWVQCDQCERWYHLVCIGLSSERAEALDSYHCKLC 1051          
BLAST of FHA domain-containing protein vs. Ensembl Nematostella
Match: EDO47828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLA5])

HSP 1 Score: 49.2914 bits (116), Expect = 3.355e-6
Identity = 31/98 (31.63%), Postives = 50/98 (51.02%), Query Frame = 2
Query:  218 IGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGN---YMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVE 502
            +GR   K   D  L+S     +ISR H  I   +  +     + D SLNGT+VN  ++I    +K  DVV FGH+ GA + PG       ++ +++++
Sbjct:   34 VGRNPGK--SDVYLDSMKHKALISRLHARIIYTTDNDTAKLTICDTSLNGTFVNDRKIIDTVEVKLGDVVTFGHLRGAVLAPGTVAKQPDSEFRFKLD 129          
BLAST of FHA domain-containing protein vs. Ensembl Medaka
Match: kdm5ba (lysine-specific demethylase 5B [Source:NCBI gene;Acc:101160898])

HSP 1 Score: 55.4546 bits (132), Expect = 2.785e-7
Identity = 26/67 (38.81%), Postives = 36/67 (53.73%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYCVH*KKSPNY 1333
            +S  D+  C+A  C  P+G+  ++W+ CD  C QWFHQ CVGL     + E Y C  C      P+Y
Sbjct: 1414 DSEEDFSLCAAPWCREPEGDE-VNWVQCDGSCNQWFHQVCVGLSAERAEKEDYICISCTQ----PDY 1475          
BLAST of FHA domain-containing protein vs. Ensembl Medaka
Match: kdm5ba (lysine-specific demethylase 5B [Source:NCBI gene;Acc:101160898])

HSP 1 Score: 53.9138 bits (128), Expect = 7.303e-7
Identity = 26/67 (38.81%), Postives = 36/67 (53.73%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYCVH*KKSPNY 1333
            +S  D+  C+A  C  P+G+  ++W+ CD  C QWFHQ CVGL     + E Y C  C      P+Y
Sbjct: 1379 DSEEDFSLCAAPWCREPEGDE-VNWVQCDGSCNQWFHQVCVGLSAERAEKEDYICISCTQ----PDY 1440          
BLAST of FHA domain-containing protein vs. Ensembl Medaka
Match: kdm5bb (lysine-specific demethylase 5B-B [Source:NCBI gene;Acc:101155110])

HSP 1 Score: 53.5286 bits (127), Expect = 9.286e-7
Identity = 23/58 (39.66%), Postives = 33/58 (56.90%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S+ +   C A  C  P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1481 DSDEEMAVCPAEDCQLPEGDE-VDWVQCDGSCNQWFHQVCVGVTPEMAEKEDYVCVTC 1537          
BLAST of FHA domain-containing protein vs. Ensembl Medaka
Match: kdm5bb (lysine-specific demethylase 5B-B [Source:NCBI gene;Acc:101155110])

HSP 1 Score: 53.5286 bits (127), Expect = 9.588e-7
Identity = 23/58 (39.66%), Postives = 33/58 (56.90%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCD-KCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +S+ +   C A  C  P+G+  +DW+ CD  C QWFHQ CVG+   + + E Y C  C
Sbjct: 1462 DSDEEMAVCPAEDCQLPEGDE-VDWVQCDGSCNQWFHQVCVGVTPEMAEKEDYVCVTC 1518          
BLAST of FHA domain-containing protein vs. Ensembl Medaka
Match: kdm5a (lysine demethylase 5A [Source:NCBI gene;Acc:101161451])

