Transcriptional adapter

Overview
NameTranscriptional adapter
Smed IDSMED30005485
Length (bp)1890
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcriptional adapter (SMED30005485) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcriptional adapter (SMED30005485) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcriptional adapter (SMED30005485) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcriptional adapter (SMED30005485) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005485

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005485SMESG000048226.1 SmedASXL_013233SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30005485SMESG000048226.1 SmedASXL_013233SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30005485SMESG000048226.1 Contig24222newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcriptional adapter vs. Ensembl Human
Match: TADA2B (transcriptional adaptor 2B [Source:HGNC Symbol;Acc:HGNC:30781])

HSP 1 Score: 112.849 bits (281), Expect = 3.720e-26
Identity = 69/236 (29.24%), Postives = 122/236 (51.69%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            C YCL ++      C +C +I +C +CF  G E G HR+ H Y++   V   +  L+  +++  W   EE  L+DA+  +  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD +AE LI+ L  + + + +   L+   +++Y   L++R R K IAR++NL+   + 
Sbjct:    9 CVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQL---VDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLG 234          
BLAST of Transcriptional adapter vs. Ensembl Human
Match: TADA2A (transcriptional adaptor 2A [Source:HGNC Symbol;Acc:HGNC:11531])

HSP 1 Score: 95.1301 bits (235), Expect = 7.881e-21
Identity = 65/239 (27.20%), Postives = 119/239 (49.79%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKSNSNFSSLKPI-FDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT +EC  H+++++  +  F  +L+   ++    ++   I F  TD    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+  +++IY   L++R R K I R+H LI+     ++E+
Sbjct:   17 CRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEI---MTSDFPVL---DPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMER 241          
BLAST of Transcriptional adapter vs. Ensembl Human
Match: TADA2A (transcriptional adaptor 2A [Source:HGNC Symbol;Acc:HGNC:11531])

HSP 1 Score: 94.7449 bits (234), Expect = 9.600e-21
Identity = 65/239 (27.20%), Postives = 119/239 (49.79%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKSNSNFSSLKPI-FDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT +EC  H+++++  +  F  +L+   ++    ++   I F  TD    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+  +++IY   L++R R K I R+H LI+     ++E+
Sbjct:   17 CRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEI---MTSDFPVL---DPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMER 241          
BLAST of Transcriptional adapter vs. Ensembl Human
Match: TADA2A (transcriptional adaptor 2A [Source:HGNC Symbol;Acc:HGNC:11531])

HSP 1 Score: 95.5153 bits (236), Expect = 2.834e-20
Identity = 65/239 (27.20%), Postives = 119/239 (49.79%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKSNSNFSSLKPI-FDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT +EC  H+++++  +  F  +L+   ++    ++   I F  TD    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+  +++IY   L++R R K I R+H LI+     ++E+
Sbjct:   17 CRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEI---MTSDFPVL---DPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMER 241          
BLAST of Transcriptional adapter vs. Ensembl Human
Match: TADA2A (transcriptional adaptor 2A [Source:HGNC Symbol;Acc:HGNC:11531])

HSP 1 Score: 95.5153 bits (236), Expect = 2.834e-20
Identity = 65/239 (27.20%), Postives = 119/239 (49.79%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKSNSNFSSLKPI-FDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT +EC  H+++++  +  F  +L+   ++    ++   I F  TD    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+  +++IY   L++R R K I R+H LI+     ++E+
Sbjct:   17 CRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEI---MTSDFPVL---DPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMER 241          
BLAST of Transcriptional adapter vs. Ensembl Celegans
Match: ada-2 (ADA (Histone acetyltransferase complex) subunit [Source:UniProtKB/TrEMBL;Acc:Q5DX44])

HSP 1 Score: 53.9138 bits (128), Expect = 3.195e-7
Identity = 30/119 (25.21%), Postives = 56/119 (47.06%), Query Frame = 2
Query:   56 CSYCLKKI-QSKFIFCIQCNIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSD--ECRLHFIENYTKSSFGRSLIK 403
            C  C  ++ Q+  + C +C + IC+ CF  G E   HR+ H Y++       +         W  ++E +L+ A   +K GNW +I+  +     D   C+ +F +++ +   G+  IK
Sbjct:   11 CFNCTLRVDQTIHVKCFECPLRICILCFQCGAESPPHRRGHNYELVKPTSNPEAM------SWTHEDEFELLKAAHKFKMGNWGEIAESIGRGRKDGHNCKDYFEKHFVRGWIGQFSIK 123          
BLAST of Transcriptional adapter vs. Ensembl Celegans
Match: ada-2 (ADA (Histone acetyltransferase complex) subunit [Source:UniProtKB/TrEMBL;Acc:Q5DX44])

HSP 1 Score: 53.5286 bits (127), Expect = 3.648e-7
Identity = 30/119 (25.21%), Postives = 56/119 (47.06%), Query Frame = 2
Query:   56 CSYCLKKI-QSKFIFCIQCNIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSD--ECRLHFIENYTKSSFGRSLIK 403
            C  C  ++ Q+  + C +C + IC+ CF  G E   HR+ H Y++       +         W  ++E +L+ A   +K GNW +I+  +     D   C+ +F +++ +   G+  IK
Sbjct:   24 CFNCTLRVDQTIHVKCFECPLRICILCFQCGAESPPHRRGHNYELVKPTSNPEAM------SWTHEDEFELLKAAHKFKMGNWGEIAESIGRGRKDGHNCKDYFEKHFVRGWIGQFSIK 136          
BLAST of Transcriptional adapter vs. Ensembl Fly
Match: Ada2b (gene:FBgn0037555 transcript:FBtr0334315)

HSP 1 Score: 117.472 bits (293), Expect = 4.806e-28
Identity = 71/232 (30.60%), Postives = 120/232 (51.72%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKP-IFDHT-DGEKSPV---LYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISH 733
            C+ C   IQ   + C +C N  +C++CF  G E G H+  H Y+         + +F+    W   EE++L+DA+  Y  GNW DIS  + TK++++ +  ++  +   + GR+     +S       +P + DHT D +  P+        PP  + SDE   LG++ NR+ F  EYD  AE+LI+ +  S+E   +   L+   ++IY   LR+R R K + R++ L+S+
Sbjct:   13 CTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDT-GTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNGTIGRATWTPAQSQ------RPRLIDHTGDDDAGPLGTNALSTLPPLEINSDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSN 237          
BLAST of Transcriptional adapter vs. Ensembl Fly
Match: Ada2b (gene:FBgn0037555 transcript:FBtr0081807)

HSP 1 Score: 117.472 bits (293), Expect = 4.806e-28
Identity = 71/232 (30.60%), Postives = 120/232 (51.72%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKP-IFDHT-DGEKSPV---LYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISH 733
            C+ C   IQ   + C +C N  +C++CF  G E G H+  H Y+         + +F+    W   EE++L+DA+  Y  GNW DIS  + TK++++ +  ++  +   + GR+     +S       +P + DHT D +  P+        PP  + SDE   LG++ NR+ F  EYD  AE+LI+ +  S+E   +   L+   ++IY   LR+R R K + R++ L+S+
Sbjct:   13 CTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDT-GTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNGTIGRATWTPAQSQ------RPRLIDHTGDDDAGPLGTNALSTLPPLEINSDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSN 237          
BLAST of Transcriptional adapter vs. Ensembl Fly
Match: Ada2b (gene:FBgn0037555 transcript:FBtr0100368)

HSP 1 Score: 119.398 bits (298), Expect = 5.652e-28
Identity = 75/255 (29.41%), Postives = 127/255 (49.80%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKP-IFDHT-DGEKSPV---LYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYFHRQMLKR 802
            C+ C   IQ   + C +C N  +C++CF  G E G H+  H Y+         + +F+    W   EE++L+DA+  Y  GNW DIS  + TK++++ +  ++  +   + GR+     +S       +P + DHT D +  P+        PP  + SDE   LG++ NR+ F  EYD  AE+LI+ +  S+E   +   L+   ++IY   LR+R R K + R++ L+S+          R+  Y  +Q L +
Sbjct:   13 CTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDT-GTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNGTIGRATWTPAQSQ------RPRLIDHTGDDDAGPLGTNALSTLPPLEINSDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFF--------RNRNYAQQQGLTK 252          
BLAST of Transcriptional adapter vs. Ensembl Fly
Match: Ada2a (gene:FBgn0263738 transcript:FBtr0310380)

HSP 1 Score: 74.7146 bits (182), Expect = 1.054e-13
Identity = 62/248 (25.00%), Postives = 110/248 (44.35%), Query Frame = 2
Query:   44 NNSKCSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTK-TSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKF---PPSL--LKSDEEKL-LGFISNRNEFHLEYDDNAEKLIATL------EPSNEIN------SLISALQTTLIEIYDHWLRKRYRYKWIAREHNLI 727
            + ++C+ C   +   +I C +C +  +C++CF  G E   HR  H Y    ++ +D + +F  +  W   +E  L+  +  +  GNW  +S  +  +    E R H+ + Y    F R L           +LK   D    E+ P +++     PP    + S + +L  G+   R +F   YD +AE L++ +      +  NE +       +   LQ  L+  Y++ LR+R R   I R+H LI
Sbjct:   77 DANRCATCRCSLTEPYIKCSECLDTLLCLQCFSRGKEAFSHRNNHAY----IIVRDNIQVFADEPHWTARDERILLKTLRTHGYGNWEAVSQALDQRHEPAEVRRHYHDCYFGGIFERLL-----------NLKHARDSYVPERMPYVFKMRSLDPPRHDDIASMQFRLSAGYRCARGDFDTPYDTSAESLLSIMVDHRGRDDDNEASESEFEREVTEELQLGLVRAYNNRLRERQRRYKIMRQHGLI 309          
BLAST of Transcriptional adapter vs. Ensembl Fly
Match: Ada2a (gene:FBgn0263738 transcript:FBtr0310382)

