CAAX prenyl protease

Overview
NameCAAX prenyl protease
Smed IDSMED30005484
Length (bp)1509
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CAAX prenyl protease (SMED30005484) t-SNE clustered cells

Violin plots show distribution of expression levels for CAAX prenyl protease (SMED30005484) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CAAX prenyl protease (SMED30005484) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CAAX prenyl protease (SMED30005484) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005484

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30005484 dd_Smed_v4_5271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005484 dd_Smed_v4_5271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005484 dd_Smed_v4_5271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005484 dd_Smed_v4_5271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005484 dd_Smed_v4_5271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CAAX prenyl protease vs. Ensembl Human
Match: ZMPSTE24 (zinc metallopeptidase STE24 [Source:HGNC Symbol;Acc:HGNC:12877])

HSP 1 Score: 414.461 bits (1064), Expect = 1.632e-140
Identity = 220/462 (47.62%), Postives = 316/462 (68.40%), Query Frame = 1
Query:  103 LMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNY-VADSDL---------NETENDQK------PDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            L ++  E  +F  + LF W  YLW+ +L  RQ+R+         +   IM+ E ++K+RLY +D   F  +  LY   E + +L +  +P++W+  LS             E+  S++FLL+A L+S + G+PW +Y+ FVIE +HGFN+QT  FF+KD IK  +V+  ++LP+S  LL+IIK+GG YF++YAW F  V+ + L+ IY ++IAPLFDK+TPL +G+LK+ IE +A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL+ Y V + D+         NE E + +       + K+GC +EEV+AVLGHELGHWKL H ++++IISQ+N FL  F+F +L     LF AFGF + + PTLI LL+I  ++FSPY+ VL F +T+LSR+ EF+AD FA KLG  + L +AL+KL+ DNL FP+ D L+S++++SHPP+LER++A
Sbjct:   10 LWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWR--LSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQ-PTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQA 468          
BLAST of CAAX prenyl protease vs. Ensembl Celegans
Match: fce-1 (CAAX prenyl protease 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XVE5])

HSP 1 Score: 354.369 bits (908), Expect = 7.406e-118
Identity = 204/447 (45.64%), Postives = 275/447 (61.52%), Query Frame = 1
Query:  130 LFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQN---------YVADSD-LNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            LF  +    W  +LWD Y+  RQ +     V+   +   ++ EE+YKKAR Y ID   FG +H  +  +  +A L     P++W  T S  +    +V V         FL I  +   +  +PW +YS F+IE  HGFNKQT  F+  D+IK +LV   L +PI Y + +II  GGPYF+VY W F  V+++ LM IYP FIAPLFDKY PL DG+LK  IE LA  + +PL +LYVV GSKRS+HSNAY YGFWKNKRIVL+DTLL           YVA  + + ETEND+    K+G N++EV+AVLGHELGHW L H L +L+I+++NLF    +FG  +    L++ FG+   +TP +I ++LI  ++ + Y+ +    M + SR  EF ADEFA  LG+GE LI AL KL  DNLS PI D+LYS   H+HPP++ER+ A
Sbjct:    6 LFKALLATNWALFLWDQYITFRQYKAHKNAVKRPNEVKELIGEEDYKKARDYKIDNHLFGFFHSWFNQLLLTAQLIGGYYPFLWYATASYPL----HVAV---------FLSINSIIETIIDLPWDLYSTFIIEDAHGFNKQTIGFYFVDKIKKMLVGFALTMPIVYGIEWIIVNGGPYFFVYIWLFVSVVVLLLMTIYPTFIAPLFDKYFPLPDGDLKTKIEQLAASLSYPLTELYVVNGSKRSAHSNAYMYGFWKNKRIVLYDTLLSGAEKEKVHELYVAAGEKIEETENDK----KRGMNNDEVVAVLGHELGHWALWHTLINLVITEVNLFFSFAVFGYFYKWEALYQGFGYH--DTPPVIGMMLIFQFVLALYNQLASIGMVIHSRSAEFGADEFAANLGHGENLIGALTKLGVDNLSMPINDSLYSWCTHTHPPVVERVAA 433          
BLAST of CAAX prenyl protease vs. Ensembl Fly
Match: ste24a (gene:FBgn0034176 transcript:FBtr0087059)

HSP 1 Score: 366.696 bits (940), Expect = 1.966e-122
Identity = 203/447 (45.41%), Postives = 297/447 (66.44%), Query Frame = 1
Query:  103 LMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAV-LYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVA--DSDLNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERI 1434
            +  ++ + VL   +FL +    L + Y+  RQ +V    ++   +    M E+ + KAR Y +D ++FG +  +   +    + LY  ++  +W+ ++  VV K++  +   E+  S +F+LI+ + S   G+P+K+Y IFV+E  HGFNKQT  FF  DQ+K  LV+ +LM+PI+  ++FI++ GG  F+++ W F  VI + L+ +YP FIAPLFDKYTPL  G L++ IE+LA  ++FPL KL+VVEGSKRSSHSNAYFYG W +KRIVLFDTLL N     DS+L+E E        KGC DEEV+AVLGHELGHWKL HV +++II Q++LFLM  +FG +F     + A GF     P L+ LL++  Y+ +PY+ ++ F MT+LSR+ E++ADEFA KLG+ E+L  AL+KL+ DNL FP++D LYS +NHSHP +L+R+
Sbjct:    1 MSSLDADTVLLSILFLVVIENAL-EIYISLRQVKVYQTALKVPAELKSHMGEDTFHKARKYGLDQEKFGIFKAVVMDVALLCMELYIGLIAVLWQLSVQ-VVDKLQWDSK-NEIIVSCVFVLISNVLSTFKGLPFKIYKIFVLEETHGFNKQTARFFAWDQLKGFLVTQVLMIPITAAIIFIVQRGGDNFFIWLWIFTGVISLVLLTLYPIFIAPLFDKYTPLEKGALRQSIEDLAASLKFPLTKLFVVEGSKRSSHSNAYFYGLWNSKRIVLFDTLLLNKGKPDDSELSEEEKG------KGCTDEEVLAVLGHELGHWKLGHVTKNIIIMQVHLFLMFLVFGNVFKYPPFYVAMGFQPGTRPILVGLLIVFTYVLAPYNALMNFAMTILSRRFEYQADEFAFKLGFAEQLGQALIKLNVDNLGFPVYDWLYSTWNHSHPTLLQRL 438          
BLAST of CAAX prenyl protease vs. Ensembl Fly
Match: ste24b (gene:FBgn0034175 transcript:FBtr0087060)

HSP 1 Score: 191.045 bits (484), Expect = 6.285e-55
Identity = 130/433 (30.02%), Postives = 227/433 (52.42%), Query Frame = 1
Query:  142 IFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQ-MIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIE 1437
            I  F+ L  LW  YL  R  +V  K  +     S  + +E Y K R+Y I    F   + L   +I     LY+    W++       +SK        E   S++F+L+  +Y ++  +P  +Y    I++     K   +  I   +  L+V  ++   +   L+++    GPY  +  +  + ++ M ++ + P  I P   +  PL +  L+  +E L  ++ FP+ ++ ++     ++ SNA+FYG    KRIV+FDTLL N    SDL+    +   ++ +G  D +V+AV+ HELGHW+  H  ++++  Q++L L + +F  LF+   +++A GF     PT+I  L+I  ++ +PY  +  F M  ++R  E++AD FA +LGYG +L  AL+KL+ DNL+FP+ D  YS +NH+HP +L+R+ 
Sbjct:   16 IIAFLVLDNLWGVYLMLRDIQVAYKTQQVPNVISPYLPQELYDKMRVYKIHKGWFTIVNTLLSAVILGIMELYFGFYAWLYGVAGKCALSKWME----HEACVSVIFVLLLSVYFWLKSVPAMIYESCCIKSLQPRPKPPWWSRICHFVVDLVVGAMITTLVVVALVYMFIGLGPYAPLGLYLQSLILTMIVLLLIPFMIHPFVGQSVPLENSNLRTQLEYLTRQVGFPMSQVRIIRVHDPNTGSNAFFYGCCCLKRIVIFDTLLLNR-GKSDLSHLTAE---ELGRGLADPQVVAVVAHELGHWRNGHFYKAIMAFQVHLILTILLFAFLFSHGPIYQAVGFPPGLQPTVIGCLIIFGFVLTPYMTLANFSMLSMTRCFEYQADRFAYQLGYGGELRQALLKLYADNLAFPVSDPCYSSWNHTHPTMLDRLS 440          
BLAST of CAAX prenyl protease vs. Ensembl Fly
Match: ste24c (gene:FBgn0050462 transcript:FBtr0100120)

HSP 1 Score: 187.193 bits (474), Expect = 2.207e-53
Identity = 125/426 (29.34%), Postives = 236/426 (55.40%), Query Frame = 1
Query:  169 LWDAYLDCRQQRV-LNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFF-FIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADG-ELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNETENDQKP-DVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERI 1434
            +W+  L  RQQ V LN ++ P  +   I+  E Y +AR+Y +       +  L  +I +   L     P++W    SL    ++ +T  QE+  +++F+    +Y  +  +P  +Y   ++E R+G + + P++ +      S+L+S +++ P++  ++F +K  G YF+++ W F     + L+F  P    P   +   L +G  L   ++ + + + FP+K++++++ ++   +SNAYFYG    KRIV+FDTLL N        +  N+  P +V +G  + +V  V+ HELGHWK  H  ++ II +I+ F+ + +FG+ F+   L+ A GF     P ++  ++++ +  +PY  +    M    R+ E+ AD+FA ++GY  +L  ALVK++ D++SFP++D  Y+ ++H+HP IL+R+
Sbjct:   28 IWEMILTKRQQLVCLNAIMVPE-ELRGIIPPEIYHRARIYELHKTELQIWKYLIDLIITLCELILGFYPFLW----SLSAKTLQKITS-QEIWITLIFVFYLTIYICIRFLPVLIYDKCLLELRYGMSGKFPWYLYCCIGAMSILLSQLVLFPLAAAIVFSVKFIGYYFFLWFWLFWATFTLLLVFFLPYCCIPCIGRQVVLPEGTALYMEVKRVCDVVGFPMKRVFIIK-TRTMQYSNAYFYGSCCLKRIVIFDTLLLNK------GKEPNEIHPYEVGRGLTNIQVAGVVCHELGHWKHGHFYKATIIMKIHFFITMGLFGLFFHSPQLYMAVGFEPGVMPIIVGFIIVLKFALTPYLTLANVLMLWNLRRFEYAADKFAHRMGYSIQLRMALVKIYADHMSFPVYDQCYARWHHTHPTILQRL 440          
BLAST of CAAX prenyl protease vs. Ensembl Fly
Match: ste24c (gene:FBgn0050462 transcript:FBtr0336870)