HSP 1 Score: 50.8322 bits (120), Expect = 6.989e-6
Identity = 23/58 (39.66%), Postives = 34/58 (58.62%), Query Frame = 2
Query: 1136 NSNYDYEECSARPCLRPDGETLIDWIMCDK-CTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            +SN +   C+A+ C RP  +  +DW+ CD  C +WFHQ CVG+   + + E Y C  C
Sbjct: 1621 DSNDENAVCAAKNCQRPCKDK-VDWVQCDGGCDEWFHQVCVGVSCEMAETEDYICMDC 1677          
BLAST of FHA domain-containing protein vs. Planmine SMEST
Match: SMESG000051866.1 (SMESG000051866.1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 411/411 (100.00%), Postives = 411/411 (100.00%), Query Frame = 2
Query:   80 MSILQFIWVGDLDETKTQRLQNPQALSFDRCHPKKMIVRQDKKETRIGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEIIDKPGPIHEKSGSVRKGXXXXXXXXXXXXXPITTEQKQKKAKHKPLNDKTKKIKVVKREXXXXXXXXXXXXXXXXXXXXXYKKQKKPXXXXXXXXXXXXXXXXXXXXXQFSKKSLDKPKKHSTISESRFNDLSVRKRKSGNENNSNPKPGFKKSHESKRPMKGDEDRRMLSSAVKDRKLHLNQKSHSKPKYSDNNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYCVH 1312
            MSILQFIWVGDLDETKTQRLQNPQALSFDRCHPKKMIVRQDKKETRIGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEIIDKPGPIHEKSGSVRKGENYSQSESSQYEEPITTEQKQKKAKHKPLNDKTKKIKVVKRESDDSDQSSDSSESSNNNLSSSYKKQKKPVDLSSVSSSEDDRLKSSSKDRQFSKKSLDKPKKHSTISESRFNDLSVRKRKSGNENNSNPKPGFKKSHESKRPMKGDEDRRMLSSAVKDRKLHLNQKSHSKPKYSDNNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYCVH
Sbjct:    1 MSILQFIWVGDLDETKTQRLQNPQALSFDRCHPKKMIVRQDKKETRIGRKNSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVRVIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEIIDKPGPIHEKSGSVRKGENYSQSESSQYEEPITTEQKQKKAKHKPLNDKTKKIKVVKRESDDSDQSSDSSESSNNNLSSSYKKQKKPVDLSSVSSSEDDRLKSSSKDRQFSKKSLDKPKKHSTISESRFNDLSVRKRKSGNENNSNPKPGFKKSHESKRPMKGDEDRRMLSSAVKDRKLHLNQKSHSKPKYSDNNGNTNANKSMKRNVNLNSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYCVH 411          
BLAST of FHA domain-containing protein vs. Planmine SMEST
Match: SMESG000015058.1 (SMESG000015058.1)

