Selenoprotein W

Overview
NameSelenoprotein W
Smed IDSMED30005470
Length (bp)419
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Selenoprotein W (SMED30005470) t-SNE clustered cells

Violin plots show distribution of expression levels for Selenoprotein W (SMED30005470) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Selenoprotein W (SMED30005470) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Selenoprotein W (SMED30005470) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005470

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30005470 dd_Smed_v4_616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005470 dd_Smed_v4_616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30005470 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30005470 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005470 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30005470 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005470 dd_Smed_v6_616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30005470SMESG000014849.1 Contig1357GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30005470 dd_Smed_v4_616_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 73.1738 bits (178), Expect = 1.863e-17
Identity = 39/70 (55.71%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKLIHSKK GD +VD + K  K++ AI  AL Q
Sbjct:   20 LQLKKKLEDEFPGRLDICG---EGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 73.1738 bits (178), Expect = 1.863e-17
Identity = 39/70 (55.71%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKLIHSKK GD +VD + K  K++ AI  AL Q
Sbjct:   20 LQLKKKLEDEFPGRLDICG---EGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 73.1738 bits (178), Expect = 1.863e-17
Identity = 39/70 (55.71%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKLIHSKK GD +VD + K  K++ AI  AL Q
Sbjct:   20 LQLKKKLEDEFPGRLDICG---EGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 73.1738 bits (178), Expect = 2.019e-17
Identity = 39/70 (55.71%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKLIHSKK GD +VD + K  K++ AI  AL Q
Sbjct:   21 LQLKKKLEDEFPGRLDICG---EGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 87          
BLAST of Selenoprotein W vs. Ensembl Human
Match: SELENOW (selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752])

HSP 1 Score: 73.1738 bits (178), Expect = 2.090e-17
Identity = 39/70 (55.71%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKLIHSKK GD +VD + K  K++ AI  AL Q
Sbjct:   19 LQLKKKLEDEFPGRLDICG---EGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 85          
BLAST of Selenoprotein W vs. Ensembl Zebrafish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 86.2705 bits (212), Expect = 8.767e-23
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            + LK  LE EFPN+L I G     TP+ TGW EVEVNGKL+HSKKNGD FVD+D K+QKI+ AI +A+ +
Sbjct:   20 IKLKTLLEDEFPNELEITG---EGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQAMGK 86          
BLAST of Selenoprotein W vs. Ensembl Mouse
Match: Selenow (selenoprotein W [Source:MGI Symbol;Acc:MGI:1100878])

HSP 1 Score: 71.633 bits (174), Expect = 6.585e-17
Identity = 37/70 (52.86%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LK+ LE EFP  L I G     TP  TG+FEV V GKL+HSKK GD +VD + K +K++ AI  AL Q
Sbjct:   20 LQLKEKLEHEFPGCLDICG---EGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQ 86          
BLAST of Selenoprotein W vs. Ensembl Mouse
Match: Selenov (selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324])

HSP 1 Score: 53.5286 bits (127), Expect = 7.402e-9
Identity = 34/68 (50.00%), Postives = 44/68 (64.71%), Query Frame = 1
Query:  145 LKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            LK+ LE +FPN L      +T     TG FEV V+GKLIHSKK GD FVD +  L+K++ AI E +K+
Sbjct:  264 LKRTLEHQFPNLLEFEEERATQV---TGEFEVFVDGKLIHSKKKGDGFVD-ESGLKKLVGAIDEEIKK 327          
BLAST of Selenoprotein W vs. Ensembl Mouse
Match: Selenov (selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324])

HSP 1 Score: 45.0542 bits (105), Expect = 3.490e-7
Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 1
Query:  223 TGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            TG FEV V+GKLIHSKK GD FVD +  L+K++ AI E +K+
Sbjct:    5 TGEFEVFVDGKLIHSKKKGDGFVD-ESGLKKLVGAIDEEIKK 45          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|Q568W0|SELW_DANRE (Selenoprotein W OS=Danio rerio OX=7955 GN=selenow PE=3 SV=3)