HSP 1 Score: 74.3294 bits (181), Expect = 1.210e-13
Identity = 62/248 (25.00%), Postives = 110/248 (44.35%), Query Frame = 2
Query:   44 NNSKCSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTK-TSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKF---PPSL--LKSDEEKL-LGFISNRNEFHLEYDDNAEKLIATL------EPSNEIN------SLISALQTTLIEIYDHWLRKRYRYKWIAREHNLI 727
            + ++C+ C   +   +I C +C +  +C++CF  G E   HR  H Y    ++ +D + +F  +  W   +E  L+  +  +  GNW  +S  +  +    E R H+ + Y    F R L           +LK   D    E+ P +++     PP    + S + +L  G+   R +F   YD +AE L++ +      +  NE +       +   LQ  L+  Y++ LR+R R   I R+H LI
Sbjct:   77 DANRCATCRCSLTEPYIKCSECLDTLLCLQCFSRGKEAFSHRNNHAY----IIVRDNIQVFADEPHWTARDERILLKTLRTHGYGNWEAVSQALDQRHEPAEVRRHYHDCYFGGIFERLL-----------NLKHARDSYVPERMPYVFKMRSLDPPRHDDIASMQFRLSAGYRCARGDFDTPYDTSAESLLSIMVDHRGRDDDNEASESEFEREVTEELQLGLVRAYNNRLRERQRRYKIMRQHGLI 309          
BLAST of Transcriptional adapter vs. Ensembl Zebrafish
Match: tada2b (transcriptional adaptor 2B [Source:NCBI gene;Acc:554156])

HSP 1 Score: 113.235 bits (282), Expect = 3.597e-26
Identity = 71/237 (29.96%), Postives = 121/237 (51.05%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAH 745
            C  CL  + +  I C +C +I +C +CF  G E G+HR+ H Y+    V   +  L+  +++  W   EE  L+DA+  Y  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD  AEKLI+ L  + +   +   ++   +++Y   LR+R R K IAR++NL+   +  
Sbjct:    9 CVNCLADVTNLRIRCAECQDIELCPECFSAGAEIGNHRRWHGYQ---QVDGGRFSLWGPEAEGGWTSREEQSLLDAIEQYGFGNWEDMAAHVGASRTPQEVMDHYVSMYIHGNLGKACIPDSIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDITVVEQQQLGYMPLRDDYEIEYDQEAEKLISGLSVNYDDEDIEIEMKRAHVDMYVRKLRERQRRKNIARDYNLVPAFLGR 235          
BLAST of Transcriptional adapter vs. Ensembl Zebrafish
Match: tada2a (transcriptional adaptor 2A [Source:ZFIN;Acc:ZDB-GENE-060929-508])

HSP 1 Score: 94.7449 bits (234), Expect = 2.671e-20
Identity = 68/246 (27.64%), Postives = 114/246 (46.34%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCNIG---ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFP---------PSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  HKY+I   +  D   L   +S W   EE+ L++AV+    GNW D++  + +KT +EC  H+++NY              +N  FSS      H D   S       P         PS        + G++  R +F  E+D+ AE  +  ++  ++ + ++ AL+  +++IY   L++R R K I R+H LI+     ILE+
Sbjct:   17 CRGCSSYLVEPYIKCAECGPSPFLLCLQCFTRGYEYKKHQSDHKYEI---MTSDFPVL---ESGWTAQEEMALLEAVMDCGFGNWSDVAYQMRSKTKEECEGHYMKNYI-------------NNPLFSSTLLSLRHMDDHLSRTADTAIPFKPTDDPPRPSFDSQLSRDMAGYMPARADFMEEFDNYAEWDLKDIDFVDDDSDILHALKVAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQILER 243          
BLAST of Transcriptional adapter vs. Ensembl Zebrafish
Match: tada2a (transcriptional adaptor 2A [Source:ZFIN;Acc:ZDB-GENE-060929-508])

HSP 1 Score: 93.5893 bits (231), Expect = 7.700e-20
Identity = 68/246 (27.64%), Postives = 114/246 (46.34%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCNIG---ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFP---------PSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  HKY+I   +  D   L   +S W   EE+ L++AV+    GNW D++  + +KT +EC  H+++NY              +N  FSS      H D   S       P         PS        + G++  R +F  E+D+ AE  +  ++  ++ + ++ AL+  +++IY   L++R R K I R+H LI+     ILE+
Sbjct:   17 CRGCSSYLVEPYIKCAECGPSPFLLCLQCFTRGYEYKKHQSDHKYEI---MTSDFPVL---ESGWTAQEEMALLEAVMDCGFGNWQDVAYQMRSKTKEECEGHYMKNYI-------------NNPLFSSTLLSLRHMDDHLSRTADTAIPFKPTDDPPRPSFDSQLSRDMAGYMPARADFMEEFDNYAEWDLKDIDFVDDDSDILHALKVAVVDIYHSRLKERQRRKKIIRDHGLINLRKFLILER 243          
BLAST of Transcriptional adapter vs. Ensembl Zebrafish
Match: tada2a (transcriptional adaptor 2A [Source:ZFIN;Acc:ZDB-GENE-060929-508])

HSP 1 Score: 93.2041 bits (230), Expect = 1.030e-19
Identity = 68/246 (27.64%), Postives = 114/246 (46.34%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCNIG---ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFP---------PSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  HKY+I   +  D   L   +S W   EE+ L++AV+    GNW D++  + +KT +EC  H+++NY              +N  FSS      H D   S       P         PS        + G++  R +F  E+D+ AE  +  ++  ++ + ++ AL+  +++IY   L++R R K I R+H LI+     ILE+
Sbjct:   17 CRGCSSYLVEPYIKCAECGPSPFLLCLQCFTRGYEYKKHQSDHKYEI---MTSDFPVL---ESGWTAQEEMALLEAVMDCGFGNWQDVAYQMRSKTKEECEGHYMKNYI-------------NNPLFSSTLLSLRHMDDHLSRTADTAIPFKPTDDPPRPSFDSQLSRDMAGYMPARADFMEEFDNYAEWDLKDIDFVDDDSDILHALKVAVVDIYHSRLKERQRRKKIIRDHGLINLRKFLILER 243          
BLAST of Transcriptional adapter vs. Ensembl Xenopus
Match: coq3 (coenzyme Q3 methyltransferase [Source:Xenbase;Acc:XB-GENE-985854])

HSP 1 Score: 115.931 bits (289), Expect = 3.662e-27
Identity = 70/236 (29.66%), Postives = 122/236 (51.69%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLF--KKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            C YCL  + S  + C +C +I +C  CF  G E G+HR+ H Y++   V   +  L+  + +  W   EE  L+DA+  +  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  L   +++ LG++  R+++ +EYD +AE LI+ L  + + + +   L+   +++Y   L++R R K IAR++NL+   + 
Sbjct:    9 CVYCLADVTSLRLRCTECQDIELCTDCFSAGAEIGNHRRWHGYQL---VDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPTEVMEHYVTMYIHGNLGKACIPDSIPNR-------VTDHTCPTGGPLSPSLTTPLPPLDLTVADQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEVELKEAYVDMYVRKLKERQRRKNIARDYNLVPAFLG 234          
BLAST of Transcriptional adapter vs. Ensembl Xenopus
Match: elf2 (E74 like ETS transcription factor 2 [Source:Xenbase;Acc:XB-GENE-853311])

HSP 1 Score: 95.1301 bits (235), Expect = 6.792e-21
Identity = 67/244 (27.46%), Postives = 119/244 (48.77%), Query Frame = 2
Query:   44 NNSKCSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSL--IKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            +   C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT ++C  H+++ +  +  F  +L  +K  +   N  +  P F   +    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+ ++++IY   L++R R K I REH LI+     ILE+
Sbjct:    9 DKPPCKGCSSYLMEPYIKCAECGPPEFLLCLQCFSRGFEYKKHQSDHSYEI---LTSDFPIL---DPSWTAQEEMSLLEAVMDCGFGNWQDVANQMRTKTKEDCEKHYMKYFINNPLFASTLLNLKQAEEEMNMDTAVP-FHPAEDPPRPTF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKISVVDIYHSRLKERQRRKRIIREHGLINLRKFQILER 237          
BLAST of Transcriptional adapter vs. Ensembl Xenopus
Match: elf2 (E74 like ETS transcription factor 2 [Source:Xenbase;Acc:XB-GENE-853311])