HSP 1 Score: 53.1434 bits (126), Expect = 9.172e-7
Identity = 19/51 (37.25%), Postives = 31/51 (60.78%), Query Frame = 2
Query: 1154 EECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVEDDESYYCPYC 1306
            ++CSA  C++   E  ++W+ CD C QWFH  CV +   +E ++ + CP C
Sbjct: 1839 DDCSADMCVQQSSEK-VNWVACDSCDQWFHWLCVDIKSEIEIEQKFLCPRC 1888          
The following BLAST results are available for this feature:
BLAST of FHA domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KDM5B2.100e-746.00lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM5B2.127e-746.00lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM5B2.128e-746.00lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM5B2.154e-746.00lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM5B2.173e-746.00lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rbr-21.754e-634.92Lysine-specific demethylase rbr-2 [Source:UniProt... [more]
rbr-22.107e-634.92Lysine-specific demethylase rbr-2 [Source:UniProt... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lid6.031e-836.36gene:FBgn0031759 transcript:FBtr0079231[more]
lid6.031e-836.36gene:FBgn0031759 transcript:FBtr0079232[more]
lid6.031e-836.36gene:FBgn0031759 transcript:FBtr0307070[more]
lid6.031e-836.36gene:FBgn0031759 transcript:FBtr0345336[more]
lid6.031e-836.36gene:FBgn0031759 transcript:FBtr0307071[more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm5bb8.469e-942.11lysine (K)-specific demethylase 5Bb [Source:NCBI g... [more]
kdm5bb8.670e-942.11lysine (K)-specific demethylase 5Bb [Source:NCBI g... [more]
kdm5bb8.914e-942.11lysine (K)-specific demethylase 5Bb [Source:NCBI g... [more]
kdm5ba1.809e-740.68lysine (K)-specific demethylase 5Ba [Source:ZFIN;A... [more]
kdm5ba1.824e-740.68lysine (K)-specific demethylase 5Ba [Source:ZFIN;A... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lamp27.086e-736.62lysosomal-associated membrane protein 2 [Source:Xe... [more]
lamp27.939e-744.00lysosomal-associated membrane protein 2 [Source:Xe... [more]
lamp28.051e-744.00lysosomal-associated membrane protein 2 [Source:Xe... [more]
lamp28.087e-744.00lysosomal-associated membrane protein 2 [Source:Xe... [more]
lamp28.189e-744.00lysosomal-associated membrane protein 2 [Source:Xe... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Kdm5b1.123e-746.00lysine (K)-specific demethylase 5B [Source:MGI Sym... [more]
Kdm5a2.479e-632.58lysine (K)-specific demethylase 5A [Source:MGI Sym... [more]
back to top
BLAST of FHA domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6IQX0|KD5BB_DANRE6.601e-842.11Lysine-specific demethylase 5B-B OS=Danio rerio OX... [more]
sp|Q5F3R2|KDM5B_CHICK1.865e-747.37Lysine-specific demethylase 5B OS=Gallus gallus OX... [more]
sp|Q9VMJ7|KDM5_DROME6.046e-736.36Lysine-specific demethylase lid OS=Drosophila mela... [more]
sp|Q80Y84|KDM5B_MOUSE7.855e-746.00Lysine-specific demethylase 5B OS=Mus musculus OX=... [more]
sp|Q9UGL1|KDM5B_HUMAN1.022e-646.00Lysine-specific demethylase 5B OS=Homo sapiens OX=... [more]
back to top
BLAST of FHA domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448X4P31.430e-5156.08FHA domain-containing protein (Fragment) OS=Protop... [more]
Q86EM51.939e-4956.16Clone ZZD192 mRNA sequence OS=Schistosoma japonicu... [more]
A0A419QEC02.008e-4957.64FHA domain-containing protein (Fragment) OS=Clonor... [more]
A0A2H1C0L03.574e-4956.52FHA domain protein OS=Fasciola hepatica OX=6192 GN... [more]
A0A5K3FSW13.828e-4958.04Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm5ba1.976e-843.10lysine (K)-specific demethylase 5Ba [Source:ZFIN;A... [more]
kdm5bb1.248e-638.60lysine-specific demethylase 5B-B-like [Source:NCBI... [more]
kdm5bb1.604e-638.60lysine-specific demethylase 5B-B-like [Source:NCBI... [more]