HSP 1 Score: 187.193 bits (474), Expect = 2.207e-53
Identity = 125/426 (29.34%), Postives = 236/426 (55.40%), Query Frame = 1
Query:  169 LWDAYLDCRQQRV-LNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFF-FIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADG-ELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNETENDQKP-DVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERI 1434
            +W+  L  RQQ V LN ++ P  +   I+  E Y +AR+Y +       +  L  +I +   L     P++W    SL    ++ +T  QE+  +++F+    +Y  +  +P  +Y   ++E R+G + + P++ +      S+L+S +++ P++  ++F +K  G YF+++ W F     + L+F  P    P   +   L +G  L   ++ + + + FP+K++++++ ++   +SNAYFYG    KRIV+FDTLL N        +  N+  P +V +G  + +V  V+ HELGHWK  H  ++ II +I+ F+ + +FG+ F+   L+ A GF     P ++  ++++ +  +PY  +    M    R+ E+ AD+FA ++GY  +L  ALVK++ D++SFP++D  Y+ ++H+HP IL+R+
Sbjct:   28 IWEMILTKRQQLVCLNAIMVPE-ELRGIIPPEIYHRARIYELHKTELQIWKYLIDLIITLCELILGFYPFLW----SLSAKTLQKITS-QEIWITLIFVFYLTIYICIRFLPVLIYDKCLLELRYGMSGKFPWYLYCCIGAMSILLSQLVLFPLAAAIVFSVKFIGYYFFLWFWLFWATFTLLLVFFLPYCCIPCIGRQVVLPEGTALYMEVKRVCDVVGFPMKRVFIIK-TRTMQYSNAYFYGSCCLKRIVIFDTLLLNK------GKEPNEIHPYEVGRGLTNIQVAGVVCHELGHWKHGHFYKATIIMKIHFFITMGLFGLFFHSPQLYMAVGFEPGVMPIIVGFIIVLKFALTPYLTLANVLMLWNLRRFEYAADKFAHRMGYSIQLRMALVKIYADHMSFPVYDQCYARWHHTHPTILQRL 440          
BLAST of CAAX prenyl protease vs. Ensembl Fly
Match: ste24c (gene:FBgn0050462 transcript:FBtr0346515)

HSP 1 Score: 187.193 bits (474), Expect = 2.207e-53
Identity = 125/426 (29.34%), Postives = 236/426 (55.40%), Query Frame = 1
Query:  169 LWDAYLDCRQQRV-LNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFF-FIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADG-ELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNETENDQKP-DVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERI 1434
            +W+  L  RQQ V LN ++ P  +   I+  E Y +AR+Y +       +  L  +I +   L     P++W    SL    ++ +T  QE+  +++F+    +Y  +  +P  +Y   ++E R+G + + P++ +      S+L+S +++ P++  ++F +K  G YF+++ W F     + L+F  P    P   +   L +G  L   ++ + + + FP+K++++++ ++   +SNAYFYG    KRIV+FDTLL N        +  N+  P +V +G  + +V  V+ HELGHWK  H  ++ II +I+ F+ + +FG+ F+   L+ A GF     P ++  ++++ +  +PY  +    M    R+ E+ AD+FA ++GY  +L  ALVK++ D++SFP++D  Y+ ++H+HP IL+R+
Sbjct:   28 IWEMILTKRQQLVCLNAIMVPE-ELRGIIPPEIYHRARIYELHKTELQIWKYLIDLIITLCELILGFYPFLW----SLSAKTLQKITS-QEIWITLIFVFYLTIYICIRFLPVLIYDKCLLELRYGMSGKFPWYLYCCIGAMSILLSQLVLFPLAAAIVFSVKFIGYYFFLWFWLFWATFTLLLVFFLPYCCIPCIGRQVVLPEGTALYMEVKRVCDVVGFPMKRVFIIK-TRTMQYSNAYFYGSCCLKRIVIFDTLLLNK------GKEPNEIHPYEVGRGLTNIQVAGVVCHELGHWKHGHFYKATIIMKIHFFITMGLFGLFFHSPQLYMAVGFEPGVMPIIVGFIIVLKFALTPYLTLANVLMLWNLRRFEYAADKFAHRMGYSIQLRMALVKIYADHMSFPVYDQCYARWHHTHPTILQRL 440          
BLAST of CAAX prenyl protease vs. Ensembl Zebrafish
Match: zmpste24 (zinc metallopeptidase, STE24 homolog [Source:ZFIN;Acc:ZDB-GENE-030131-6312])

HSP 1 Score: 415.616 bits (1067), Expect = 2.666e-141
Identity = 217/464 (46.77%), Postives = 317/464 (68.32%), Query Frame = 1
Query:  100 KLMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNET----------------ENDQKPDVKK-GCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            +++ ++ E  +F  +  F W  Y+W+AYL  RQ+++    V   T+   IM+ E ++K+RLY +D   FG +  LY   E + +L    +P++WK +  L            E++ S++FL++A L+S   G+PW +Y+ FVIE +HGFN+QT  FF+KD +K   V+  ++LP++  LL+IIK+GG YF++YAW F F++ + L+ IY ++IAPLFDK+TPL DGEL+  IE++A+ I FPL KLYVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y   S LN++                E+  KP  KK GC++ EV+AVLGHELGHWKL H +++++ISQ+N FL  F+F +L     LF AFGF + + PTLI L++I  ++FSPY+ +L F MT+LSR+ EF+AD FA  +G   +L +AL+KL+ DNL FP+ D L+S++++SHPP+LER+ A
Sbjct:    4 EILALSVEDKIFYAVLFFSWTVYVWEAYLAYRQRKIYRATVHVPTELGKIMDSETFEKSRLYQLDKSNFGFWSGLYSEFEGTLILLLGGIPFLWKLSGHLTAHF--GFGPEYEISQSLVFLMLATLFSAFTGLPWSLYNTFVIEEKHGFNQQTLGFFLKDALKKFAVTQCILLPVTSLLLYIIKIGGDYFFIYAWLFTFIVSLILVTIYADYIAPLFDKFTPLPDGELRSEIESMAKSISFPLTKLYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDY---SPLNQSGEKEPGTGEENEAVVNESKAKPKNKKQGCSNPEVLAVLGHELGHWKLGHTVKNIVISQMNSFLCFFLFAVLIGRKELFMAFGFHDTQ-PTLIGLMIIFQFIFSPYNELLSFCMTVLSRRFEFQADAFARGMGRSSELYSALIKLNKDNLGFPVADWLFSMWHYSHPPLLERLRA 461          
BLAST of CAAX prenyl protease vs. Ensembl Zebrafish
Match: zmpste24 (zinc metallopeptidase, STE24 homolog [Source:ZFIN;Acc:ZDB-GENE-030131-6312])

HSP 1 Score: 414.461 bits (1064), Expect = 7.321e-141
Identity = 216/464 (46.55%), Postives = 317/464 (68.32%), Query Frame = 1
Query:  100 KLMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNET----------------ENDQKPDVKK-GCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            +++ ++ E  +F  +  F W  Y+W+AYL  RQ+++    V   T+   IM+ E ++K+RLY +D   FG +  LY   E + +L    +P++WK +  L            E++ S++FL++A L+S   G+PW +Y+ FVIE +HGFN+QT  FF+KD +K   V+  +++P++  LL+IIK+GG YF++YAW F F++ + L+ IY ++IAPLFDK+TPL DGEL+  IE++A+ I FPL KLYVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y   S LN++                E+  KP  KK GC++ EV+AVLGHELGHWKL H +++++ISQ+N FL  F+F +L     LF AFGF + + PTLI L++I  ++FSPY+ +L F MT+LSR+ EF+AD FA  +G   +L +AL+KL+ DNL FP+ D L+S++++SHPP+LER+ A
Sbjct:    4 EILALSVEDKIFYAVLFFSWTVYVWEAYLAYRQRKIYRATVHVPTELGKIMDSETFEKSRLYQLDKSNFGFWSGLYSEFEGTLILLLGGIPFLWKLSGHLTAHF--GFGPEYEISQSLVFLMLATLFSAFTGLPWSLYNTFVIEEKHGFNQQTLGFFLKDALKKFAVTQCILVPVTSLLLYIIKIGGDYFFIYAWLFTFIVSLILVTIYADYIAPLFDKFTPLPDGELRSEIESMAKSISFPLTKLYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDY---SPLNQSGEKEPGTGEENEAVVNESKAKPKNKKQGCSNPEVLAVLGHELGHWKLGHTVKNIVISQMNSFLCFFLFAVLIGRKELFMAFGFHDTQ-PTLIGLMIIFQFIFSPYNELLSFCMTVLSRRFEFQADAFARGMGRSSELYSALIKLNKDNLGFPVADWLFSMWHYSHPPLLERLRA 461          
BLAST of CAAX prenyl protease vs. Ensembl Zebrafish
Match: CR352220.2 (pep chromosome:GRCz11:17:24588834:24631981:-1 gene:ENSDARG00000116881.1 transcript:ENSDART00000184562.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352220.2)