HSP 1 Score: 94.7449 bits (234), Expect = 4.672e-20
Identity = 67/244 (27.46%), Postives = 119/244 (48.77%), Query Frame = 2
Query:   44 NNSKCSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSL--IKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            +   C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT ++C  H+++ +  +  F  +L  +K  +   N  +  P F   +    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+ ++++IY   L++R R K I REH LI+     ILE+
Sbjct:   41 DKPPCKGCSSYLMEPYIKCAECGPPEFLLCLQCFSRGFEYKKHQSDHSYEI---LTSDFPIL---DPSWTAQEEMSLLEAVMDCGFGNWQDVANQMRTKTKEDCEKHYMKYFINNPLFASTLLNLKQAEEEMNMDTAVP-FHPAEDPPRPTF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKISVVDIYHSRLKERQRRKRIIREHGLINLRKFQILER 269          
BLAST of Transcriptional adapter vs. Ensembl Xenopus
Match: elf2 (E74 like ETS transcription factor 2 [Source:Xenbase;Acc:XB-GENE-853311])

HSP 1 Score: 94.7449 bits (234), Expect = 4.786e-20
Identity = 67/240 (27.92%), Postives = 118/240 (49.17%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSL--IKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT ++C  H+++ +  +  F  +L  +K  +   N  +  P F   +    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+ ++++IY   L++R R K I REH LI+     ILE+
Sbjct:   17 CKGCSSYLMEPYIKCAECGPPEFLLCLQCFSRGFEYKKHQSDHSYEI---LTSDFPIL---DPSWTAQEEMSLLEAVMDCGFGNWQDVANQMRTKTKEDCEKHYMKYFINNPLFASTLLNLKQAEEEMNMDTAVP-FHPAEDPPRPTF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKISVVDIYHSRLKERQRRKRIIREHGLINLRKFQILER 241          
BLAST of Transcriptional adapter vs. Ensembl Xenopus
Match: elf2 (E74 like ETS transcription factor 2 [Source:Xenbase;Acc:XB-GENE-853311])

HSP 1 Score: 94.7449 bits (234), Expect = 5.023e-20
Identity = 67/240 (27.92%), Postives = 118/240 (49.17%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSL--IKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT ++C  H+++ +  +  F  +L  +K  +   N  +  P F   +    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+ ++++IY   L++R R K I REH LI+     ILE+
Sbjct:   21 CKGCSSYLMEPYIKCAECGPPEFLLCLQCFSRGFEYKKHQSDHSYEI---LTSDFPIL---DPSWTAQEEMSLLEAVMDCGFGNWQDVANQMRTKTKEDCEKHYMKYFINNPLFASTLLNLKQAEEEMNMDTAVP-FHPAEDPPRPTF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKISVVDIYHSRLKERQRRKRIIREHGLINLRKFQILER 245          
BLAST of Transcriptional adapter vs. Ensembl Mouse
Match: Tada2b (transcriptional adaptor 2B [Source:MGI Symbol;Acc:MGI:3035274])

HSP 1 Score: 112.849 bits (281), Expect = 2.554e-26
Identity = 69/236 (29.24%), Postives = 122/236 (51.69%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            C YCL ++      C +C +I +C +CF  G E G HR+ H Y++   V   +  L+  +++  W   EE  L+DA+  +  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD +AE LI+ L  + + + +   L+   +++Y   L++R R K IAR++NL+   + 
Sbjct:    9 CVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQL---VDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLG 234          
BLAST of Transcriptional adapter vs. Ensembl Mouse
Match: Tada2a (transcriptional adaptor 2A [Source:MGI Symbol;Acc:MGI:2144471])

HSP 1 Score: 91.2781 bits (225), Expect = 4.438e-19
Identity = 63/239 (26.36%), Postives = 119/239 (49.79%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKSNSNFSSLKPI-FDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  H Y+I   +  D   L   D  W   EE+ L++AV+    GNW D+++ + TKT +EC  H+++++  +  F  +L+   ++ +  ++   I F   D    P        SLL  D   + G++  R +F  E+D+ AE  +  ++   + + ++ AL+  +++IY   L++R R K I R+H L++     ++E+
Sbjct:   17 CRGCSSYLTEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEI---MTSDFPVL---DPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEAAKAADTAIPFHSADDPPRPAF-----DSLLSRD---MAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLVNLRKFRLMER 241          
BLAST of Transcriptional adapter vs. Ensembl Mouse
Match: Tada2b (transcriptional adaptor 2B [Source:MGI Symbol;Acc:MGI:3035274])