kdm5bb1.607e-638.60lysine-specific demethylase 5B-B-like [Source:NCBI... [more]
kdm5bb1.653e-638.60lysine-specific demethylase 5B-B-like [Source:NCBI... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FHA domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FHA domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO348832.311e-744.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478283.355e-631.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FHA domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm5ba2.785e-738.81lysine-specific demethylase 5B [Source:NCBI gene;A... [more]
kdm5ba7.303e-738.81lysine-specific demethylase 5B [Source:NCBI gene;A... [more]
kdm5bb9.286e-739.66lysine-specific demethylase 5B-B [Source:NCBI gene... [more]
kdm5bb9.588e-739.66lysine-specific demethylase 5B-B [Source:NCBI gene... [more]
kdm5a6.989e-639.66lysine demethylase 5A [Source:NCBI gene;Acc:101161... [more]
back to top
BLAST of FHA domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000051866.10.000e+0100.00SMESG000051866.1[more]
SMESG000015058.19.172e-737.25SMESG000015058.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005492 ID=SMED30005492|Name=FHA domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2385bp
ATATATTTTGATGTTTATCAAAGAACTCTTATCCAATATATTTTGAAATT
AGCAAAAGAAATTATTTTTTTAATTTTAGATGAGTATTCTACAGTTTATT
TGGGTTGGAGATTTAGATGAAACAAAAACGCAAAGACTCCAGAACCCCCA
GGCTTTGTCCTTTGATCGATGCCATCCCAAGAAAATGATAGTCAGACAAG
ATAAAAAAGAAACACGTATTGGTAGAAAAAATTCTAAAATGCCCCCAGAT
TACGCATTAGAGAGTGCAGTTAGTAATCGTATGATCTCAAGGAACCATGT
AACTATTGAAAGATTAAGCAAAGGAAATTATATGCTATACGATCACAGTT
TAAACGGGACATATGTAAATTTTGTTCGCGTAATTGGTGGAACTATTCTA
AAGCATGAAGATGTTGTATGCTTCGGACATATAAATGGTGCAAATATTAA
ACCAGGGGAATCAGTTACACCATTTGCTACTGATCTAAAATATCGAGTCG
AAATAATAGATAAACCAGGCCCAATTCACGAAAAATCTGGTTCTGTTAGA
AAAGGAGAGAATTATTCTCAATCAGAATCTAGTCAATATGAAGAACCAAT
TACGACAGAACAGAAGCAGAAAAAAGCTAAGCATAAACCATTAAATGACA
AAACTAAAAAAATTAAAGTAGTTAAACGTGAATCAGATGATTCAGATCAA
TCTTCAGATTCTTCAGAAAGTAGTAATAATAATCTAAGCAGTAGTTATAA
AAAGCAAAAGAAACCAGTTGATTTGTCATCTGTATCGAGTTCAGAAGACG
ATAGATTAAAAAGTTCTAGTAAAGATCGTCAATTTTCTAAAAAATCATTA
GATAAACCGAAGAAACATTCCACAATATCAGAGTCTCGTTTCAACGATTT
ATCGGTCCGTAAACGCAAATCCGGTAATGAAAATAACTCGAACCCGAAGC
CTGGTTTCAAAAAGTCACATGAATCGAAAAGACCAATGAAAGGTGATGAA
GATCGCCGGATGTTATCGTCTGCTGTTAAAGATCGAAAACTGCATTTAAA
TCAGAAATCGCATTCGAAACCTAAATATTCGGATAATAATGGTAATACAA
ATGCTAATAAATCTATGAAACGAAATGTAAATTTAAATTCCAACTATGAC
TATGAAGAGTGTAGTGCTCGCCCATGTTTGCGGCCGGATGGTGAAACATT
AATCGATTGGATTATGTGTGATAAATGCACCCAATGGTTTCACCAATCAT
GTGTCGGACTTGATGAGGCAGTGGAAGACGATGAGAGTTACTATTGTCCA
TATTGTGTTCATTAAAAGAAATCCCCAAACTATACTAATTTAAAATTACT
GATGTTATTTCATTTCCAATGTTGAAATGCCGCAACCTTGTTTACTTGCT
ACATTTAGCGTAGTTTAAATGGCACTAAATTTATTTTTTCATTTTAGCTA
TTAATTCAAAACCTGCGTTAATTAACGATCTGAAATTGTCCAATGAAAAC
CCGTGTTTATAATTGACCATTAATTGTTCGATTTTTGTCATTGGGATTGT
TGGCAAGTTTGATGAATTATTATTACATTTGGACAAATTGCATTTATGCT
GATGATAAGATGATGATGATGTCGAGACGAATTTATCTGTATATTATTCT
GTGTTTCAAATGTTTCTGGTTATACTTTACTCGATGATAATATTATATTA
ATATTAATACTTGTTTTATTACCAAAGTTGAAAGTTTTCAGTTAATCTTG
TTGGTTTTCTCAGTGTACATATTATTACTGATCTAGCCATTGTGATTTTG
AAAATTGTCTGGCAATATTTTTTTTAATAATTGCATAATCTTAAGTAGGA
ATTTTCAGCCGTTTTTAATTAAATGAATTTCAATAAATCTGCATGTTCTT
TAATAATATTTATTAAATAATTATATTTCAATAAGGCGAGGATGTGGAGG
TAAATTTTTAGAAAATTGTCTAATAGTTTTACATTGTGTAGAAATATACG
TTTAATGAATGTTTCAATCTTTGAATTTTGGACAGGTTGAACTTATTCTA
TTGTTTCGGTTTTGGGTATTGCAGACGTTGAGCCGACTCTATCATTGACA
GTGAAAATTAATTACAAATTCTCAGTATCATTTTAAATGCAATAAAATAG
CAGAGAATAATTCGATTGATTTAATATTCCATATTTAATGAGTTATTCTA
AAGAAATTTTTATTGCAAAATATGCTTAGCAGTCAGCATGTTGCTCATCA
CTGATCTTATGAGTTAAAATGTAGGCTCAAGAAATTGATTTGATAAAAGC
AAAAAATTTTCTGGCCCAAATTTCAGTCGGAAAAAATTGTGGACAAATAT
TGACAATTTTCGAAGGAATGCTAGGTAAATCGAGA
back to top