HSP 1 Score: 66.6254 bits (161), Expect = 8.039e-12
Identity = 67/268 (25.00%), Postives = 130/268 (48.51%), Query Frame = 1
Query:  118 KEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLF 921
            K  V+++ IF +    Y +++YL  +++   N +V   T    ++++E Y K  L+ +    F  Y   Y     S VL      ++      L        + + +   + LFL  + L ++   + + + +++ ++ R  F++QT  FF++  +K   V      P+++  L I ++   Y Y+Y + + ++ +   ++IY  + +P F K+  +A GE +  IE L + I F +  LYV++    S+ SN Y Y F+ NK IVLF
Sbjct:    9 KTKVIYMLIF-YSRYCYFYESYL-LQKRNAYNAMVYFPTKLGHLLSKETYFKTVLFELLRNNFSVYSSFYSEFIVSLVLRLGRHNFLQTLRGGLSTHFAFGPSYVADQTCAALFL--SHLATYYTALFFSLENMYNLQFRANFHQQTENFFLQAAMKKFAVLYCTYFPLTFKTLGINRIKNNYRYIYIYIYIYIYIYIYIYIYINYCSPWFFKFDLVAGGESRTQIELLKKTIIFRMTVLYVMDQYNHSNLSNVYLYSFFHNKYIVLF 272          
BLAST of CAAX prenyl protease vs. Ensembl Zebrafish
Match: CR352220.2 (pep chromosome:GRCz11:17:24588834:24631981:-1 gene:ENSDARG00000116881.1 transcript:ENSDART00000184711.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352220.2)

HSP 1 Score: 59.6918 bits (143), Expect = 1.742e-9
Identity = 72/271 (26.57%), Postives = 128/271 (47.23%), Query Frame = 1
Query:  118 KEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLY---YNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLF 921
            K  V+++ IF +    Y +++YL  +++   N +V   T    ++++E Y K  L+ +    F  Y   Y     S VL    +N L  + +  LS   +   +  + Q + +  L      L+S      W  +  ++  + H FNK    F +KD +K   V      P+++  L I ++   Y Y+Y + + ++ +   ++IY  + +P F K+  +A GE +  IE L + I F +  LYV++    S+ SN Y Y F+ NK IVLF
Sbjct:    9 KTKVIYMLIF-YSRYCYFYESYL-LQKRNAYNAMVYFPTKLGHLLSKETYFKTVLFELLRNNFSVYSSFYSEFIVSLVLRLGRHNFLQTL-RGGLSTHFAFGPSYAISQSICSLQL-----ALFSRSSSEQWSHWVRYLNSSGHRFNKVLEIF-LKDSMKKFAVLYCTYFPLTFKTLGINRIKNNYRYIYIYIYIYIYIYIYIYIYINYCSPWFFKFDLVAGGESRTQIELLKKTIIFRMTVLYVMDQYNHSNLSNVYLYSFFHNKYIVLF 270          
BLAST of CAAX prenyl protease vs. Ensembl Xenopus
Match: slc25a48 (solute carrier family 25 member 48 [Source:Xenbase;Acc:XB-GENE-5770986])

HSP 1 Score: 419.853 bits (1078), Expect = 6.646e-143
Identity = 211/448 (47.10%), Postives = 310/448 (69.20%), Query Frame = 1
Query:  118 KEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNY-------VADSDLNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            ++ ++F  + LF W+ Y W+AYL  RQ+++         +   IM+ E ++K+RLY +D   F  +  LY   E + +L    +P++W     ++       +   E+  S++FLL+A L+S   G+PW +Y+ FVIE RHGFN+QT  FF KD +K  LV+  ++LP++  LL+IIK+GG YF++YAW F  V+ + L+ IY ++IAPLFDK+TPL +G+LK+ IEN+A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y         D+  NE    +  + K+GCN++EV+AVLGHELGHWKL H +++++ISQ+N FL  F+F +L     LF AFGF   + PTLI L++I  ++FSPY+ VL F +T+LSR+ EF+AD FA  LG  + L +AL+KL+ DNL FP+ D ++S++++SHPP+LER++A
Sbjct:    6 RQNIIFYSVLLFSWIVYTWEAYLASRQRKIYRTTTHVPAELGNIMDAETFEKSRLYQLDKSTFSFWSGLYSEAEGTLILLLGGIPFLWNIAEQMLYRA--GFSAEYEIIHSLVFLLLATLFSAFTGLPWSLYNTFVIEERHGFNQQTLGFFFKDAVKKFLVTQCILLPVASLLLYIIKMGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGDLKESIENMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNKEGTEDTSGNENTELKNLNKKQGCNNQEVLAVLGHELGHWKLGHTVKNIVISQVNSFLCFFLFAVLIGRKELFAAFGFYNTQ-PTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFARNLGKAKDLYSALIKLNKDNLGFPVSDWVFSMWHYSHPPLLERLQA 450          
BLAST of CAAX prenyl protease vs. Ensembl Xenopus
Match: slc25a48 (solute carrier family 25 member 48 [Source:Xenbase;Acc:XB-GENE-5770986])

HSP 1 Score: 419.083 bits (1076), Expect = 1.379e-142
Identity = 214/453 (47.24%), Postives = 311/453 (68.65%), Query Frame = 1
Query:  103 LMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNY-------VADSDLNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            LM V  ++  F  + LF W+ Y W+AYL  RQ+++         +   IM+ E ++K+RLY +D   F  +  LY   E + +L    +P++W     ++       +   E+  S++FLL+A L+S   G+PW +Y+ FVIE RHGFN+QT  FF KD +K  LV+  ++LP++  LL+IIK+GG YF++YAW F  V+ + L+ IY ++IAPLFDK+TPL +G+LK+ IEN+A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y         D+  NE    +  + K+GCN++EV+AVLGHELGHWKL H +++++ISQ+N FL  F+F +L     LF AFGF   + PTLI L++I  ++FSPY+ VL F +T+LSR+ EF+AD FA  LG  + L +AL+KL+ DNL FP+ D ++S++++SHPP+LER++A
Sbjct:    6 LMSVESQI--FYSVLLFSWIVYTWEAYLASRQRKIYRTTTHVPAELGNIMDAETFEKSRLYQLDKSTFSFWSGLYSEAEGTLILLLGGIPFLWNIAEQMLYRA--GFSAEYEIIHSLVFLLLATLFSAFTGLPWSLYNTFVIEERHGFNQQTLGFFFKDAVKKFLVTQCILLPVASLLLYIIKMGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGDLKESIENMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNKEGTEDTSGNENTELKNLNKKQGCNNQEVLAVLGHELGHWKLGHTVKNIVISQVNSFLCFFLFAVLIGRKELFAAFGFYNTQ-PTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFARNLGKAKDLYSALIKLNKDNLGFPVSDWVFSMWHYSHPPLLERLQA 453          
BLAST of CAAX prenyl protease vs. Ensembl Xenopus
Match: slc25a48 (solute carrier family 25 member 48 [Source:Xenbase;Acc:XB-GENE-5770986])

HSP 1 Score: 416.001 bits (1068), Expect = 2.776e-141
Identity = 215/459 (46.84%), Postives = 314/459 (68.41%), Query Frame = 1
Query:   97 MKLMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV-----ADSDLNETENDQ-KPDV-----KKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            + L +++ E  +F  + LF W+ Y W+AYL  RQ+++         +   IM+ E ++K+RLY +D   F  +  LY   E + +L    +P++W     ++       +   E+  S++FLL+A L+S   G+PW +Y+ FVIE RHGFN+QT  FF KD +K  LV+  ++LP++  LL+IIK+GG YF++YAW F  V+ + L+ IY ++IAPLFDK+TPL +G+LK+ IEN+A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y         D +  EN + K  V     K+GCN++EV+AVLGHELGHWKL H +++++ISQ+N FL  F+F +L     LF AFGF   + PTLI L++I  ++FSPY+ VL F +T+LSR+ EF+AD FA  LG  + L +AL+KL+ DNL FP+ D ++S++++SHPP+LER++A
Sbjct:   10 LMLSEMSVESQIFYSVLLFSWIVYTWEAYLASRQRKIYRTTTHVPAELGNIMDAETFEKSRLYQLDKSTFSFWSGLYSEAEGTLILLLGGIPFLWNIAEQMLYRA--GFSAEYEIIHSLVFLLLATLFSAFTGLPWSLYNTFVIEERHGFNQQTLGFFFKDAVKKFLVTQCILLPVASLLLYIIKMGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGDLKESIENMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNKEGTEDTSGNENTELKAKVKNLNKKQGCNNQEVLAVLGHELGHWKLGHTVKNIVISQVNSFLCFFLFAVLIGRKELFAAFGFYNTQ-PTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFARNLGKAKDLYSALIKLNKDNLGFPVSDWVFSMWHYSHPPLLERLQA 465          
BLAST of CAAX prenyl protease vs. Ensembl Xenopus
Match: slc25a48 (solute carrier family 25 member 48 [Source:Xenbase;Acc:XB-GENE-5770986])

HSP 1 Score: 387.497 bits (994), Expect = 1.457e-130
Identity = 202/409 (49.39%), Postives = 289/409 (70.66%), Query Frame = 1
Query:  247 IMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV-----ADSDLNETENDQ-KPDV-----KKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            IM+ E ++K+RLY +D   F  +  LY   E + +L    +P++W     ++       +   E+  S++FLL+A L+S   G+PW +Y+ FVIE RHGFN+QT  FF KD +K  LV+  ++LP++  LL+IIK+GG YF++YAW F  V+ + L+ IY ++IAPLFDK+TPL +G+LK+ IEN+A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y         D +  EN + K  V     K+GCN++EV+AVLGHELGHWKL H +++++ISQ+N FL  F+F +L     LF AFGF   + PTLI L++I  ++FSPY+ VL F +T+LSR+ EF+AD FA  LG  + L +AL+KL+ DNL FP+ D ++S++++SHPP+LER++A
Sbjct:   20 IMDAETFEKSRLYQLDKSTFSFWSGLYSEAEGTLILLLGGIPFLWNIAEQMLYRA--GFSAEYEIIHSLVFLLLATLFSAFTGLPWSLYNTFVIEERHGFNQQTLGFFFKDAVKKFLVTQCILLPVASLLLYIIKMGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGDLKESIENMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNKEGTEDTSGNENTELKAKVKNLNKKQGCNNQEVLAVLGHELGHWKLGHTVKNIVISQVNSFLCFFLFAVLIGRKELFAAFGFYNTQ-PTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFARNLGKAKDLYSALIKLNKDNLGFPVSDWVFSMWHYSHPPLLERLQA 425          
BLAST of CAAX prenyl protease vs. Ensembl Xenopus
Match: slc25a48 (solute carrier family 25 member 48 [Source:Xenbase;Acc:XB-GENE-5770986])