HSP 1 Score: 63.1586 bits (152), Expect = 2.939e-10
Identity = 41/150 (27.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  305 DISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD +AE LI+ L  + + + +   L+   +++Y   L++R R K IAR++NL+   + 
Sbjct:   17 DMAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLG 159          
BLAST of Transcriptional adapter vs. UniProt/SwissProt
Match: sp|Q8I8V0|TAD2B_DROME (Transcriptional adapter 2B OS=Drosophila melanogaster OX=7227 GN=Ada2b PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.666e-27
Identity = 75/255 (29.41%), Postives = 127/255 (49.80%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKP-IFDHT-DGEKSPV---LYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYFHRQMLKR 802
            C+ C   IQ   + C +C N  +C++CF  G E G H+  H Y+         + +F+    W   EE++L+DA+  Y  GNW DIS  + TK++++ +  ++  +   + GR+     +S       +P + DHT D +  P+        PP  + SDE   LG++ NR+ F  EYD  AE+LI+ +  S+E   +   L+   ++IY   LR+R R K + R++ L+S+          R+  Y  +Q L +
Sbjct:   13 CTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDT-GTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNGTIGRATWTPAQSQ------RPRLIDHTGDDDAGPLGTNALSTLPPLEINSDEAMQLGYMPNRDSFEREYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFF--------RNRNYAQQQGLTK 252          
BLAST of Transcriptional adapter vs. UniProt/SwissProt
Match: sp|Q5RBN9|TAD2B_PONAB (Transcriptional adapter 2-beta OS=Pongo abelii OX=9601 GN=TADA2B PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.787e-25
Identity = 69/236 (29.24%), Postives = 122/236 (51.69%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            C YCL ++      C +C +I +C +CF  G E G HR+ H Y++   V   +  L+  +++  W   EE  L+DA+  +  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD +AE LI+ L  + + + +   L+   +++Y   L++R R K IAR++NL+   + 
Sbjct:    9 CVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQL---VDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLG 234          
BLAST of Transcriptional adapter vs. UniProt/SwissProt
Match: sp|Q86TJ2|TAD2B_HUMAN (Transcriptional adapter 2-beta OS=Homo sapiens OX=9606 GN=TADA2B PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 1.787e-25
Identity = 69/236 (29.24%), Postives = 122/236 (51.69%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            C YCL ++      C +C +I +C +CF  G E G HR+ H Y++   V   +  L+  +++  W   EE  L+DA+  +  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD +AE LI+ L  + + + +   L+   +++Y   L++R R K IAR++NL+   + 
Sbjct:    9 CVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQL---VDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLG 234          
BLAST of Transcriptional adapter vs. UniProt/SwissProt
Match: sp|Q503N9|TAD2B_DANRE (Transcriptional adapter 2-beta OS=Danio rerio OX=7955 GN=tada2b PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.690e-25
Identity = 71/237 (29.96%), Postives = 121/237 (51.05%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAH 745
            C  CL  + +  I C +C +I +C +CF  G E G+HR+ H Y+    V   +  L+  +++  W   EE  L+DA+  Y  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD  AEKLI+ L  + +   +   ++   +++Y   LR+R R K IAR++NL+   +  
Sbjct:    9 CVNCLADVTNLRIRCAECQDIELCPECFSAGAEIGNHRRWHGYQ---QVDGGRFSLWGPEAEGGWTSREEQSLLDAIEQYGFGNWEDMAAHVGASRTPQEVMDHYVSMYIHGNLGKACIPDSIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDITVVEQQQLGYMPLRDDYEIEYDQEAEKLISGLSVNYDDEDIEIEMKRAHVDMYVRKLRERQRRKNIARDYNLVPAFLGR 235          
BLAST of Transcriptional adapter vs. UniProt/SwissProt
Match: sp|Q6NRB5|TAD2B_XENLA (Transcriptional adapter 2-beta OS=Xenopus laevis OX=8355 GN=tada2b PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 3.755e-24
Identity = 67/236 (28.39%), Postives = 120/236 (50.85%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLF--KKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            C YCL  + S  + C +C +I +C  CF  G E G+HR+ H Y++   V   +  L+  + +  W   EE  L+DA+  +  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    P   L   +++ LG++  R+++ +E+D  AE LI+ L  + + + +   L+   +++Y   L++R R K +AR++NL+   + 
Sbjct:    9 CVYCLADVTSLRLRCTECQDIELCTDCFSAGAEIGNHRRWHGYQL---VDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPTEVMEHYVTMYIHGNLGKACIPDSIPNR-------VTDHTCPTGGPLSPSLTTPLPTLDLTVADQQQLGYMPLRDDYEIEFDQEAETLISGLSVNYDDDDVEVELKEAYVDMYVRKLKERQRRKSLARDYNLVPAFLG 234          
BLAST of Transcriptional adapter vs. TrEMBL
Match: A0A183AVC3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS10908 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.599e-46
Identity = 133/424 (31.37%), Postives = 205/424 (48.35%), Query Frame = 2
Query:   50 SKCSYCLKKIQSKFIFCIQCN-IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT--DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYFHRQMLKRIYPSQNVFSFPTPTSTPRQKSIFGRVYMHQRQPSLKTQISTDSNS---IDLSTPSEADHMCHT-------------------PIQIPQ------------NPLISPKIASFQTFEDHPSWHYNAFEIDKNLRPFLQFLTAETTKQFLDNLKKEEQLKSEILTLQSCVKHG 1210
            + C YCLK I   +I C+ C+ I +C+ CFC G+E G+H+KTH Y+I++  K   V +F     WN  EEL+L++A+  Y  GNW D++  V TKT  EC+ H+ + Y     G   + +    S    +  + DHT    + SP  Y   P   ++ ++++LLG++  R +F  +YD++AE ++  L PS   + L  AL+   + IY   LR+R R K IAREH LI+ I+A IL K  +      ++M+    P +     P+P    R+K+  G      R  S K  IS  +NS      S+P     +                      P++IP             +PLI P + S      +   +   F ++  L+PFL++ T    KQF+D+L +EE LK EI  L  C   G
Sbjct:    6 ATCQYCLKTIDGTYIKCMDCSVISLCLTCFCLGVEAGNHKKTHGYQIKTTSKSPSVPVF---GDWNAQEELQLLEALEQYGVGNWEDVAFKVETKTPQECKRHYSDYYLS---GLCNLAFTSDRS----VSRVNDHTCHSSQPSPT-YPHSPMVHVEVEDQQLLGYMPARGDFERDYDNDAESILCRLHPSFSHDDLEDALKVAQVGIYMQRLRERQRRKEIAREHGLIAEILAFILNKRLKRRVPLAKEMI----PVRKRGRPPSPRRAIREKTSHGGTA--SRNASSKRVISDTANSSFEFRSSSPPPGSWLAAPFVLKSSGATRGTPLIASGRPLEIPSLSSLSHPPLCKTHPLI-PTLPSVHAGNSNGCENRTVFLLNDKLKPFLRYFTCVEGKQFMDSLYREELLKHEIKYLLDCRAKG 411          
BLAST of Transcriptional adapter vs. TrEMBL
Match: A0A564Z0U6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11123 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.446e-42
Identity = 125/396 (31.57%), Postives = 202/396 (51.01%), Query Frame = 2
Query:   41 VNNSKCSYCLKKIQSKFIFCIQCN-IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKV-CLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYFHRQMLKRIYPSQNVFSFPTPTSTPRQKSIFGRVYMHQRQPSLKTQISTDSNSIDLSTPSEADHMCHTPIQIPQN------PLISPKIASFQTFEDHPSW---HYNAFEIDKNLRPFLQFLTAETTKQFLDNLKKEEQLKSEILTLQS 1195
            +N  +C+YCLK+IQ  +I C  C+ + +C+ CF +G E G H+++HKY I+ V+  D+  C+    + W   EEL+ + AV  Y  GNW+DIS+     T  EC  H+ + Y   S   SL+K      N SS   + DH+   K P   E+  P  L+  E++LLG++  R++F  +YD++AE L+  L    + + L +AL    + IY   L++R + K IAR H LI  I A++        TY  +++ ++ Y +++ F     TS  R K I          P L++Q    +      +P     +   P  +  +      P++ P +AS      + +     Y+ F I++ L+PFL++ T    KQFL+NL +EE LK EI  LQ+
Sbjct:    1 MNAGRCTYCLKRIQKVYIKCTDCSSVNLCLFCFSHGAEAGHHKRSHKYSIKYVLLGDEENCII---NGWPGSEELEFLCAVEQYGLGNWLDISAKCGHHTPQECYEHYDKFYLHGS-NISLLK-----GNISSYDTVLDHSSPLK-PSGQER--PVQLEPIEQQLLGYMIMRDDFERDYDNDAESLLTRLNVKTDCDDLENALHVAHVNIYTQRLQERQKRKEIARLHGLIYQISAYL--------TY--KKIKRKHYKTESKF-----TSAQRHKPI----------PVLQSQRKRSTPQSSPVSPPAGSWLA-APFALQSSGPTRGIPVVVPGVASLTQDTTNKASDLDDYDPFNINEKLKPFLRYFTPTQAKQFLNNLHREEVLKHEIKYLQN 358          
BLAST of Transcriptional adapter vs. TrEMBL
Match: A0A267FFL9 (SANT domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022601g1 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 6.676e-40
Identity = 91/307 (29.64%), Postives = 151/307 (49.19%), Query Frame = 2
Query:   41 VNNSKCSYCLKKIQSKFIFCIQCN------------------IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLF-----KKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRS--LIKYIKSNSNFSSLKP-------IFDHTDGEKSPV---LYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYFHRQMLKRIYPSQNVFSFPTPTSTPR 856
            ++   C YCL++++S +I C  C                   + +CV+CF  G E G H + H Y++E+V   +K  +F        + W+FDEE +L+D++ VY  GNW D++S V  +TSD+C  H+ + Y +   G    L     + +  +  KP       + D T    +P+   L++  PP+ L  +E +LLGF+  R +F  +YD+ AE L+  L+PS E + L +AL+   I++Y   L++R R K IA  H L+   +  IL +     +   R    R+          TP++T R
Sbjct:   10 IDPDACRYCLRRLRSPYIACSDCRLPSHPALQQQQQQQKRRIVRLCVRCFASGAEAGKHSRRHDYRLETVRDWEKQAIFHPATDAAAAHWSFDEETRLLDSIDVYGVGNWSDVASKVDGRTSDQCIEHYSKFYMRGVIGAKTFLPVAASAATTVAEEKPLEIPLGQVEDLTAAPGAPLSPSLFQALPPADLTQEEAQLLGFMPLRGDFERDYDNEAESLLCQLQPSFEQDELDNALRVAQIDMYTGRLQERQRRKLIAARHGLLHQAMRCILARG----SAAARPPQPRLLAPARGLGGGTPSTTMR 312          
BLAST of Transcriptional adapter vs. TrEMBL
Match: A0A267E4P8 (SANT domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022601g2 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.296e-38
Identity = 85/275 (30.91%), Postives = 141/275 (51.27%), Query Frame = 2
Query:   41 VNNSKCSYCLKKIQSKFIFCIQCN------------------IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLF-----KKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRS--LIKYIKSNSNFSSLKP-------IFDHTDGEKSPV---LYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKS 760
            ++   C YCL++++S +I C  C                   + +CV+CF  G E G H + H Y++E+V   +K  +F        + W+FDEE +L+D++ VY  GNW D++S V  +TSD+C  H+ + Y +   G    L     + +  +  KP       + D T    +P+   L++  PP+ L  +E +LLGF+  R +F  +YD+ AE L+  L+PS E + L +AL+   I++Y   L++R R K IA  H L+   +  IL + 
Sbjct:    9 IDPDACRYCLRRLRSPYIACSDCRLPSHPALQQQQQQQKRRIVRLCVRCFASGAEAGKHSRRHDYRLETVRDWEKQAIFHPATDAAAAHWSFDEETRLLDSIDVYGVGNWSDVASKVDGRTSDQCIEHYSKYYMRGVIGAKTFLPVAASAATTVAEEKPLEIPLGQVEDLTAAPGAPLSPSLFQALPPADLTQEEAQLLGFMPLRGDFERDYDNEAESLLCQLQPSFEQDELDNALRVAQIDMYTGRLQERQRRKLIAARHGLLHQAMRCILARG 283          
BLAST of Transcriptional adapter vs. TrEMBL
Match: G4V6B5 (Transcriptional adaptor 2 (Ada2)-related OS=Schistosoma mansoni OX=6183 GN=Smp_004040 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 8.253e-38
Identity = 125/412 (30.34%), Postives = 195/412 (47.33%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN-IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGE-KSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK--------------------------SPRDFTYF-HRQMLKRIYPSQNVFSF-----PTPTSTPRQKSIFGRVYMHQRQPSLKTQ---ISTDSNSIDLSTPSEADHMCHTPIQIPQNPLISPKIASFQTFEDHPSWHYNAFEIDKNLRPFLQFLTAETTKQFLDNLKKEEQLKSEI 1180
            CS CLK+     I C++C+ + +C+ C+CYG E G H+K H Y++  +       L      WN +EEL L++A+  Y  GNW DI+  V TK+S+EC  H+   Y    FG  L+   K  S       I DHT+    SP+   K P   +  ++++LLG++ NR +F  +YD++AE ++  L PS   + L  AL+   + IY   LR+R R K IA EH LI HI+A IL K                           P   T   H ++  +I P + + +         T  P   S     ++ Q    +K     ++  SN ++    +++  +  T I          K+ S  + ED     +N F +++ L+PFL++ T    KQF++NL KEE +K EI
Sbjct:   10 CSNCLKQADVHLI-CVECDCVQLCITCYCYGAESGIHKKNHGYRVSRLNLLPHSIL----EGWNSEEELNLLEALEQYGIGNWEDIALKVGTKSSEECMYHYCNRYLGGVFGLELLNDNKYPSR------ITDHTNRVVASPMQPPKAP--FIDIEDQQLLGYMPNRGDFERDYDNDAESILCRLHPSFSHDDLEDALKVAQVNIYMQRLRERQRRKEIACEHALIPHILAFILNKRIKKRIPVVGKHTAKGYTPARSKHRGRPPSLTNISHNKLNNKITPMRKLSNINESLNKGSTKKPSPSSWLAAPFIVQSSELIKGAPIVVNISSNVLNNQVLTDSKSINSTNIY---------KVESTNSLED-----FNGFYLNEKLKPFLRYFTGIQGKQFMENLYKEELMKHEI 394          
BLAST of Transcriptional adapter vs. Ensembl Cavefish
Match: tada2b (transcriptional adaptor 2B [Source:NCBI gene;Acc:554156])