protein sequence of SMED30005492-orf-1

>SMED30005492-orf-1 ID=SMED30005492-orf-1|Name=SMED30005492-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MSILQFIWVGDLDETKTQRLQNPQALSFDRCHPKKMIVRQDKKETRIGRK
NSKMPPDYALESAVSNRMISRNHVTIERLSKGNYMLYDHSLNGTYVNFVR
VIGGTILKHEDVVCFGHINGANIKPGESVTPFATDLKYRVEIIDKPGPIH
EKSGSVRKGENYSQSESSQYEEPITTEQKQKKAKHKPLNDKTKKIKVVKR
ESDDSDQSSDSSESSNNNLSSSYKKQKKPVDLSSVSSSEDDRLKSSSKDR
QFSKKSLDKPKKHSTISESRFNDLSVRKRKSGNENNSNPKPGFKKSHESK
RPMKGDEDRRMLSSAVKDRKLHLNQKSHSKPKYSDNNGNTNANKSMKRNV
NLNSNYDYEECSARPCLRPDGETLIDWIMCDKCTQWFHQSCVGLDEAVED
DESYYCPYCVH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0010468regulation of gene expression
GO:0032259methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR042803TCF19
IPR000253FHA_dom
IPR001965Znf_PHD
IPR019787Znf_PHD-finger
IPR013083Znf_RING/FYVE/PHD
IPR011011Znf_FYVE_PHD
IPR008984SMAD_FHA_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0008168methyltransferase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000253Forkhead-associated (FHA) domainSMARTSM00240FHA_2coord: 44..101
e-value: 8.2E-8
score: 42.0
IPR000253Forkhead-associated (FHA) domainPFAMPF00498FHAcoord: 46..116
e-value: 1.6E-10
score: 41.2
IPR000253Forkhead-associated (FHA) domainPROSITEPS50006FHA_DOMAINcoord: 45..101
score: 13.975
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 40..119
e-value: 1.40347E-11
score: 58.5518
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 360..410
e-value: 1.1E-5
score: 34.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 358..411
e-value: 1.5E-15
score: 58.4
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 11..124
e-value: 2.6E-16
score: 61.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 234..284
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 291..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 209..233
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 330..344
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 158..174
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..344
NoneNo IPR availableCDDcd15610PHD3_KDM5A_likecoord: 360..409
e-value: 4.9527E-21
score: 83.5308
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 366..410
e-value: 2.4E-7
score: 30.5
IPR042803Transcription factor 19PANTHERPTHR15464FAMILY NOT NAMEDcoord: 16..146
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 38..118
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 350..410