HSP 1 Score: 340.502 bits (872), Expect = 1.965e-112
Identity = 191/457 (41.79%), Postives = 277/457 (60.61%), Query Frame = 1
Query:  103 LMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV-----ADSDLNETENDQ-KPDV-----KKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            L +++ E  +F  + LF W+ Y W+AYL  RQ+++         +   IM+ E ++K+RLY +D   F  +  LY   E + +L    +P++W     ++       +   E+  S++FLL+A L+S   G+PW +Y+ FVIE RHGFN+Q                                                    L+ IY ++IAPLFDK+TPL +G+LK+ IEN+A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y         D +  EN + K  V     K+GCN++EV+AVLGHELGHWKL H +++++ISQ+N FL  F+F +L     LF AFGF   + PTLI L++I  ++FSPY+ VL F +T+LSR+ EF+AD FA  LG  + L +AL+KL+ DNL FP+ D ++S++++SHPP+LER++A
Sbjct:    5 LSEMSVESQIFYSVLLFSWIVYTWEAYLASRQRKIYRTTTHVPAELGNIMDAETFEKSRLYQLDKSTFSFWSGLYSEAEGTLILLLGGIPFLWNIAEQMLYRA--GFSAEYEIIHSLVFLLLATLFSAFTGLPWSLYNTFVIEERHGFNQQV---------------------------------------------------LVTIYADYIAPLFDKFTPLPEGDLKESIENMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNKEGTEDTSGNENTELKAKVKNLNKKQGCNNQEVLAVLGHELGHWKLGHTVKNIVISQVNSFLCFFLFAVLIGRKELFAAFGFYNTQ-PTLIGLMIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFARNLGKAKDLYSALIKLNKDNLGFPVSDWVFSMWHYSHPPLLERLQA 407          
BLAST of CAAX prenyl protease vs. Ensembl Mouse
Match: Zmpste24 (zinc metallopeptidase, STE24 [Source:MGI Symbol;Acc:MGI:1890508])

HSP 1 Score: 414.075 bits (1063), Expect = 1.318e-140
Identity = 219/462 (47.40%), Postives = 313/462 (67.75%), Query Frame = 1
Query:  103 LMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNY-VADSD---------LNETENDQK------PDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            + D   E  +F  + LF W  YLW+ +L  RQ+R+         +   IM+ + ++K+RLY +D   F  +  LY  +E + +L +  +P++W+ +     S         E+  S++FLL+A L+S + G+PW +Y+ FVIE +HGFN QT  FF+KD IK  +V+  ++LP+S  LL+IIK+GG YF++YAW F  V+ + L+ IY ++IAPLFDK+TPL +G+LK+ IE +A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL+ Y V + D          NE E D +       + K+GC +EEV+AVLGHELGHWKL H ++++IISQ+N FL  F+F +L     LF AFGF + + PTLI LL+I  ++FSPY+ VL F +T+LSR+ EF+AD FA KLG  + L +AL+KL+ DNL FP+ D L+S +++SHPP+LER++A
Sbjct:   10 MWDFPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTRVPAELEQIMDSDTFEKSRLYQLDKSTFSFWSGLYSEVEGTFILLFGGIPYLWRLSGQFCSSA--GFGPEYEIIQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNHQTLEFFMKDAIKKFIVTQCILLPVSALLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKQEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVPNKDNQEESGMEARNEGEGDSEEVKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRRELFAAFGFYDSQ-PTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSTWHYSHPPLLERLQA 468          
BLAST of CAAX prenyl protease vs. Ensembl Mouse
Match: Zmpste24 (zinc metallopeptidase, STE24 [Source:MGI Symbol;Acc:MGI:1890508])

HSP 1 Score: 77.0258 bits (188), Expect = 2.230e-16
Identity = 43/148 (29.05%), Postives = 73/148 (49.32%), Query Frame = 1
Query:  199 QRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSA-------------------VLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQI 585
            +R+         +   IM+ + ++K+RLY +D   F  +  LY  +E +                    +L +  +P++W+ +     S         E+  S++FLL+A L+S + G+PW +Y+ FVIE +HGFN QT  FF+KD I
Sbjct:    1 RRIYKTTTRVPAELEQIMDSDTFEKSRLYQLDKSTFSFWSGLYSEVEGTDSSFPDHRRSESPILFHSLFILLFGGIPYLWRLSGQFCSSA--GFGPEYEIIQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNHQTLEFFMKDAI 146          
BLAST of CAAX prenyl protease vs. UniProt/SwissProt
Match: sp|O75844|FACE1_HUMAN (CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2)

HSP 1 Score: 414.461 bits (1064), Expect = 7.836e-140
Identity = 220/462 (47.62%), Postives = 316/462 (68.40%), Query Frame = 1
Query:  103 LMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNY-VADSDL---------NETENDQK------PDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            L ++  E  +F  + LF W  YLW+ +L  RQ+R+         +   IM+ E ++K+RLY +D   F  +  LY   E + +L +  +P++W+  LS             E+  S++FLL+A L+S + G+PW +Y+ FVIE +HGFN+QT  FF+KD IK  +V+  ++LP+S  LL+IIK+GG YF++YAW F  V+ + L+ IY ++IAPLFDK+TPL +G+LK+ IE +A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL+ Y V + D+         NE E + +       + K+GC +EEV+AVLGHELGHWKL H ++++IISQ+N FL  F+F +L     LF AFGF + + PTLI LL+I  ++FSPY+ VL F +T+LSR+ EF+AD FA KLG  + L +AL+KL+ DNL FP+ D L+S++++SHPP+LER++A
Sbjct:   10 LWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWR--LSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQ-PTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQA 468          
BLAST of CAAX prenyl protease vs. UniProt/SwissProt
Match: sp|Q80W54|FACE1_MOUSE (CAAX prenyl protease 1 homolog OS=Mus musculus OX=10090 GN=Zmpste24 PE=1 SV=2)