HSP 1 Score: 86.6557 bits (213), Expect = 4.987e-22
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            + LK  LE EFPN+L I G     TP+ TGW EVEVNGKL+HSKKNGD FVD+D K+QKI+ AI +A+ +
Sbjct:   20 IKLKTLLEDEFPNELEITG---EGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIMTAIEQAMGK 86          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|Q5NVB2|SELW_PONAB (Selenoprotein W OS=Pongo abelii OX=9601 GN=SELENOW PE=3 SV=4)

HSP 1 Score: 73.1738 bits (178), Expect = 8.948e-17
Identity = 39/70 (55.71%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKLIHSKK GD +VD + K  K++ AI  AL Q
Sbjct:   20 LQLKKKLEDEFPGRLDICG---EGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|P63303|SELW_MACMU (Selenoprotein W OS=Macaca mulatta OX=9544 GN=SELENOW PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 8.948e-17
Identity = 39/70 (55.71%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKLIHSKK GD +VD + K  K++ AI  AL Q
Sbjct:   20 LQLKKKLEDEFPGRLDICG---EGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|P63302|SELW_HUMAN (Selenoprotein W OS=Homo sapiens OX=9606 GN=SELENOW PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 8.948e-17
Identity = 39/70 (55.71%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKLIHSKK GD +VD + K  K++ AI  AL Q
Sbjct:   20 LQLKKKLEDEFPGRLDICG---EGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of Selenoprotein W vs. UniProt/SwissProt
Match: sp|Q95KL4|SELW_PIG (Selenoprotein W OS=Sus scrofa OX=9823 GN=SELENOW PE=3 SV=4)

HSP 1 Score: 72.0182 bits (175), Expect = 3.107e-16
Identity = 38/70 (54.29%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKK LE EFP +L I G     TP  TG+FEV V GKL+HSKK GD +VD + K  K++ AI  AL Q
Sbjct:   20 LQLKKKLEDEFPGRLDICG---EGTPQVTGFFEVLVAGKLVHSKKGGDGYVDTESKFLKLVAAIKAALAQ 86          
BLAST of Selenoprotein W vs. TrEMBL
Match: F6NSR1 (Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selenow1 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 1.962e-19
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            + LK  LE EFPN+L I G     TP+ TGW EVEVNGKL+HSKKNGD FVD+D K+QKI+ AI +A+ +
Sbjct:   20 IKLKTLLEDEFPNELEITG---EGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQAMGK 86          
BLAST of Selenoprotein W vs. TrEMBL
Match: Q802G9 (Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selenow1 PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 2.491e-19
Identity = 42/70 (60.00%), Postives = 52/70 (74.29%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            + LK  LE EFPN+L I G     TP+ TGW EVEVNGKL+HSKKNGD FVD+D K+QKI+ AI +A+ +
Sbjct:   20 IKLKTLLEDEFPNELEITG---EGTPSTTGWLEVEVNGKLVHSKKNGDGFVDSDSKMQKIVTAIEQAMGK 86          
BLAST of Selenoprotein W vs. TrEMBL
Match: A0A5N5JZ13 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00161260 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.034e-18
Identity = 44/73 (60.27%), Postives = 51/73 (69.86%), Query Frame = 1
Query:  124 FVMAILNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEAL 342
            F+     LK  LE EFP  L I   TS  TPT TGWFEV+VNG L+HSKKNGD FVDND+KL +I+ AI +AL
Sbjct:    2 FISQFTKLKTLLEDEFPGDLEI---TSEGTPTTTGWFEVQVNGVLVHSKKNGDGFVDNDQKLARIVRAIEKAL 71          
BLAST of Selenoprotein W vs. TrEMBL
Match: V8NVW9 (Uncharacterized protein (Fragment) OS=Ophiophagus hannah OX=8665 GN=L345_08127 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 4.073e-18
Identity = 46/83 (55.42%), Postives = 52/83 (62.65%), Query Frame = 1
Query:   94 IYFNVFDKRCFVMAILNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEAL 342
            +    F +R F      LKK+LE EFP KL I G     TP  TGWFEV V GK++HSKKNGD FVDND KL KI+ AI  AL
Sbjct:   10 LSLQGFQQRQF----QKLKKELEKEFPGKLEISG---EETPQVTGWFEVMVAGKMVHSKKNGDGFVDNDAKLSKIIKAIRTAL 85          
BLAST of Selenoprotein W vs. TrEMBL
Match: H9G9L8 (Selenoprotein W OS=Anolis carolinensis OX=28377 GN=SELENOW PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.661e-18
Identity = 44/70 (62.86%), Postives = 49/70 (70.00%), Query Frame = 1
Query:  139 LNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            L LKKDLE EFP+KL I G     TP  TGWFEV V  KL+HSKKNGD +VDND KL KI  AI  AL++
Sbjct:    7 LKLKKDLEKEFPDKLEITG---EGTPEATGWFEVTVAEKLVHSKKNGDGYVDNDTKLGKITTAIKAALEE 73          
BLAST of Selenoprotein W vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 80.1073 bits (196), Expect = 1.542e-20
Identity = 40/71 (56.34%), Postives = 50/71 (70.42%), Query Frame = 1
Query:  130 MAILNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEAL 342
            M    LK  LE EFP  L I G    +TP  +GWFEVEVNGKL+HSKKNGD FVD+D+K+ KI+ AI +++
Sbjct:    1 MGYTKLKTLLEDEFPGDLEISG---ESTPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAIEKSI 68          
BLAST of Selenoprotein W vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 78.9518 bits (193), Expect = 3.997e-20
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 1
Query:  124 FVMAILNLKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEAL 342
            F +    LK  LE EFP  L I G    +TP  +GWFEVEVNGKL+HSKKNGD FVD+D+K+ KI+ AI +++
Sbjct:    3 FPLQYTKLKTLLEDEFPGDLEISG---ESTPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAIEKSI 72          
BLAST of Selenoprotein W vs. Ensembl Cavefish
Match: selenow1 (selenoprotein W, 1 [Source:NCBI gene;Acc:352915])