HSP 1 Score: 112.079 bits (279), Expect = 4.261e-26
Identity = 70/236 (29.66%), Postives = 120/236 (50.85%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            C  CL  + +  I C  C +I +C +CF  G E G+HR+ H Y+    V   +  L+  +++  W   EE  L+DA+  Y  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +E+D  AEKLI+ L  + +   +   ++   +++Y   LR+R R K IAR++NL+   + 
Sbjct:    9 CVNCLSDVSNLRIRCTDCPDIELCPECFSAGAEIGNHRRWHGYQ---QVDGGRFALWGAEAEGGWTGREEQSLLDAIEQYGFGNWEDMAAHVGASRTPQEVMDHYVSMYIHGNLGKACIPDNIPNR-------VTDHTCPGGGPLSPSLTTPLPPMDISVAEQQQLGYMPLRDDYEIEFDHEAEKLISGLSVNYDDEDVEIEMKRAHVDMYVRKLRERQRRKNIARDYNLVPAFLG 234          
BLAST of Transcriptional adapter vs. Ensembl Cavefish
Match: tada2b (transcriptional adaptor 2B [Source:NCBI gene;Acc:554156])

HSP 1 Score: 112.079 bits (279), Expect = 1.146e-25
Identity = 70/236 (29.66%), Postives = 120/236 (50.85%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIA 742
            C  CL  + +  I C  C +I +C +CF  G E G+HR+ H Y+    V   +  L+  +++  W   EE  L+DA+  Y  GNW D+++ V  ++T  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +E+D  AEKLI+ L  + +   +   ++   +++Y   LR+R R K IAR++NL+   + 
Sbjct:   39 CVNCLSDVSNLRIRCTDCPDIELCPECFSAGAEIGNHRRWHGYQ---QVDGGRFALWGAEAEGGWTGREEQSLLDAIEQYGFGNWEDMAAHVGASRTPQEVMDHYVSMYIHGNLGKACIPDNIPNR-------VTDHTCPGGGPLSPSLTTPLPPMDISVAEQQQLGYMPLRDDYEIEFDHEAEKLISGLSVNYDDEDVEIEMKRAHVDMYVRKLRERQRRKNIARDYNLVPAFLG 264          
BLAST of Transcriptional adapter vs. Ensembl Cavefish
Match: tada2a (transcriptional adaptor 2A [Source:NCBI gene;Acc:103043311])

HSP 1 Score: 91.2781 bits (225), Expect = 3.485e-19
Identity = 66/239 (27.62%), Postives = 118/239 (49.37%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCNIG---ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKSNSNFSSLKPI-FDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  HK++I   +  D   L   +  W   EE+ L++AV+    GNW D++  + TKT +EC  H+++N+  +  F  +L+   +     ++   I F  TD    P        S L  D   + G++  R +F  E+D+ AE  +  ++  ++ + ++ AL+  +++IY   L++R R K I R+H LI+     ILE+
Sbjct:   17 CRGCSSYLVEPYIKCAECGPSPFLLCLQCFTRGYEYKKHQSDHKFEI---MTSDFPIL---EPSWTAQEEMALLEAVMDCGFGNWQDVAYQMRTKTKEECENHYMKNFINNPLFSSTLLSLRQMEEARTADSAIPFKPTDDPPRPSF-----DSQLSRD---MAGYMPARADFMEEFDNYAEWDLKDIDFVDDDSDILHALKVAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQILER 241          
BLAST of Transcriptional adapter vs. Ensembl Cavefish
Match: tada2a (transcriptional adaptor 2A [Source:NCBI gene;Acc:103043311])

HSP 1 Score: 91.6633 bits (226), Expect = 3.966e-19
Identity = 60/237 (25.32%), Postives = 112/237 (47.26%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCNIG---ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  HK++I   +  D   L   +  W   EE+ L++AV+    GNW D++  + TKT +EC  H+++N+  +    S +  ++      +          +  P       PS        + G++  R +F  E+D+ AE  +  ++  ++ + ++ AL+  +++IY   L++R R K I R+H LI+     ILE+
Sbjct:   17 CRGCSSYLVEPYIKCAECGPSPFLLCLQCFTRGYEYKKHQSDHKFEI---MTSDFPIL---EPSWTAQEEMALLEAVMDCGFGNWQDVAYQMRTKTKEECENHYMKNFINNPLFSSTLLSLRQMEEARTADSAIPFKPTDDPPR------PSFDSQLSRDMAGYMPARADFMEEFDNYAEWDLKDIDFVDDDSDILHALKVAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQILER 241          
BLAST of Transcriptional adapter vs. Ensembl Cavefish
Match: tada2a (transcriptional adaptor 2A [Source:NCBI gene;Acc:103043311])

HSP 1 Score: 75.0998 bits (183), Expect = 6.426e-14
Identity = 65/239 (27.20%), Postives = 111/239 (46.44%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCNIG---ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKSNSNFSSLKPI-FDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   +   +I C +C      +C++CF  G E   H+  HK++I   +  D   L   +  W   EE+ L++AV+    GNW D++  + TKT +EC  H+++N+  +  F  +L+   +     ++   I F  TD    P        S L  D   + G++  R +F        E  +   + +  + S IS L+  +++IY   L++R R K I R+H LI+     ILE+
Sbjct:   17 CRGCSSYLVEPYIKCAECGPSPFLLCLQCFTRGYEYKKHQSDHKFEI---MTSDFPIL---EPSWTAQEEMALLEAVMDCGFGNWSDVAYQMRTKTKEECENHYMKNFINNPLFSSTLLSLRQMEEARTADSAIPFKPTDDPPRPSF-----DSQLSRD---MAGYMPARADF-------MEVSVQCFQFA--VWSKIS-LKVAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQILER 231          
BLAST of Transcriptional adapter vs. Ensembl Sea Lamprey
Match: tada2a (transcriptional adaptor 2A [Source:ZFIN;Acc:ZDB-GENE-060929-508])

HSP 1 Score: 100.523 bits (249), Expect = 6.642e-23
Identity = 74/268 (27.61%), Postives = 127/268 (47.39%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN---IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTD-----GEKSPVLY---EKFP-PSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILE----KSPRDFTYFHRQMLKRIYP 811
            C  C   +   +I C QC    + +C++CF  G+E   HR  H Y+I   V  D   L   D  W   EE+ L++AV+    GNW D+++ +  K+ +EC  H++E Y              +N +F+S       +D        +PV +   E  P P L  +   ++ G++  R++F  E+D+ AE  +  ++   + + ++ AL+  ++EIY   L++R R K I R++ LI+     +LE    K  RD +   R   K + P
Sbjct:   17 CPGCSSYLVEPYIKCSQCGPPPLLLCLQCFAQGLELRSHRSEHSYEI---VTTDFPVL---DIGWTAQEEMTLLEAVLDCGLGNWQDVANQMRRKSKEECEWHYMERYI-------------NNPHFASPAAGTGPSDRAEATAVAAPVAFQACEDPPRPGLDSAVAREMAGYMPARSDFCQEFDNYAEWDLRDIDFVEDDSDVLRALKMAVVEIYHSRLKERQRRKKIVRDYGLINLRKFQVLERQNSKEVRDLSEAIRPFAKTMKP 265          
BLAST of Transcriptional adapter vs. Ensembl Sea Lamprey
Match: tada2b (transcriptional adaptor 2B [Source:NCBI gene;Acc:554156])

HSP 1 Score: 99.7525 bits (247), Expect = 1.348e-22
Identity = 70/246 (28.46%), Postives = 123/246 (50.00%), Query Frame = 2
Query:   44 NNSKCSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIEN--YTKSSFGRSLI--KYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPR 766
            N   C  CL++  +  + C +C ++ +C++CF  G E G HR+ H Y++   V +   C       W+  EE  L++AV  Y  GNW D+++ V ++T+ E   H++    Y    FG++++  K    ++  S + P F         V Y      LL   E + LG++  R++F +E+D  AE LI+ L  S   + L   L+   +++Y   + +R R K I RE+NLI+  +    ++ P+
Sbjct:   13 NKKYCVNCLEEATALRLRCAECADMELCLECFSAGAELGPHRRWHSYQM---VLQQPAC----GPGWSNCEEQLLLEAVEQYGFGNWEDVAAHVGSRTAAEATEHYLGRFVYVMDVFGQTMLDTKAADGSAENSIVVPYFYSIV-----VPYFHCCTLLLSPAERQQLGYLPLRDDFEVEHDPEAEGLISGLALSYSDDELDLELKRACVDMYVRRVEERQRRKQIVREYNLIAGFLGKERDRGPK 246          
BLAST of Transcriptional adapter vs. Ensembl Yeast
Match: ADA2 (Transcription coactivator; component of the ADA and SAGA transcriptional adaptor/HAT (histone acetyltransferase) complexes [Source:SGD;Acc:S000002856])