HSP 1 Score: 414.075 bits (1063), Expect = 9.221e-140
Identity = 219/462 (47.40%), Postives = 313/462 (67.75%), Query Frame = 1
Query:  103 LMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNY-VADSD---------LNETENDQK------PDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            + D   E  +F  + LF W  YLW+ +L  RQ+R+         +   IM+ + ++K+RLY +D   F  +  LY  +E + +L +  +P++W+ +     S         E+  S++FLL+A L+S + G+PW +Y+ FVIE +HGFN QT  FF+KD IK  +V+  ++LP+S  LL+IIK+GG YF++YAW F  V+ + L+ IY ++IAPLFDK+TPL +G+LK+ IE +A+ I+FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL+ Y V + D          NE E D +       + K+GC +EEV+AVLGHELGHWKL H ++++IISQ+N FL  F+F +L     LF AFGF + + PTLI LL+I  ++FSPY+ VL F +T+LSR+ EF+AD FA KLG  + L +AL+KL+ DNL FP+ D L+S +++SHPP+LER++A
Sbjct:   10 MWDFPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTRVPAELEQIMDSDTFEKSRLYQLDKSTFSFWSGLYSEVEGTFILLFGGIPYLWRLSGQFCSSA--GFGPEYEIIQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNHQTLEFFMKDAIKKFIVTQCILLPVSALLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKQEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVPNKDNQEESGMEARNEGEGDSEEVKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRRELFAAFGFYDSQ-PTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSTWHYSHPPLLERLQA 468          
BLAST of CAAX prenyl protease vs. UniProt/SwissProt
Match: sp|Q3Y6B8|FACE_TAESO (CAAX prenyl protease 1 homolog OS=Taenia solium OX=6204 GN=TsSte24p PE=1 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 4.959e-139
Identity = 227/463 (49.03%), Postives = 303/463 (65.44%), Query Frame = 1
Query:  106 MDVNKEVVLFLC-------IFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFT------LSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV-----ADSDLNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            MDV   + L+ C       I +F+W+ +LW+ Y++ RQ +V  ++ E   +   +MN+ ++ K+R Y+ID   F      Y ++  SAVLY+ ++ W W  +      +     +    T   E+  S+LF +   L+ F   +PW  Y  FVIE R+GFNKQT  FFIKD++KSL V +++ LPI   L++IIK GG YFY+YA+ F FV+   +MFIYPEFIAP+FD+Y    D EL+K IE LA  IEFPLKKLYVVEGSKRSSHSNAYFYGF KNKRIVLFDTL++ +      ADS  N  E+  +   +   +DEE++A L HELGHWKL H+  +LII+QIN+F M F FG L N++ LF  FGF     P LIRL+++  ++F PY  VLEF MT+LSRK EF+AD FAV L  GEKL +AL+ L  DNLSFP++D LYS+ NHSHPPI+ER+ A
Sbjct:    1 MDVGGALDLYGCSVNVYNAILIFIWVLFLWETYINLRQLKVAKRVTESPEEIKCLMNDVDFDKSRRYAIDKMNFDIVSGFYNILSLSAVLYFQLIAWAWHKSQEHMLFVCSYAPRSFGTTEGSEILFSLLFTVYVALFQFFESLPWSYYRHFVIEERYGFNKQTIGFFIKDRLKSLAVGLVIGLPIISMLVWIIKAGGHYFYIYAYGFTFVVSFIIMFIYPEFIAPIFDRYEHFPDCELRKKIEELAASIEFPLKKLYVVEGSKRSSHSNAYFYGFGKNKRIVLFDTLIKGFKMPGVEADSSANADESSDETQNRGCGDDEEILATLAHELGHWKLKHMTFNLIIAQINIFFMFFAFGQLINVDQLFVDFGFPPSTAPILIRLIVVFQFIFMPYSSVLEFLMTMLSRKFEFQADAFAVSLKSGEKLKSALLVLTKDNLSFPVYDWLYSMCNHSHPPIIERLAA 463          
BLAST of CAAX prenyl protease vs. UniProt/SwissProt
Match: sp|Q9XVE5|FACE1_CAEEL (CAAX prenyl protease 1 homolog OS=Caenorhabditis elegans OX=6239 GN=fce-1 PE=1 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 9.420e-117
Identity = 204/447 (45.64%), Postives = 275/447 (61.52%), Query Frame = 1
Query:  130 LFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQN---------YVADSD-LNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            LF  +    W  +LWD Y+  RQ +     V+   +   ++ EE+YKKAR Y ID   FG +H  +  +  +A L     P++W  T S  +    +V V         FL I  +   +  +PW +YS F+IE  HGFNKQT  F+  D+IK +LV   L +PI Y + +II  GGPYF+VY W F  V+++ LM IYP FIAPLFDKY PL DG+LK  IE LA  + +PL +LYVV GSKRS+HSNAY YGFWKNKRIVL+DTLL           YVA  + + ETEND+    K+G N++EV+AVLGHELGHW L H L +L+I+++NLF    +FG  +    L++ FG+   +TP +I ++LI  ++ + Y+ +    M + SR  EF ADEFA  LG+GE LI AL KL  DNLS PI D+LYS   H+HPP++ER+ A
Sbjct:    6 LFKALLATNWALFLWDQYITFRQYKAHKNAVKRPNEVKELIGEEDYKKARDYKIDNHLFGFFHSWFNQLLLTAQLIGGYYPFLWYATASYPL----HVAV---------FLSINSIIETIIDLPWDLYSTFIIEDAHGFNKQTIGFYFVDKIKKMLVGFALTMPIVYGIEWIIVNGGPYFFVYIWLFVSVVVLLLMTIYPTFIAPLFDKYFPLPDGDLKTKIEQLAASLSYPLTELYVVNGSKRSAHSNAYMYGFWKNKRIVLYDTLLSGAEKEKVHELYVAAGEKIEETENDK----KRGMNNDEVVAVLGHELGHWALWHTLINLVITEVNLFFSFAVFGYFYKWEALYQGFGYH--DTPPVIGMMLIFQFVLALYNQLASIGMVIHSRSAEFGADEFAANLGHGENLIGALTKLGVDNLSMPINDSLYSWCTHTHPPVVERVAA 433          
BLAST of CAAX prenyl protease vs. UniProt/SwissProt
Match: sp|Q8RX88|FACE1_ARATH (CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana OX=3702 GN=FACE1 PE=1 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 5.773e-111
Identity = 188/431 (43.62%), Postives = 269/431 (62.41%), Query Frame = 1
Query:  151 FMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNETENDQKPDVKKGC-NDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            FM + Y+++ YLD RQ   L     P T   +I ++E ++K+R YS+D   F   H+   ++  SA+L++ +LPW WK  +S  V     +    E+  ++ FL     +S +  +P+ +YS FVIE+RHGFNKQT + FI+D IK   +S+IL  PI   ++FI++ GGPY  +Y W F F++ + +M IYP  IAPLF+K+TPL DG+L++ IE LA  ++FPLKKL+VV+GS RSSHSNAY YGF+KNKRIVL+DTL+Q                      C N++E++AV+ HELGHWKLNH   S I  QI  FL    + ++ N   LFR+FGF   +T  ++  L+I  +   P   ++ F + L+SR  EF+AD FAVKLGY + L  ALVKL  +NLS    D LYS +++SHPP++ER+ A
Sbjct:   12 FMIVMYIFETYLDLRQLTALKLPTLPKTLVGVI-SQEKFEKSRAYSLDKSYFHFVHEFVTILMDSAILFFGILPWFWK--MSGAVLPRLGLDPENEILHTLSFLAGVMTWSQITDLPFSLYSTFVIESRHGFNKQTIWMFIRDMIKGTFLSVILGPPIVAAIIFIVQKGGPYLAIYLWAFMFILSLVMMTIYPVLIAPLFNKFTPLPDGDLREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQ---------------------CKNEDEIVAVIAHELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGF---DTQPVLIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRA 415          
BLAST of CAAX prenyl protease vs. TrEMBL
Match: A0A183MXJ0 (CAAX prenyl protease OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS20765 PE=3 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 1.153e-149
Identity = 233/459 (50.76%), Postives = 323/459 (70.37%), Query Frame = 1
Query:  121 EVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTT---DTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQ------------ELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV---ADSDLNETENDQKPDVKKGCN-DEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
             + LFL +F+F+W  Y+W+ YL  RQ++   K+V+ TT   + + +M+ + ++K+RLY+ID   FG    LY MIE S  LY++++PW+W   ++   S + N  V+             E+  S++F L   ++ F   +PW +YS FVIEARHGFNKQT  FFIKDQIKSLL+S+I+ +PI  CL++IIK+GG YFY+YA+ F  V+ +FLMF+YPEFIAPLFD+Y PL DG LK  IE LA  I+FPLKKL VVEGS+RS+HSNAYFYGF KNKRIV+FDTL++ +     + DL + E     D ++GC  DEE+++V+ HELGHWKL H + +L I + NL ++  +FG+L +++ LF +FGF   +TP ++RL +I  Y+FSPY+ V++F MT+LSRK EF+AD FA KLGY + L +ALV L  DNLSFP+ D LYS+FNHSHPP+LER+ A
Sbjct:   14 NMTLFLAVFVFLWCMYIWETYLSIRQRK---KIVDTTTVPIELASVMDNDKFQKSRLYAIDRSSFGLVSGLYHMIELSVTLYFSLIPWLWYTVVNH--STILNTYVLHKFGVDMGFDKDSEIKCSVIFFLYVAVFVFFDSLPWTIYSTFVIEARHGFNKQTFGFFIKDQIKSLLISMIIGIPIMSCLVWIIKVGGHYFYLYAFLFTVVVTVFLMFVYPEFIAPLFDRYEPLPDGSLKTKIETLAASIKFPLKKLLVVEGSRRSAHSNAYFYGFGKNKRIVIFDTLIRGFKFPNKNEDLAKQETKNDSD-QRGCAVDEEILSVIAHELGHWKLGHTIYNLFIGKANLLMLFVIFGLLMDVDDLFISFGFKSDDTPVILRLFIIFQYIFSPYNTVMDFLMTVLSRKFEFQADAFAAKLGYRQYLKSALVILLKDNLSFPVCDWLYSMFNHSHPPLLERLSA 466          
BLAST of CAAX prenyl protease vs. TrEMBL
Match: A0A4Z2CYI6 (CAAX prenyl protease OS=Schistosoma japonicum OX=6182 GN=EWB00_006515 PE=3 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 1.231e-149
Identity = 231/454 (50.88%), Postives = 316/454 (69.60%), Query Frame = 1
Query:  121 EVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMW------KFTLSLVVSKVENVTV----IQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV---ADSDLNETENDQKPDVKKGCN-DEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
             V LFL +F+FMW TYLW+ YL  RQ+R +        + S +M+ + ++K+RLY+ID   F     LY M+E S  LY++++PW+W         L++ +    ++ V      E+  S++F L   +++F   +PW  YS FVIEARHGFNKQT  FF+KDQIKS  +S+I+ +P+  CL++IIK+GG YFY+YA+ F  V+ +FLMF+YPEFIAPLFD+Y PL DG LK  IE LA  I+FPLKKL VVEGS+RS+HSNAYFYGF KNKRIV+FDTL++ +     + D+   E     D ++GC  DEE++AV+ HELGHWKL H + +L I + NL L+  +FG+L +++ LF +FGF   +TPT++RL +I  Y+FSPY+ VL+F MT+LSRK EF+AD FA KLGY + L +ALV L  DNLSFP+ D LYS+FNHSHPP+LER+ A
Sbjct:   14 NVTLFLAVFIFMWCTYLWETYLSIRQKRKIIDSRAVPIELSSVMDNDKFQKSRLYAIDRSNFSLISGLYHMMELSVTLYFSLIPWLWYTVVNHSIILNIYIQNKLSIDVGLGPDSEIKCSIIFFLYVAIFAFFDSLPWSTYSTFVIEARHGFNKQTFGFFLKDQIKSFFISMIIGIPVMACLVWIIKVGGQYFYLYAFLFTVVVTVFLMFVYPEFIAPLFDRYEPLPDGSLKTKIETLAASIKFPLKKLLVVEGSRRSAHSNAYFYGFGKNKRIVIFDTLIRGFKFPNKNEDITTQETKDDSD-QRGCAVDEEILAVIAHELGHWKLGHTIYNLFIGKANLLLLFVVFGLLMDMDDLFISFGFRINDTPTILRLFIIFQYIFSPYNTVLDFLMTVLSRKFEFQADAFAAKLGYKDYLKSALVTLLKDNLSFPVCDWLYSMFNHSHPPLLERLSA 466          
BLAST of CAAX prenyl protease vs. TrEMBL
Match: A0A094ZX19 (CAAX prenyl protease OS=Schistosoma haematobium OX=6185 GN=MS3_06049 PE=3 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 5.115e-149
Identity = 233/459 (50.76%), Postives = 322/459 (70.15%), Query Frame = 1
Query:  121 EVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTT---DTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQ------------ELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV---ADSDLNETENDQKPDVKKGCN-DEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
             + LFL +F+F+W  Y+W+ YL  RQ+R   K+V+  T   + + +M+ + ++K+RLY+ID   FG    LY MIE S  LY++++PW+W   ++   S + N  V+             E+  S++F L   ++ F   +PW +YS FVIEARHGFNKQT  FFIKDQIKSLL+S+I+ +PI  CL++IIK+GG YFY+YA+ F  V+ +FLMF+YPEFIAPLFD+Y PL DG LK  IE LA  I+FPLKKL VVEGS+RS+HSNAYFYGF KNKRIV+FDTL++ +     + DL + E     D ++GC  DEE+++V+ HELGHWKL H + +L I + NL ++  +FG+L +++ LF +FGF   +TP ++RL +I  Y+FSPY+ V++F MT+LSRK EF+AD FA KLGY + L +ALV L  DNLSFP+ D LYS+FNHSHPP+LER+ A
Sbjct:   14 NMTLFLAVFVFLWCMYIWETYLSIRQRR---KIVDTRTVPIELASVMDNDKFQKSRLYAIDRSSFGLVSGLYHMIELSVTLYFSLIPWLWYTVVNH--STILNTYVLHKFGVDMGFDKDSEIKCSVIFFLYVAVFVFFDSLPWTIYSTFVIEARHGFNKQTFGFFIKDQIKSLLISMIIGIPIMSCLVWIIKVGGHYFYLYAFLFTVVVTVFLMFVYPEFIAPLFDRYEPLPDGSLKTKIETLAASIKFPLKKLLVVEGSRRSAHSNAYFYGFGKNKRIVIFDTLIRGFKFPNKNEDLAKQETKNDSD-QRGCAVDEEILSVIAHELGHWKLGHTIYNLFIGKANLLMLFVIFGLLMDVDDLFISFGFKSDDTPIILRLFIIFQYIFSPYNTVMDFLMTVLSRKFEFQADAFAAKLGYKQYLKSALVILLKDNLSFPVCDWLYSMFNHSHPPLLERLSA 466          
BLAST of CAAX prenyl protease vs. TrEMBL
Match: A0A183KDJ7 (CAAX prenyl protease OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS13089 PE=3 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 5.115e-149
Identity = 233/459 (50.76%), Postives = 322/459 (70.15%), Query Frame = 1
Query:  121 EVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTT---DTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQ------------ELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV---ADSDLNETENDQKPDVKKGCN-DEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
             + LFL +F+F+W  Y+W+ YL  RQ+R   K+V+  T   + + +M+ + ++K+RLY+ID   FG    LY MIE S  LY++++PW+W   ++   S + N  V+             E+  S++F L   ++ F   +PW +YS FVIEARHGFNKQT  FFIKDQIKSLL+S+I+ +PI  CL++IIK+GG YFY+YA+ F  V+ +FLMF+YPEFIAPLFD+Y PL DG LK  IE LA  I+FPLKKL VVEGS+RS+HSNAYFYGF KNKRIV+FDTL++ +     + DL + E     D ++GC  DEE+++V+ HELGHWKL H + +L I + NL ++  +FG+L +++ LF +FGF   +TP ++RL +I  Y+FSPY+ V++F MT+LSRK EF+AD FA KLGY + L +ALV L  DNLSFP+ D LYS+FNHSHPP+LER+ A
Sbjct:   14 NMTLFLAVFVFLWCMYIWETYLSIRQRR---KIVDTRTVPIELASVMDNDKFQKSRLYAIDRSSFGLVSGLYHMIELSVTLYFSLIPWLWYTVVNH--STILNTYVLHKFGVDMGFDKDSEIKCSVIFFLYVAVFVFFDSLPWTIYSTFVIEARHGFNKQTFGFFIKDQIKSLLISMIIGIPIMSCLVWIIKVGGHYFYLYAFLFTVVVTVFLMFVYPEFIAPLFDRYEPLPDGSLKTKIETLAASIKFPLKKLLVVEGSRRSAHSNAYFYGFGKNKRIVIFDTLIRGFKFPNKNEDLAKQETKNDSD-QRGCAVDEEILSVIAHELGHWKLGHTIYNLFIGKANLLMLFVIFGLLMDVDDLFISFGFKSDDTPIILRLFIIFQYIFSPYNTVMDFLMTVLSRKFEFQADAFAAKLGYKQYLKSALVILLKDNLSFPVCDWLYSMFNHSHPPLLERLSA 466          
BLAST of CAAX prenyl protease vs. TrEMBL
Match: G4VC95 (CAAX prenyl protease OS=Schistosoma mansoni OX=6183 GN=Smp_082620 PE=3 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 2.275e-147
Identity = 233/461 (50.54%), Postives = 323/461 (70.07%), Query Frame = 1
Query:  121 EVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTT---DTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVI------------QELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYV---ADSDL--NETENDQKPDVKKGCN-DEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            ++ LFL +F+F+W  Y+W+ YL  RQ+R   K+V+  T   + + +M+ + ++K+RLY+ID   FG     Y MIE S  LY++++PW+W   ++   S + N  V+             E+  S++F L   ++ F   +PW +YS FVIEARHGFNKQT  FFIKDQIKSLL+S+I+ +PI  CL++IIK+GG YFY+YA+ F  V+ +FLMF+YPEFIAPLFD+Y PL DG LK  IE LA  I+FPLKKL VVEGS+RS+HSNAYFYGF  NKRIV+FDTL++ +     + DL   ET+ND +   ++GC  DEE+++V+ HELGHWKL H + +L I + NL ++  +FG+L +++ LF +FGF   +TP ++RL +I  Y+FSPY+ V++F MT+LSRK EF+AD FA KLGY   L +ALV L  DNLSFP+ D LYS+FNHSHPP+LER+ A
Sbjct:   14 KMTLFLAVFVFLWCMYIWETYLSIRQRR---KIVDTRTVPIELASVMDNDKFQKSRLYAIDRSSFGLVSGFYHMIELSVTLYFSLIPWLWYTVVNH--STILNAYVVDKFGVDMGFDKDSEIKCSVIFFLYVAVFVFFDSLPWTIYSTFVIEARHGFNKQTFGFFIKDQIKSLLISMIIGIPIMSCLVWIIKVGGHYFYLYAFLFTVVVTVFLMFVYPEFIAPLFDRYEPLPDGPLKTKIETLAASIKFPLKKLLVVEGSRRSAHSNAYFYGFGNNKRIVIFDTLIRGFKFPNKNEDLTKQETKNDSE---QRGCAVDEEILSVIAHELGHWKLGHTVYNLFIGKANLLMLFVIFGLLMDVDDLFISFGFKSNDTPVILRLFIIFQYIFSPYNTVIDFLMTVLSRKFEFQADAFAAKLGYKHYLKSALVILLKDNLSFPVCDWLYSMFNHSHPPLLERLSA 466          
BLAST of CAAX prenyl protease vs. Ensembl Cavefish
Match: zmpste24 (zinc metallopeptidase STE24 [Source:NCBI gene;Acc:103025887])