HSP 1 Score: 78.5666 bits (192), Expect = 6.837e-20
Identity = 39/68 (57.35%), Postives = 50/68 (73.53%), Query Frame = 1
Query:  145 LKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEALKQ 348
            LK  LE EFP  L I G    +TP  +GWFEVEVNGKL+HSKKNGD FVD+D+K+ KI+ AI +++ +
Sbjct:   11 LKTLLEDEFPGDLEISG---ESTPRTSGWFEVEVNGKLVHSKKNGDGFVDSDQKMAKIVSAIEKSIGK 75          
BLAST of Selenoprotein W vs. Ensembl Nematostella
Match: EDO35675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKT9])

HSP 1 Score: 69.3218 bits (168), Expect = 7.369e-17
Identity = 36/66 (54.55%), Postives = 47/66 (71.21%), Query Frame = 1
Query:  145 LKKDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDNDKKLQKILDAIAEAL 342
            LK  ++ EF +    V  TS ATP  TG+FEV VN +L+HSKKNGD +VD++KKL KI D+I +AL
Sbjct:    2 LKSTIQAEFSSNE--VEVTSYATPNVTGYFEVSVNDQLVHSKKNGDGYVDSEKKLAKIFDSITKAL 65          
The following BLAST results are available for this feature:
BLAST of Selenoprotein W vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SELENOW1.863e-1755.71selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW1.863e-1755.71selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW1.863e-1755.71selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW2.019e-1755.71selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
SELENOW2.090e-1755.71selenoprotein W [Source:HGNC Symbol;Acc:HGNC:10752... [more]
back to top
BLAST of Selenoprotein W vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
selenow18.767e-2360.00selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
back to top
BLAST of Selenoprotein W vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Selenow6.585e-1752.86selenoprotein W [Source:MGI Symbol;Acc:MGI:1100878... [more]
Selenov7.402e-950.00selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324... [more]
Selenov3.490e-759.52selenoprotein V [Source:MGI Symbol;Acc:MGI:3608324... [more]
back to top
BLAST of Selenoprotein W vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q568W0|SELW_DANRE4.987e-2260.00Selenoprotein W OS=Danio rerio OX=7955 GN=selenow ... [more]
sp|Q5NVB2|SELW_PONAB8.948e-1755.71Selenoprotein W OS=Pongo abelii OX=9601 GN=SELENOW... [more]
sp|P63303|SELW_MACMU8.948e-1755.71Selenoprotein W OS=Macaca mulatta OX=9544 GN=SELEN... [more]
sp|P63302|SELW_HUMAN8.948e-1755.71Selenoprotein W OS=Homo sapiens OX=9606 GN=SELENOW... [more]
sp|Q95KL4|SELW_PIG3.107e-1654.29Selenoprotein W OS=Sus scrofa OX=9823 GN=SELENOW P... [more]
back to top
BLAST of Selenoprotein W vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F6NSR11.962e-1960.00Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selen... [more]