HSP 1 Score: 65.0846 bits (157), Expect = 1.157e-11
Identity = 57/237 (24.05%), Postives = 107/237 (45.15%), Query Frame = 2
Query:   65 CLKKIQSKFIFCIQCNIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKS----PVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATL--EPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  +++     C + ++  CV CF  G   G HR  H Y+I        +C       W  DEEL+L+        GNW DI+  + ++  +E + H+++ Y +S +    I  I  N +    + +       +S    P+   + P + + S  E + GF+  R EF  E+++ AE  +  +  EP ++   L   L+  +++IY+  L  R   K +  E++L+ +     ++K
Sbjct:   14 CTNRVRVSCAICPEYDL--CVPCFSQGSYTGKHRPYHDYRIIETNSYPILC-----PDWGADEELQLIKGAQTLGLGNWQDIADHIGSRGKEEVKEHYLKYYLESKY--YPIPDITQNIHVPQDEFLEQRRHRIESFRERPLEPPRKPMASVPSCHE-VQGFMPGRLEFETEFENEAEGPVKDMVFEPDDQ--PLDIELKFAILDIYNSRLTTRAEKKRLLFENHLMDYRKLQAIDK 238          
BLAST of Transcriptional adapter vs. Ensembl Nematostella
Match: EDO35590 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL39])

HSP 1 Score: 125.561 bits (314), Expect = 4.293e-31
Identity = 76/235 (32.34%), Postives = 128/235 (54.47%), Query Frame = 2
Query:   41 VNNSKCSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKK-DKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLIS 730
             N   C+YC        + C +C +  +C++CFC G E G+H++ HKY++  +VK      LF +D  W  +EE  L+DA+  +  GNW D++  + TKT+ E   H+   Y + S G+  I+  K+         I DHT    G  SP + E  PP  + + E+  LG++  R++F  EYD++AE L++ L+ S++ + +   L+   I++Y   L++R   K +AR+H LI+
Sbjct:    3 ANEYHCNYCQADCTLLRLKCAECTDFDLCLQCFCCGAEMGEHKRGHKYQL--IVKDCGTFPLFMED--WTAEEETLLLDAIEQHGFGNWEDVADHIGTKTAHETADHYNSCYVEGSVGKVTIEPFKNK--------IVDHTISEGGLLSPTILEPPPPLDMSAAEQTELGYMPFRDDFEKEYDNDAETLVSGLQFSHDDDDIEKDLKLAQIDMYLRRLQERQHRKNVARQHGLIA 225          
BLAST of Transcriptional adapter vs. Ensembl Nematostella
Match: EDO31480 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXT4])

HSP 1 Score: 107.457 bits (267), Expect = 3.217e-26
Identity = 74/248 (29.84%), Postives = 121/248 (48.79%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCN--IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEK----------LLGFISNRNEFHLEYDDNAEKLIA--TLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEK 757
            C  C   ++  FI C +C   + ICV CF  G E G HR  H Y+I S    +   +F  ++ W+ +EEL+LMDA+     GNW ++S  + TKT +ECR H+ + Y K +    L              P+ +     ++P +     P  +  D  +          L G++  R +F +EYD+ AE  I   + E +N+ +SL++ L+   +EI+   LR+R+  K I R + L++     +LEK
Sbjct:    1 CFICSVALKEPFIRCSRCRPVVDICVHCFARGAERGRHRNDHSYEIIS----NSFPVF--EAAWSAEEELRLMDALSDCGYGNWAEVSKQMQTKTEEECRGHYNQCYIKRALTHGL--------------PVLEPPKDARTPTVATWSVPFKVSEDPPRPPMDSVRSIELAGYMPCRGDFEVEYDNYAEFDIKDISFENTND-SSLLTELKIAAVEIFLTRLRERWYRKQIVRRYGLVNIKKWQMLEK 227          
BLAST of Transcriptional adapter vs. Ensembl Nematostella
Match: EDO29681 (pep supercontig:ASM20922v1:NEMVEscaffold_848:14523:17012:-1 gene:NEMVEDRAFT_v1g143620 transcript:EDO29681 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 7.447e-23
Identity = 66/222 (29.73%), Postives = 109/222 (49.10%), Query Frame = 2
Query:   77 IQSKFIFCIQCN--IGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEK----------LLGFISNRNEFHLEYDDNAEKLIA--TLEPSNEINSLISALQTTLIEIYDHWLRKRYRYK 700
            ++  FI C +C   + ICV CF  G E G HR  H Y+I S    +   +F  ++ W+ +EEL+LMDA+     GNW ++S  + TKT +ECR H+ + Y K +    L              P+ +     ++P +     P  +  D  +          L G++  R +F +EYD+ AE  I   + E +N+ +SL++ L+   +EI+   LR+R+  K
Sbjct:    5 LKEPFIRCSRCRPVVDICVHCFARGAERGRHRNDHSYEIIS----NSFPVF--EAAWSAEEELRLMDALSDCGYGNWAEVSKQMQTKTEEECRGHYNQCYIKRALTHGL--------------PVLEPPKDARTPTVATWSVPFKVSEDPPRPPMDSVRSIELAGYMPCRGDFEVEYDNYAEFDIKDISFENTND-SSLLTELKIAAVEIFLTRLRERWYRK 205          
BLAST of Transcriptional adapter vs. Ensembl Nematostella
Match: EDO28834 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5C9])

HSP 1 Score: 66.2402 bits (160), Expect = 8.015e-13
Identity = 39/118 (33.05%), Postives = 61/118 (51.69%), Query Frame = 2
Query:  119 ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKS 472
            +C +CFC G E G+H++ HKY++   +      LF +D  W  +EE  L+DA+  +  GNW D++  + TKT+ E   H+   Y + S G+  I+  K+         I DHT  E  
Sbjct:   60 VCDQCFCCGAEMGEHKRGHKYQL---IDCGTFPLFMED--WTAEEETLLLDAIEQHGFGNWEDVADHIGTKTAHETADHYNSCYVEGSVGKVTIEPFKNK--------IVDHTISEGG 164          
BLAST of Transcriptional adapter vs. Ensembl Medaka
Match: tada2b (transcriptional adaptor 2B [Source:NCBI gene;Acc:101163525])

HSP 1 Score: 112.079 bits (279), Expect = 9.256e-26
Identity = 69/231 (29.87%), Postives = 121/231 (52.38%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSK--WNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLI 727
            C  CL  + +  + C +C +I +C +CF  G E G+HR+ H Y+    V   +  ++  +++  W   EE  L+DA+  Y  GNW D+++ V  +++  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD +AEKLI+ L  + +   +   L+   +++Y   LR+R R K IAR++NL+
Sbjct:   37 CVNCLADVTNLRLRCTECTDIDLCPECFSAGAEIGNHRRWHGYQ---QVDGGRFSIWGPEAEGGWTSREEQSLLDAIEQYGFGNWEDMAAHVGASRSPQEVMEHYVTMYIHGNLGKACIPDSIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDISLAEQQQLGYMPLRDDYEIEYDQDAEKLISGLSVNYDDEDVEIELKRAHVDMYVRKLRERQRRKNIARDYNLV 257          
BLAST of Transcriptional adapter vs. Ensembl Medaka
Match: tada2b (transcriptional adaptor 2B [Source:NCBI gene;Acc:101163525])

HSP 1 Score: 110.923 bits (276), Expect = 1.037e-25
Identity = 69/231 (29.87%), Postives = 120/231 (51.95%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLF--KKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVH-TKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT---DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLI 727
            C  CL  + +  + C +C +I +C +CF  G E G+HR+ H Y+    V   +  ++  + +  W   EE  L+DA+  Y  GNW D+++ V  +++  E   H++  Y   + G++ I     N        + DHT    G  SP L    PP  +   E++ LG++  R+++ +EYD +AEKLI+ L  + +   +   L+   +++Y   LR+R R K IAR++NL+
Sbjct:    9 CVNCLADVTNLRLRCTECTDIDLCPECFSAGAEIGNHRRWHGYQ---QVDGGRFSIWGPEAEGGWTSREEQSLLDAIEQYGFGNWEDMAAHVGASRSPQEVMEHYVTMYIHGNLGKACIPDSIPNR-------VTDHTCPSGGPLSPSLTTPLPPLDISLAEQQQLGYMPLRDDYEIEYDQDAEKLISGLSVNYDDEDVEIELKRAHVDMYVRKLRERQRRKNIARDYNLV 229          
BLAST of Transcriptional adapter vs. Ensembl Medaka
Match: tada2a (transcriptional adaptor 2A [Source:NCBI gene;Acc:101161664])

HSP 1 Score: 99.3673 bits (246), Expect = 9.784e-22
Identity = 72/259 (27.80%), Postives = 127/259 (49.03%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCNIG---ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKS-NSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYFHRQMLKRIYPSQ 817
            C  C   +   +I C +C      +C++CF  G E   H+  H+Y+I   +  D   L   +  W   EE+ L++AV+    GNW D++  + TKT +EC  H+++N+  +  F  +L+   K+ +S F+     F   D    P+       S+L  D   + G++  R +F  E+D+ AE  +  ++  ++ + ++ AL+  +++IY   L++R R K I R+H LI+           R F     QML+R YP +
Sbjct:   17 CRGCSSHLTEPYIKCAECGPSPFLLCLQCFTRGFEYKKHQSDHRYEI---MTSDFPVL---EPGWTAQEEMALLEAVMDCGFGNWQDVAYQMRTKTKEECESHYMKNFINNPLFSSTLLSLKKTKDSRFAEGAIPFKPCDDPPRPIF-----DSVLSRD---MAGYMPARADFMEEFDNYAEWDLKDIDFVDDDSDILHALKLAVVDIYHSRLKERQRRKKIIRDHGLINL----------RKF-----QMLERCYPKE 246          
BLAST of Transcriptional adapter vs. Ensembl Medaka
Match: tada2a (transcriptional adaptor 2A [Source:NCBI gene;Acc:101161664])