HSP 1 Score: 416.001 bits (1068), Expect = 1.597e-141
Identity = 215/463 (46.44%), Postives = 317/463 (68.47%), Query Frame = 1
Query:  100 KLMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVA---------------DSDLNETENDQKPDVKK-GCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            +L+ +  +  +F  + +F W  YLW+AYL  RQ+R+    +   T+   IM+ E ++K+RLY +D   FG +  LY   E + +L    +P++WK + +L       +    E++ S++FL++A L+S   G+PW +Y+ FVIE +HGFN+QT  FF+KD +K   V+  ++LP++  LL+IIK+GG YF++YAW F  ++ + L+ IY ++IAPLFDK+TPL DGELK  IE++++ I FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y                 +S+++  E+  KP  KK GC++ EV+AVLGHELGHWKL H ++++IISQ+N FL  F+F  L     LF AFGF + + PTLI L++I  ++FSPY+ +L F +T+LSR+ EF+AD FA  LG   +L +AL+KL+ DNL FP+ D L+S++++SHPP+LER+ A
Sbjct:    4 ELLQLPVQDQIFYAVLVFSWTVYLWEAYLAYRQRRIYRSTMHVPTELGKIMDSETFEKSRLYQLDKSNFGFWSGLYSETEGTLILLLGGIPFLWKISGNLTARF--GLGPEYEISQSLVFLMLATLFSAFTGLPWSLYNTFVIEEKHGFNQQTLGFFLKDALKKFAVTQCILLPVTSLLLYIIKIGGDYFFIYAWLFTLIVSLVLVTIYADYIAPLFDKFTPLPDGELKTDIESMSKSISFPLTKIYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNQSGEGEAATEQKEESEVSGDESKPKPKNKKQGCSNPEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAALIGRKELFLAFGFNDSQ-PTLIGLMIIFQFIFSPYNELLSFCLTVLSRRFEFQADRFARGLGRSAELYSALIKLNKDNLGFPVADWLFSMWHYSHPPLLERLRA 463          
BLAST of CAAX prenyl protease vs. Ensembl Cavefish
Match: zmpste24 (zinc metallopeptidase STE24 [Source:NCBI gene;Acc:103025887])

HSP 1 Score: 342.813 bits (878), Expect = 1.415e-113
Identity = 193/463 (41.68%), Postives = 281/463 (60.69%), Query Frame = 1
Query:  100 KLMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVA---------------DSDLNETENDQKPDVKK-GCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            +L+ +  +  +F  + +F W  YLW+AYL  RQ+R+    +   T+   IM+ E ++K+RLY +D   FG +  LY   E + +L    +P++WK + +L       +    E++ S++FL++A L+S   G+PW +Y+ FVIE +HGFN+Q                                                    L+ IY ++IAPLFDK+TPL DGELK  IE++++ I FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y                 +S+++  E+  KP  KK GC++ EV+AVLGHELGHWKL H ++++IISQ+N FL  F+F  L     LF AFGF + + PTLI L++I  ++FSPY+ +L F +T+LSR+ EF+AD FA  LG   +L +AL+KL+ DNL FP+ D L+S++++SHPP+LER+ A
Sbjct:    4 ELLQLPVQDQIFYAVLVFSWTVYLWEAYLAYRQRRIYRSTMHVPTELGKIMDSETFEKSRLYQLDKSNFGFWSGLYSETEGTLILLLGGIPFLWKISGNLTARF--GLGPEYEISQSLVFLMLATLFSAFTGLPWSLYNTFVIEEKHGFNQQV---------------------------------------------------LVTIYADYIAPLFDKFTPLPDGELKTDIESMSKSISFPLTKIYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNQSGEGEAATEQKEESEVSGDESKPKPKNKKQGCSNPEVLAVLGHELGHWKLGHTIKNIIISQMNSFLCFFLFAALIGRKELFLAFGFNDSQ-PTLIGLMIIFQFIFSPYNELLSFCLTVLSRRFEFQADRFARGLGRSAELYSALIKLNKDNLGFPVADWLFSMWHYSHPPLLERLRA 412          
BLAST of CAAX prenyl protease vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009419.1 (pep scaffold:Pmarinus_7.0:GL497832:1044:2209:-1 gene:ENSPMAG00000008527.1 transcript:ENSPMAT00000009419.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 2.442e-17
Identity = 44/81 (54.32%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1000 GCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFV 1242
            GC++EEV+AVLGHELGHWKL H  ++L+ISQ+N  L   +F  L     LF AFGF + E PTLI L++I  ++FSPY+ V
Sbjct:    1 GCSNEEVLAVLGHELGHWKLGHTTKNLVISQVNSLLCFSLFAALIGRPELFAAFGFHD-ERPTLIGLIIIFQFVFSPYNEV 80          
BLAST of CAAX prenyl protease vs. Ensembl Yeast
Match: STE24 (Highly conserved zinc metalloprotease; functions in two steps of a-factor maturation, C-terminal CAAX proteolysis and the first step of N-terminal proteolytic processing; cleaves both isoprenylated and non-prenylated oligopeptides; contains multiple transmembrane spans; human homolog ZMPSTE24 implicated in mandibuloacral dysplasia (MAD), and can complement yeast null mutant [Source:SGD;Acc:S000003878])