Q802G92.491e-1960.00Selenoprotein W, 1 OS=Danio rerio OX=7955 GN=selen... [more]
A0A5N5JZ131.034e-1860.27Uncharacterized protein OS=Pangasianodon hypophtha... [more]
V8NVW94.073e-1855.42Uncharacterized protein (Fragment) OS=Ophiophagus ... [more]
H9G9L84.661e-1862.86Selenoprotein W OS=Anolis carolinensis OX=28377 GN... [more]
back to top
BLAST of Selenoprotein W vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
selenow11.542e-2056.34selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
selenow13.997e-2054.79selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
selenow16.837e-2057.35selenoprotein W, 1 [Source:NCBI gene;Acc:352915][more]
back to top
BLAST of Selenoprotein W vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO356757.369e-1754.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Selenoprotein W vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Selenoprotein W vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005470 ID=SMED30005470|Name=Selenoprotein W|organism=Schmidtea mediterranea sexual|type=transcript|length=419bp
ATGCACTATTTCGATTTTCGTTATCCTCGCCACATATTCTTAACTTTATT
ACATTATTATATTCCAAAACAGACATTAAAAAAATTTACTAACATTTATT
TTAATGTTTTCGATAAACGTTGTTTTGTTATGGCAATTCTAAACTTGAAG
AAAGATCTGGAACTTGAATTTCCAAACAAACTAACCATTGTAGGTTTTAC
TTCGACTGCAACTCCGACCAAAACTGGGTGGTTTGAAGTTGAAGTGAATG
GTAAATTGATCCATTCAAAAAAGAATGGAGATGAATTCGTTGATAACGAT
AAAAAATTACAAAAGATCTTGGATGCGATAGCTGAAGCATTGAAACAATG
AACAGTTTTAGCTTTCATTTTAGGTTTTAATTTCTATTGCCAACTCTGTG
AAAATTGTTGTTAAAAATC
back to top

protein sequence of SMED30005470-orf-1

>SMED30005470-orf-1 ID=SMED30005470-orf-1|Name=SMED30005470-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MHYFDFRYPRHIFLTLLHYYIPKQTLKKFTNIYFNVFDKRCFVMAILNLK
KDLELEFPNKLTIVGFTSTATPTKTGWFEVEVNGKLIHSKKNGDEFVDND
KKLQKILDAIAEALKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0016209antioxidant activity
Vocabulary: biological process
TermDefinition
GO:0098869cellular oxidant detoxification
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR012336Thioredoxin-like_fold
IPR011893Selenoprotein_Rdx-typ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011893Selenoprotein, Rdx-typePFAMPF10262Rdxcoord: 47..106
e-value: 5.7E-7
score: 29.6
IPR011893Selenoprotein, Rdx-typeTIGRFAMTIGR02174TIGR02174coord: 46..106
e-value: 1.5E-13
score: 48.9
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 32..116
e-value: 1.5E-22
score: 81.4
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 46..111
NoneNo IPR availablePANTHERPTHR15124:SF18SELENOPROTEIN Wcoord: 46..115
NoneNo IPR availablePANTHERPTHR15124SELENOPROTEIN Wcoord: 46..115