HSP 1 Score: 87.8113 bits (216), Expect = 3.596e-18
Identity = 65/260 (25.00%), Postives = 126/260 (48.46%), Query Frame = 2
Query:   56 CSYCLKKIQSKFIFCIQCNIG---ICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSS-FGRSLIKYIKS-NSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYFHRQMLKRIYPSQN 820
            C  C   +   +I C +C      +C++CF  G E   H+  H+Y+I   +  D   L   +  W   EE+ L++AV+    GNW D++  + TKT +EC  H+++N+  +  F  +L+   K+ +S F+     F   D    P+       S+L  D   + G++  R +F  E+D+ AE  +  ++  ++ + ++ AL+  +++IY   L++R R K I     LI  ++     K  ++     R+  + + P+++
Sbjct:   17 CRGCSSHLTEPYIKCAECGPSPFLLCLQCFTRGFEYKKHQSDHRYEI---MTSDFPVL---EPGWTAQEEMALLEAVMDCGFGNWQDVAYQMRTKTKEECESHYMKNFINNPLFSSTLLSLKKTKDSRFAEGAIPFKPCDDPPRPIF-----DSVLSRD---MAGYMPARADFMEEFDNYAEWDLKDIDFVDDDSDILHALKLAVVDIYHSRLKERQRRKNIRSSLPLI--VLERCYPKEVQELYDAMRRFARVVGPTEH 260          
BLAST of Transcriptional adapter vs. Planmine SMEST
Match: SMESG000048226.1 (SMESG000048226.1)

HSP 1 Score: 927.161 bits (2395), Expect = 0.000e+0
Identity = 451/456 (98.90%), Postives = 451/456 (98.90%), Query Frame = 2
Query:   38 CVNNSKCSYCLKKIQSKFIFCIQCNIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYFHRQMLKRIYPSQNVFSFPTPTSTPRQKSIFGRVYMHQRQPSLKTQISTDSNSIDLSTPSEADHMCHTPIQIPQNPLISPKIASFQTFEDHPSWHYNAFEIDKNLRPFLQFLTAETTKQFLDNLKKEEQLKSEILTLQSCVKHGILSYDDYKEKLCQHKKRISDNSNYIPDGNKFSKKRKRGMTKNFNYIAIMRKKRLKKYLISLENHD 1405
            CVNNSKCSYCLKKIQSKFIFCIQCNIGICVKCFCYGIEGGDHRKTHKYKIE    KDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYK IAREHNLISHIIAHILEKSPRDFTYFHRQMLKRIYPSQNVFSFPTPTSTPRQKSIFGRVYMHQRQPSLKTQISTDSNSIDLSTPSEADHMCHTPIQIPQNPLISPKIASFQTFEDHPSWHYNAFEIDKNLRPFLQFLTAETTKQFLDNLKKEEQLKSEILTLQSCVKHGILSYDDYKEKLCQHKKRISDNSNYIPDGNKFSKKRKRGMTKNFNYIAIMRKKRLKKYLISLENHD
Sbjct:    3 CVNNSKCSYCLKKIQSKFIFCIQCNIGICVKCFCYGIEGGDHRKTHKYKIE----KDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKRIAREHNLISHIIAHILEKSPRDFTYFHRQMLKRIYPSQNVFSFPTPTSTPRQKSIFGRVYMHQRQPSLKTQISTDSNSIDLSTPSEADHMCHTPIQIPQNPLISPKIASFQTFEDHPSWHYNAFEIDKNLRPFLQFLTAETTKQFLDNLKKEEQLKSEILTLQSCVKHGILSYDDYKEKLCQHKKRISDNSNYIPDGNKFSKKRKRGMTKNFNYIAIMRKKRLKKYLISLENHD 454          
BLAST of Transcriptional adapter vs. Planmine SMEST
Match: SMESG000042527.1 (SMESG000042527.1)