HSP 1 Score: 229.18 bits (583), Expect = 4.898e-70
Identity = 158/450 (35.11%), Postives = 243/450 (54.00%), Query Frame = 1
Query:  136 LCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVE-NVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGF-WKNKRIVLFDTLLQNYVADSDLNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGF-------------VEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            L I  F    + +++YL  RQ + L++   P      I ++E + K+R YS    +F  +  +Y + +    + Y++ P +W   +SL+ + +     ++  +  S+ FL +    S +  +P   YS FV+E + GFNK T   +I D IKSL ++  +  PI Y  L I       F  Y   F FV+ +  M I P FI P+F+K+TPL DGELKK IE+LA+++ FPL K++V++GSKRSSHSNAYF G  + +KRIVLFDTL+ +   D                     E+ AVL HE+GHW+ NH++  +I SQ++ FL+  +F  ++     +  FGF             +  E P +I  +L    L +P    ++F M+L+SR  E++AD +A KLGY + L  AL+ L   NLS    D LYS +++SHP + ER+ A
Sbjct:   17 LIISGFSIAQFSFESYLTYRQYQKLSETKLPPVLEDEI-DDETFHKSRNYSRAKAKFSIFGDVYNLAQKLVFIKYDLFPKIWHMAVSLLNAVLPVRFHMVSTVAQSLCFLGLLSSLSTLVDLPLSYYSHFVLEEKFGFNKLTVQLWITDMIKSLTLAYAIGGPILYLFLKIFDKFPTDFLWYIMVFLFVVQILAMTIIPVFIMPMFNKFTPLEDGELKKSIESLADRVGFPLDKIFVIDGSKRSSHSNAYFTGLPFTSKRIVLFDTLVNSNSTD---------------------EITAVLAHEIGHWQKNHIVNMVIFSQLHTFLIFSLFTSIYRNTSFYNTFGFFLEKSTGSFVDPVITKEFPIIIGFML-FNDLLTPLECAMQFVMSLISRTHEYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTA 443          
BLAST of CAAX prenyl protease vs. Ensembl Nematostella
Match: EDO31610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXF6])

HSP 1 Score: 422.55 bits (1085), Expect = 9.188e-145
Identity = 219/447 (48.99%), Postives = 305/447 (68.23%), Query Frame = 1
Query:  124 VVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNE---TENDQKPDV-----KKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            V +F  +F+F+WL YLW++YL  RQ ++  +  +   +   ++ ++ ++KAR Y +D   +G YH +Y  IE+S +L    +P++W  + +L+       T   E+  SM FL+ A ++S +  +PW +YS FVIE RHGFNKQT  FFIKD IK L+V + +MLP+S  L+FIIK GG YF++YAW F   I + ++ +Y ++IAPLFDK+TPL +G L+  IE LA  I+FPL K+ VVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL       D +E    +ND K D      +KGC+++EV+AVLGHELGHW L+H L++LIISQ N      +FGIL +  VL+ AFGF     P LI L++I  ++FSPY+ +L F MT+L+R+ EF+AD FA +LG+   L +AL+KLH DNL FPI D LYS +++SHPP+LER+ A
Sbjct:    2 VDVFSAVFVFLWLVYLWESYLSYRQHKLFKETEDIPVELKDVLEKDTFEKARKYQLDRSTYGFYHGIYSQIETSVILLLGGIPFLWNISGNLIAKF--GFTTEYEITHSMSFLICAVIFSTITDLPWSLYSTFVIEERHGFNKQTLGFFIKDSIKKLVVMMAIMLPVSAGLIFIIKWGGQYFFLYAWLFTIFITLVIVTVYLDYIAPLFDKFTPLPEGALRTAIEKLALSIDFPLTKILVVEGSKRSSHSNAYFYGFYKNKRIVLFDTLLAESPTKKDEDEISGKDNDSKTDSSSEHKQKGCSNDEVLAVLGHELGHWSLSHNLKNLIISQFNTLFCFLIFGILMHEKVLYEAFGFN--SQPVLIGLIIIFQFVFSPYNELLGFLMTILTRRFEFQADAFAKQLGFAPHLRSALIKLHQDNLGFPIADKLYSAYHYSHPPLLERLRA 444          
BLAST of CAAX prenyl protease vs. Ensembl Nematostella
Match: EDO47143 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMR9])

HSP 1 Score: 84.3445 bits (207), Expect = 2.198e-17
Identity = 38/66 (57.58%), Postives = 51/66 (77.27%), Query Frame = 1
Query: 1243 LEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            L F MT+L+R+ EF+AD FA +LG+   L +AL+KLH DNL FPI D LYS +++SHPP+LER+ A
Sbjct:  492 LGFLMTILTRRFEFQADAFAKQLGFAPHLRSALIKLHQDNLGFPIADKLYSAYHYSHPPLLERLRA 557          
BLAST of CAAX prenyl protease vs. Ensembl Medaka
Match: zmpste24 (zinc metallopeptidase STE24 [Source:NCBI gene;Acc:101167159])

HSP 1 Score: 421.394 bits (1082), Expect = 1.392e-143
Identity = 215/459 (46.84%), Postives = 309/459 (67.32%), Query Frame = 1
Query:  103 LMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNY-----VADSDLNETENDQ-------KPDVKK-GCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            ++++  E  +F  +  F W  YLW+AYL  RQ+R          +   IM+ E ++K+RLY +D   F  +  LY   E + +L    +P++W    SL        T   E+  S++FL +A L+S + G+PW +Y+ FVIE +HGFN+QT  FF KD +K  +V+  ++LP++  LL+IIK+GG YF++YAW F   + + L+ IY ++IAPLFDK+TPL +GELK  IE++A+ I FPL K+YVVEGSKRSSHSNAYFYGF+KNKRIVLFDTLL++Y       +S   ETEND+       KP  KK GCN++E++AVLGHELGHWKL H +++++ISQ+N FL   +F +L     LF AFGF   + PTLI L++I  ++FSPY+ +L F +T+LSR+ EF+AD FA  +G   +L +AL+KL+ DNL FP+ D L+S++++SHPP+LER+ A
Sbjct:    5 ILNLPVEKQIFYAVLAFSWTVYLWEAYLSYRQRRTYRSTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWSGLYSETEGTLILLLGGIPFLWDIAGSLAARF--GFTPEHEITQSLVFLTLATLFSALTGLPWSLYNTFVIEEKHGFNQQTLGFFFKDAVKKFVVTQCILLPVTSLLLYIIKIGGDYFFIYAWLFTLAVSLVLVTIYADYIAPLFDKFTPLPEGELKTAIEDMAKSISFPLTKIYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNKAGESQPEETENDETVSESKTKPKNKKQGCNNQEILAVLGHELGHWKLGHTVKNIVISQMNSFLCFSLFAVLIGRKELFVAFGFTNTQ-PTLIGLMIIFQFIFSPYNELLSFCLTVLSRRFEFQADAFARSMGKASQLYSALIKLNKDNLGFPVADWLFSMWHYSHPPLLERLRA 460          
BLAST of CAAX prenyl protease vs. Planmine SMEST
Match: SMESG000023418.1 (SMESG000023418.1)