HSP 1 Score: 200.29 bits (508), Expect = 2.944e-57
Identity = 148/466 (31.76%), Postives = 222/466 (47.64%), Query Frame = 2
Query:   44 NNSKCSYCLKKIQSKFIFCIQC-NIGICVKCFCYGIEGGDHRKTHKYKIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTKTSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHT----DGEKSPVLYEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSLISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILE------------------------KSPRDFTYFHRQMLKRIYPSQNVFSFPTPT--STPRQKSIFGRVYMHQRQPSLKTQISTDSNSIDLSTPSEADHMCHTPIQIPQNPLISPKIASFQTFEDHPSWHYNAFEIDKNLRPFLQFLTAETTKQFLDNLKKEEQLKSEILTLQSCVKHGILSYDDYKEKLCQHKKRISDNSNYIPDGNKFSKKRKR--GMTKNFN 1342
            NN  C+YCLK     FI CI+C NI +C+ CF YGI+GG+H+K H Y   SV   +KV      S W+  EE KL+DA+ +Y  GNW D+S  V + ++DECR H+I  Y  S+ G+ L+     N +   L  + DH+    +   SP L+E  PP +L  D++ +LG++  R++F  +YD++AE ++  L+P    + L+ AL+   + IY   L++R R K IAREH LI  I++ IL                         KSP+       + L R  P    F+  +P   S+P  KS+  +V M  +  S+ +   +  N +  + P                                    Y+AF I +NL+PFL++LT    K  L+NL +EE LK EI  + + +K G       + K+     R   NSN       F + R R  G T+N N
Sbjct:    6 NNIYCAYCLKPFNFYFIKCIECKNITLCIPCFSYGIQGGNHKKNHLY---SVKVSNKVSEVFVKSNWSIIEEQKLLDAIELYGVGNWNDVSCKVESHSADECRDHYINYYINSAIGKYLL-----NDSKGKLCQVSDHSVNVDNSNLSPSLFEVMPPCVLSVDDQVMLGYMPKRDDFERDYDNDAESILCRLKPDFIKDDLLDALKVAHVGIYTQRLKERQRRKLIAREHGLIGPIMSCILNRRWKPSMSSDNPKEINSKIMLSPIKSPKFSDNRRNETLVRNKP----FTLLSPNTLSSPPCKSV-RKVRMIDKTLSMTSAKKSRVNELSRNRP------------------------------------YDAFMISENLKPFLRYLTFSQAKALLENLHREEILKFEISNIINSIKRG-------RRKVFDMPVRYPLNSNI------FVRSRPRIIGQTENGN 409          
The following BLAST results are available for this feature:
BLAST of Transcriptional adapter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TADA2B3.720e-2629.24transcriptional adaptor 2B [Source:HGNC Symbol;Acc... [more]
TADA2A7.881e-2127.20transcriptional adaptor 2A [Source:HGNC Symbol;Acc... [more]
TADA2A9.600e-2127.20transcriptional adaptor 2A [Source:HGNC Symbol;Acc... [more]
TADA2A2.834e-2027.20transcriptional adaptor 2A [Source:HGNC Symbol;Acc... [more]
TADA2A2.834e-2027.20transcriptional adaptor 2A [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ada-23.195e-725.21ADA (Histone acetyltransferase complex) subunit [... [more]
ada-23.648e-725.21ADA (Histone acetyltransferase complex) subunit [... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ada2b4.806e-2830.60gene:FBgn0037555 transcript:FBtr0334315[more]
Ada2b4.806e-2830.60gene:FBgn0037555 transcript:FBtr0081807[more]
Ada2b5.652e-2829.41gene:FBgn0037555 transcript:FBtr0100368[more]
Ada2a1.054e-1325.00gene:FBgn0263738 transcript:FBtr0310380[more]
Ada2a1.210e-1325.00gene:FBgn0263738 transcript:FBtr0310382[more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tada2b3.597e-2629.96transcriptional adaptor 2B [Source:NCBI gene;Acc:5... [more]
tada2a2.671e-2027.64transcriptional adaptor 2A [Source:ZFIN;Acc:ZDB-GE... [more]
tada2a7.700e-2027.64transcriptional adaptor 2A [Source:ZFIN;Acc:ZDB-GE... [more]
tada2a1.030e-1927.64transcriptional adaptor 2A [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coq33.662e-2729.66coenzyme Q3 methyltransferase [Source:Xenbase;Acc:... [more]
elf26.792e-2127.46E74 like ETS transcription factor 2 [Source:Xenbas... [more]
elf24.672e-2027.46E74 like ETS transcription factor 2 [Source:Xenbas... [more]
elf24.786e-2027.92E74 like ETS transcription factor 2 [Source:Xenbas... [more]
elf25.023e-2027.92E74 like ETS transcription factor 2 [Source:Xenbas... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tada2b2.554e-2629.24transcriptional adaptor 2B [Source:MGI Symbol;Acc:... [more]
Tada2a4.438e-1926.36transcriptional adaptor 2A [Source:MGI Symbol;Acc:... [more]
Tada2b2.939e-1027.33transcriptional adaptor 2B [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Transcriptional adapter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8I8V0|TAD2B_DROME5.666e-2729.41Transcriptional adapter 2B OS=Drosophila melanogas... [more]
sp|Q5RBN9|TAD2B_PONAB1.787e-2529.24Transcriptional adapter 2-beta OS=Pongo abelii OX=... [more]
sp|Q86TJ2|TAD2B_HUMAN1.787e-2529.24Transcriptional adapter 2-beta OS=Homo sapiens OX=... [more]
sp|Q503N9|TAD2B_DANRE2.690e-2529.96Transcriptional adapter 2-beta OS=Danio rerio OX=7... [more]
sp|Q6NRB5|TAD2B_XENLA3.755e-2428.39Transcriptional adapter 2-beta OS=Xenopus laevis O... [more]
back to top
BLAST of Transcriptional adapter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AVC31.599e-4631.37Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A564Z0U61.446e-4231.57Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A267FFL96.676e-4029.64SANT domain-containing protein (Fragment) OS=Macro... [more]
A0A267E4P82.296e-3830.91SANT domain-containing protein (Fragment) OS=Macro... [more]
G4V6B58.253e-3830.34Transcriptional adaptor 2 (Ada2)-related OS=Schist... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tada2b4.261e-2629.66transcriptional adaptor 2B [Source:NCBI gene;Acc:5... [more]
tada2b1.146e-2529.66transcriptional adaptor 2B [Source:NCBI gene;Acc:5... [more]
tada2a3.485e-1927.62transcriptional adaptor 2A [Source:NCBI gene;Acc:1... [more]
tada2a3.966e-1925.32transcriptional adaptor 2A [Source:NCBI gene;Acc:1... [more]
tada2a6.426e-1427.20transcriptional adaptor 2A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tada2a6.642e-2327.61transcriptional adaptor 2A [Source:ZFIN;Acc:ZDB-GE... [more]
tada2b1.348e-2228.46transcriptional adaptor 2B [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ADA21.157e-1124.05Transcription coactivator; component of the ADA an... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO355904.293e-3132.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314803.217e-2629.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296817.447e-2329.73pep supercontig:ASM20922v1:NEMVEscaffold_848:14523... [more]
EDO288348.015e-1333.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcriptional adapter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tada2b9.256e-2629.87transcriptional adaptor 2B [Source:NCBI gene;Acc:1... [more]
tada2b1.037e-2529.87transcriptional adaptor 2B [Source:NCBI gene;Acc:1... [more]
tada2a9.784e-2227.80transcriptional adaptor 2A [Source:NCBI gene;Acc:1... [more]
tada2a3.596e-1825.00transcriptional adaptor 2A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Transcriptional adapter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000048226.10.000e+098.90SMESG000048226.1[more]
SMESG000042527.12.944e-5731.76SMESG000042527.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005485 ID=SMED30005485|Name=Transcriptional adapter|organism=Schmidtea mediterranea sexual|type=transcript|length=1890bp
AAAAAATTAGACTTTTTAAAATTTTATGTAAATGAACTGTGTTAATAATT
CGAAATGTTCCTATTGTTTGAAAAAAATACAAAGTAAATTTATCTTTTGC
ATTCAATGTAATATTGGTATTTGTGTAAAGTGCTTTTGCTATGGTATAGA
AGGAGGTGACCACCGTAAAACCCATAAATATAAAATCGAATCCGTTGTAA
AGAAAGATAAAGTCTGTTTGTTTAAAAAAGATTCTAAATGGAATTTTGAT
GAAGAATTAAAATTAATGGATGCTGTTATAGTTTATAAAACTGGAAATTG
GGTTGACATATCTTCGATGGTCCACACAAAGACTTCTGATGAATGCCGAC
TGCATTTCATAGAAAATTACACCAAAAGTTCTTTCGGCCGAAGCTTAATT
AAATATATCAAATCCAACAGTAACTTCTCATCTTTGAAACCCATTTTCGA
CCACACAGACGGCGAGAAATCGCCAGTTCTCTATGAGAAATTCCCTCCGT
CTTTATTAAAATCTGATGAAGAAAAATTGCTGGGGTTCATTTCTAATCGA
AATGAATTTCATTTGGAATACGATGACAATGCCGAAAAATTGATAGCTAC
CCTTGAACCGTCCAATGAGATTAACAGTTTGATTTCAGCCTTGCAAACGA
CACTCATCGAAATTTATGATCATTGGTTGAGAAAGAGATATCGATACAAG
TGGATCGCAAGAGAACATAATCTTATATCTCATATTATTGCTCATATCTT
AGAGAAAAGTCCCCGTGATTTTACATATTTCCATCGACAAATGCTCAAAC
GAATTTATCCTTCACAGAATGTTTTTTCTTTCCCAACTCCAACGTCAACA
CCGCGCCAGAAATCCATTTTCGGACGTGTCTACATGCATCAACGTCAACC
GTCATTGAAAACACAAATCAGTACCGATTCCAACAGTATAGACTTATCGA
CGCCGAGTGAAGCAGATCATATGTGTCACACTCCAATTCAAATTCCTCAG
AACCCTTTGATATCACCAAAAATCGCATCATTCCAAACATTTGAAGATCA
TCCCTCGTGGCATTATAATGCATTTGAAATCGATAAAAATCTCAGACCAT
TTCTTCAATTTCTCACAGCTGAAACTACCAAACAGTTTTTGGACAATTTA
AAAAAGGAAGAACAGCTCAAGTCTGAGATCCTCACATTGCAATCGTGCGT
CAAGCACGGGATATTAAGTTACGATGATTACAAAGAGAAATTGTGTCAAC
ATAAAAAACGAATATCCGACAACTCGAACTATATCCCGGACGGTAACAAA
TTCTCGAAGAAACGAAAGCGTGGTATGACTAAAAATTTCAACTACATTGC
CATAATGCGCAAAAAGCGATTGAAAAAATATTTGATTTCTTTGGAAAATC
ATGATAACTAGTTTTATTCCAATTCTGCATTTTGATTCAATATATAACCG
GGAAAATTGCATTGCAGTGGTTTTATCGATTGATTGATTTGTCTGGGAGC
TTGTGTGCGCGTTCGGATGATTGATTGATTGGCTGGTGCTGCCACCGCTT
GACCGACTGACTAACGCAGCTGCATATGCTGCTGGCTCTACCAAACCAAT
TTTGATTGACTTTTAATATTCAATTTGTAAATAATTGTTGACAATTTTCA
TCAAAAGTTATCCACATTGTTTTATTTAATTATCAACACCTGTTTTTCTA
TTTGATGCATCTGGCTGGCTGTGTAGGAATTTTATATTCAAATATTGATT
GTTATTCCATGGCTGACTTTAGGTGTCTCTTATTCAACTGTTGTCCATAC
GATAAATATTATTATATATTATTACTAATATGGCTTTATTTTTATTGATT
TATTGACAAATATTTATATCCATTTATAGCTTGTTTTCCA
back to top

protein sequence of SMED30005485-orf-1

>SMED30005485-orf-1 ID=SMED30005485-orf-1|Name=SMED30005485-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=460bp
MNCVNNSKCSYCLKKIQSKFIFCIQCNIGICVKCFCYGIEGGDHRKTHKY
KIESVVKKDKVCLFKKDSKWNFDEELKLMDAVIVYKTGNWVDISSMVHTK
TSDECRLHFIENYTKSSFGRSLIKYIKSNSNFSSLKPIFDHTDGEKSPVL
YEKFPPSLLKSDEEKLLGFISNRNEFHLEYDDNAEKLIATLEPSNEINSL
ISALQTTLIEIYDHWLRKRYRYKWIAREHNLISHIIAHILEKSPRDFTYF
HRQMLKRIYPSQNVFSFPTPTSTPRQKSIFGRVYMHQRQPSLKTQISTDS
NSIDLSTPSEADHMCHTPIQIPQNPLISPKIASFQTFEDHPSWHYNAFEI
DKNLRPFLQFLTAETTKQFLDNLKKEEQLKSEILTLQSCVKHGILSYDDY
KEKLCQHKKRISDNSNYIPDGNKFSKKRKRGMTKNFNYIAIMRKKRLKKY
LISLENHDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0003677DNA binding
GO:0003713transcription coactivator activity
Vocabulary: biological process
TermDefinition
GO:1903508positive regulation of nucleic acid-templated transcription
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0035065regulation of histone acetylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001005SANT/Myb
IPR009057Homeobox-like_sf
IPR017884SANT_dom
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001005SANT/Myb domainSMARTSM00717santcoord: 66..115
e-value: 2.2E-7
score: 40.5
IPR001005SANT/Myb domainPFAMPF00249Myb_DNA-bindingcoord: 68..110
e-value: 2.0E-7
score: 31.1
IPR001005SANT/Myb domainCDDcd00167SANTcoord: 69..109
e-value: 7.5798E-7
score: 43.7182
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 64..114
e-value: 6.2E-10
score: 40.7
NoneNo IPR availablePANTHERPTHR12374:SF20TRANSCRIPTIONAL ADAPTER 2-BETAcoord: 6..424
NoneNo IPR availablePANTHERPTHR12374TRANSCRIPTIONAL ADAPTOR 2 ADA2 -RELATEDcoord: 6..424
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
IPR017884SANT domainPROSITEPS51293SANTcoord: 65..117
score: 13.01
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 64..116