HSP 1 Score: 390.578 bits (1002), Expect = 4.886e-131
Identity = 207/453 (45.70%), Postives = 296/453 (65.34%), Query Frame = 1
Query:  121 EVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLVEPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLPWMWKFTLSL---------VVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIFVIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFYVYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEFPLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNY----VADSDLNETENDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQXXXXXXXXXXXXXXXXXVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSRKKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPILERIEA 1440
            EV+LF  I  F W  + WD+YL+ RQ++VL K  +P  +     N ENY KARLYS+D   F  Y+  Y M+E   +L  + L W+W F++S          V+S  E++    E  AS +FL++     F+ G+PWK+Y  F++E RH     +   F  DQIKS + ++I++LPI++CLL +IKLGG YFY+YAW F+F++M  L  +YPEFIAP F     L D  LK+ IENLA+++ FPL +++V +G+K+ +H+N Y +G + +KRI + D LL+N     + +   ++   DQ   +    ++EE+IA+L  E GHW  NH  QS+++ QINLF+M +  G LFN  VLF  FGF E+ TP LI+L++I  +LFSPY+ +LEF M L+SR+ EF+ADEFAVKLG G+ LINAL KL ND+L+FP+ D  YS+FN+SHP ILERI+A
Sbjct:   48 EVLLFFGILAFSWTMFAWDSYLNFRQRKVLTKAKQPPFEILSTFNTENYGKARLYSLDNNLFNMYNSWYAMLEIMIILIGDGLSWLWSFSVSCTRQLRRENSVLSMGEDILEEHEFAASTMFLILLVTIIFLNGLPWKIYHTFILEKRHELLNISWDLFFLDQIKSYIGTLIIILPITFCLLNVIKLGGKYFYLYAWGFSFIMMTTLRILYPEFIAPKFKTQLALNDDSLKRSIENLADRVNFPLSEVFVTKGTKQFNHTNIYLFGCFTDKRIAIVDDLLRNRPTSKIGNKLDSQVTGDQTTKLDPTFSNEEIIALLSREFGHWAYNHFTQSIVVGQINLFVMFYALGCLFNYGVLFEIFGFTEVGTPNLIKLIIIFQFLFSPYNALLEFIMALISRRNEFQADEFAVKLGKGKFLINALAKLQNDSLTFPLSDKWYSVFNNSHPTILERIKA 500          
The following BLAST results are available for this feature:
BLAST of CAAX prenyl protease vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZMPSTE241.632e-14047.62zinc metallopeptidase STE24 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fce-17.406e-11845.64CAAX prenyl protease 1 homolog [Source:UniProtKB/... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ste24a1.966e-12245.41gene:FBgn0034176 transcript:FBtr0087059[more]
ste24b6.285e-5530.02gene:FBgn0034175 transcript:FBtr0087060[more]
ste24c2.207e-5329.34gene:FBgn0050462 transcript:FBtr0100120[more]
ste24c2.207e-5329.34gene:FBgn0050462 transcript:FBtr0336870[more]
ste24c2.207e-5329.34gene:FBgn0050462 transcript:FBtr0346515[more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zmpste242.666e-14146.77zinc metallopeptidase, STE24 homolog [Source:ZFIN;... [more]
zmpste247.321e-14146.55zinc metallopeptidase, STE24 homolog [Source:ZFIN;... [more]
CR352220.28.039e-1225.00pep chromosome:GRCz11:17:24588834:24631981:-1 gene... [more]
CR352220.21.742e-926.57pep chromosome:GRCz11:17:24588834:24631981:-1 gene... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a486.646e-14347.10solute carrier family 25 member 48 [Source:Xenbase... [more]
slc25a481.379e-14247.24solute carrier family 25 member 48 [Source:Xenbase... [more]
slc25a482.776e-14146.84solute carrier family 25 member 48 [Source:Xenbase... [more]
slc25a481.457e-13049.39solute carrier family 25 member 48 [Source:Xenbase... [more]
slc25a481.965e-11241.79solute carrier family 25 member 48 [Source:Xenbase... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Zmpste241.318e-14047.40zinc metallopeptidase, STE24 [Source:MGI Symbol;Ac... [more]
Zmpste242.230e-1629.05zinc metallopeptidase, STE24 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of CAAX prenyl protease vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75844|FACE1_HUMAN7.836e-14047.62CAAX prenyl protease 1 homolog OS=Homo sapiens OX=... [more]
sp|Q80W54|FACE1_MOUSE9.221e-14047.40CAAX prenyl protease 1 homolog OS=Mus musculus OX=... [more]
sp|Q3Y6B8|FACE_TAESO4.959e-13949.03CAAX prenyl protease 1 homolog OS=Taenia solium OX... [more]
sp|Q9XVE5|FACE1_CAEEL9.420e-11745.64CAAX prenyl protease 1 homolog OS=Caenorhabditis e... [more]
sp|Q8RX88|FACE1_ARATH5.773e-11143.62CAAX prenyl protease 1 homolog OS=Arabidopsis thal... [more]
back to top
BLAST of CAAX prenyl protease vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183MXJ01.153e-14950.76CAAX prenyl protease OS=Schistosoma margrebowiei O... [more]
A0A4Z2CYI61.231e-14950.88CAAX prenyl protease OS=Schistosoma japonicum OX=6... [more]
A0A094ZX195.115e-14950.76CAAX prenyl protease OS=Schistosoma haematobium OX... [more]
A0A183KDJ75.115e-14950.76CAAX prenyl protease OS=Schistosoma curassoni OX=6... [more]
G4VC952.275e-14750.54CAAX prenyl protease OS=Schistosoma mansoni OX=618... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zmpste241.597e-14146.44zinc metallopeptidase STE24 [Source:NCBI gene;Acc:... [more]
zmpste241.415e-11341.68zinc metallopeptidase STE24 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009419.12.442e-1754.32pep scaffold:Pmarinus_7.0:GL497832:1044:2209:-1 ge... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
STE244.898e-7035.11Highly conserved zinc metalloprotease; functions i... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO316109.188e-14548.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471432.198e-1757.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CAAX prenyl protease vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zmpste241.392e-14346.84zinc metallopeptidase STE24 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of CAAX prenyl protease vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023418.14.886e-13145.70SMESG000023418.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005484 ID=SMED30005484|Name=CAAX prenyl protease|organism=Schmidtea mediterranea sexual|type=transcript|length=1509bp
GCCACATTTAAAGCGGTATTTTAAATCAATATTATTTTAATAATTTTGTT
CTAAAATTAATATACTACAAAAATGTTTGAAATAATGGATTTCACGATGA
AGTTAATGGATGTGAACAAAGAAGTTGTATTATTTTTATGTATATTTCTG
TTTATGTGGTTGACCTATTTGTGGGATGCTTACTTAGATTGTCGACAACA
AAGAGTTCTTAATAAATTAGTCGAACCTACAACTGATACTTCGTTAATAA
TGAATGAAGAAAATTATAAAAAAGCCAGGTTATATAGTATAGACACTAAA
AGATTTGGTTCATATCATAAGTTATATCAAATGATAGAATCTTCTGCTGT
GTTATATTATAATGTTTTACCATGGATGTGGAAGTTCACACTTTCTTTAG
TTGTCAGTAAAGTTGAAAATGTGACAGTTATACAAGAATTAAATGCATCT
ATGTTGTTTTTATTGATTGCTGGTCTGTATTCGTTTGTATTTGGCATGCC
TTGGAAAGTGTATAGTATATTTGTTATTGAAGCAAGACATGGTTTCAATA
AACAAACACCGTTCTTCTTTATTAAAGACCAGATCAAGTCTTTGTTGGTG
TCAATTATTTTAATGTTACCTATATCATATTGTTTATTATTCATTATTAA
GTTAGGTGGTCCGTATTTTTATGTGTATGCATGGTGTTTTGCTTTCGTAA
TAATGATGTTTTTAATGTTTATTTATCCTGAATTTATAGCTCCATTGTTC
GATAAATATACTCCATTAGCTGATGGGGAACTGAAAAAAGGTATCGAAAA
TCTTGCTGAAAAAATTGAATTCCCACTGAAAAAGTTATATGTTGTCGAGG
GTTCTAAAAGGTCTAGTCATAGTAATGCATATTTTTATGGATTTTGGAAA
AATAAAAGAATTGTTTTGTTCGATACATTGTTGCAAAATTATGTGGCAGA
TTCAGATTTAAATGAAACAGAAAATGATCAAAAGCCTGACGTGAAAAAAG
GATGCAATGATGAAGAAGTTATTGCTGTATTGGGACATGAATTGGGTCAT
TGGAAATTAAACCACGTGTTGCAAAGTTTAATAATTAGTCAAATTAATTT
GTTTCTTATGCTTTTTATGTTTGGTATTTTGTTTAATTTAAATGTCTTGT
TTAGAGCTTTTGGTTTCGTGGAAATAGAGACACCAACTCTAATTAGATTG
TTATTGATAATTTGTTATTTATTTAGTCCTTACCATTTCGTTTTGGAATT
TTTTATGACTTTGCTGTCAAGGAAAAAGGAATTTGAAGCAGATGAGTTTG
CAGTAAAACTGGGTTACGGAGAAAAATTGATCAATGCATTGGTTAAACTG
CATAATGATAACCTATCTTTCCCAATTTTTGACAATTTGTATTCAATTTT
TAACCATTCTCATCCTCCTATTTTAGAAAGAATTGAAGCTATTAAAAATA
ATAAAGAATATAAAAAATCAATTTGAAAAAAATAAATTCGGTTTTGAGTT
GTTGATATT
back to top

protein sequence of SMED30005484-orf-1

>SMED30005484-orf-1 ID=SMED30005484-orf-1|Name=SMED30005484-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MFEIMDFTMKLMDVNKEVVLFLCIFLFMWLTYLWDAYLDCRQQRVLNKLV
EPTTDTSLIMNEENYKKARLYSIDTKRFGSYHKLYQMIESSAVLYYNVLP
WMWKFTLSLVVSKVENVTVIQELNASMLFLLIAGLYSFVFGMPWKVYSIF
VIEARHGFNKQTPFFFIKDQIKSLLVSIILMLPISYCLLFIIKLGGPYFY
VYAWCFAFVIMMFLMFIYPEFIAPLFDKYTPLADGELKKGIENLAEKIEF
PLKKLYVVEGSKRSSHSNAYFYGFWKNKRIVLFDTLLQNYVADSDLNETE
NDQKPDVKKGCNDEEVIAVLGHELGHWKLNHVLQSLIISQINLFLMLFMF
GILFNLNVLFRAFGFVEIETPTLIRLLLIICYLFSPYHFVLEFFMTLLSR
KKEFEADEFAVKLGYGEKLINALVKLHNDNLSFPIFDNLYSIFNHSHPPI
LERIEAIKNNKEYKKSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0004222metalloendopeptidase activity
GO:0008233peptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027057CAXX_Prtase_1
IPR032456Peptidase_M48_N
IPR001915Peptidase_M48
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0071586CAAX-box protein processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032456CAAX prenyl protease 1, N-terminalPFAMPF16491Peptidase_M48_Ncoord: 42..228
e-value: 1.4E-54
score: 184.7
IPR001915Peptidase M48PFAMPF01435Peptidase_M48coord: 232..459
e-value: 2.1E-51
score: 174.5
NoneNo IPR availableGENE3DG3DSA:3.30.2010.10coord: 227..330
e-value: 3.0E-39
score: 135.0
NoneNo IPR availablePANTHERPTHR10120:SF24CAAX PRENYL PROTEASE 1 HOMOLOGcoord: 20..460
NoneNo IPR availableTMHMMTMhelixcoord: 373..395
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 341..363
NoneNo IPR availableTMHMMTMhelixcoord: 173..192
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 19..38
IPR027057CAAX prenyl protease 1PANTHERPTHR10120CAAX PRENYL PROTEASE 1coord: 20..460
IPR027057CAAX prenyl protease 1CDDcd07343M48A_Zmpste24p_likecoord: 24..459
e-value: 3.11376E-172
score: 487.759