slc17a-1

Overview
Nameslc17a-1 (AHB51762.1)
Smed IDSMED30005469
Length (bp)2310
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc17a-1 (SMED30005469) t-SNE clustered cells

Violin plots show distribution of expression levels for slc17a-1 (SMED30005469) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc17a-1 (SMED30005469) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc17a-1 (SMED30005469) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005469

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005469SMESG000080078.1 SMESG000052932.1 Contig937newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005469SMESG000080078.1 SMESG000052932.1 Contig937uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005469SMESG000021124.1 Contig937newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005469SMESG000021124.1 Contig937uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30005469SMESG000080078.1 SMESG000052932.1 SmedASXL_013527SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30005469SMESG000080078.1 SMESG000052932.1 dd_Smed_v4_10192_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005469SMESG000080078.1 SMESG000052932.1 dd_Smed_v4_10192_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30005469SMESG000080078.1 SMESG000052932.1 dd_Smed_v6_10192_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005469SMESG000080078.1 SMESG000052932.1 OX_Smed_1.0.08304ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc17a-1 vs. Ensembl Human
Match: SLC17A6 (solute carrier family 17 member 6 [Source:HGNC Symbol;Acc:HGNC:16703])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 286/504 (56.75%), Postives = 352/504 (69.84%), Query Frame = 2
Query:  353 DELDEVEQLSSNKKP-QKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVT 1849
             +  E  +L+ + KP +      P+  C     + + +RY++A MS  GF +SFGIRCN+  A+VDM N+  I    H    +I    K  F W      ++ GSFF+GY+ TQIPGG IA++  A RVFG A+  TS LN+L+P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L    GW + FY YG  G+ W + W    YE PA HP ITD+ER YIE ++ E +   G+      PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PHLVM IIVPIGGQ+AD+LR K  L+TT VRKI NCGGFG EA  LLVVGY+H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+K+RE W YVFL+A+L+H  GV FYAIFASGEKQPWAD PE+ +   C    ED   E T
Sbjct:   35 QDTGETIELTEDGKPLEVPERKAPLCDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HRGGKVIKE--KAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWAD-PEETSEEKCGFIHEDELDEET 528          
BLAST of slc17a-1 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 292/554 (52.71%), Postives = 366/554 (66.06%), Query Frame = 2
Query:  212 MVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKD-LQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG--SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDY 1861
            M    F+T KEK          K G + +K  +      LQ   +   +E D +E     +  Q      P+  C       + KRY++A MS  GF +SFGIRCN+  A+V+M N  N T     KP I        F W      L+ GSFF+GY+ TQIPGG I+NKF A RVFG A+  TS LN+ +P A + HY  VM VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W + W    YE PA HP I+++E+ YIE ++ EG+   S +    PW+R FTS+PVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PH+VM I+VPIGGQLADYLR +  LTTT VRKI NCGGFG EA  LLVVG++H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   T+ KTRE W  VFL+A+L+H  GV FY +FASGEKQ WAD PE+++   C    +D   E  E ++
Sbjct:    1 MPFKAFDTFKEKI--------LKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRPSPPLCDCHCC---GLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVN--NSTVYVDGKPEI----QTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWAD-PENLSEEKCGIIDQDELAEEIELNH 536          
BLAST of slc17a-1 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 280/495 (56.57%), Postives = 347/495 (70.10%), Query Frame = 2
Query:  347 QYDELDEVEQLSSNKKP-QKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCA 1816
            +  E  E  +LS++ +P        P+  C     + + +RY++A MS  GF +SFGIRCN+  A+V M N+     T+    +++    K  F W      L+ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++ER YIE  + E +           PWRR FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQ+AD+LR +  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY +FASGEKQPWA+ PE+++   C 
Sbjct:   25 KRQEGAETLELSADGRPVTTQTRDPPVVDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNST---THRGGHVVVQ---KAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAE-PEEMSEEKCG 509          
BLAST of slc17a-1 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 270/449 (60.13%), Postives = 326/449 (72.61%), Query Frame = 2
Query:  482 MSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCA 1816
            MS  GF +SFGIRCN+  A+V M N+     T+    +++    K  F W      L+ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++ER YIE  + E +           PWRR FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQ+AD+LR +  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY +FASGEKQPWA+ PE+++   C 
Sbjct:    1 MSGLGFCISFGIRCNLGVAIVSMVNNST---THRGGHVVVQ---KAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAE-PEEMSEEKCG 442          
BLAST of slc17a-1 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 481.485 bits (1238), Expect = 4.998e-162
Identity = 268/552 (48.55%), Postives = 333/552 (60.33%), Query Frame = 2
Query:  212 MVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKD-LQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDY 1861
            M    F+T KEK          K G + +K  +      LQ   +   +E D +E     +  Q      P+  C       + KRY++A MS  GF +SFGIRCN+  A+V+M N  N T     KP I        F W      L+ GSFF+GY+ TQIPGG I+NKF A RVFG A+  TS LN+ +P A + HY  VM VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W + W    YE PA HP I+++E+ YIE ++ EG    AN+         S+                                     VG LSA+PH+VM I+VPIGGQLADYLR +  LTTT VRKI NCGGFG EA  LLVVG++H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   T+ KTRE W  VFL+A+L+H  GV FY +FASGEKQ WAD PE+++   C    +D   E  E ++
Sbjct:    1 MPFKAFDTFKEKI--------LKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRPSPPLCDCHCC---GLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVN--NSTVYVDGKPEI----QTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEG----ANV--------VSL------------------------------------SVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWAD-PENLSEEKCGIIDQDELAEEIELNH 486          
BLAST of slc17a-1 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 480.715 bits (1236), Expect = 6.891e-162
Identity = 249/480 (51.88%), Postives = 324/480 (67.50%), Query Frame = 2
Query:  341 NMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYA-LVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANI-PIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKN-YLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQ 1771
             MQ +  +   Q+ SNK  Q  +    +G+C         KR+LLA +++ GFM+SFGIRCN   A   M  +    +T+    + +H      F W++ + S+++ S+F+GYL TQIP G +A KFP  ++FGF +   + LN+LLP   K     LV  ++I QGLV+GV YPA HG+WRYWAPP+ERS+LAT AF GSYAGAVLGL LS  L   + W APFY YG+ G+ W I WF   +EKPA HP I+ +E+I+IE  +   S +   I  IPW+ I TS PV+AIIVANFARSW+FYLL+     Y+ + L   +   G L+A+PHLVM  +V +GGQLADYLR N  L+TT VRKIFNCGGFGGEA F+L+V YT S   A+ +L+ AVG SGFAISG+NVNHLDIAPRYA+ILMG SNG+GTL+G+ CP V E FT + ++  W+ VFL+ASLIH  GVTFYA++ASGE Q
Sbjct:   16 QMQEEGNENPMQMHSNKVLQV-MEQTWIGKC--------RKRWLLAILANMGFMISFGIRCNFGAAKTHMYKN----YTDPYGKVHMHE-----FNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAIGHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFT-AHSKHGWTSVFLLASLIHFTGVTFYAVYASGELQ 476          
BLAST of slc17a-1 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 479.945 bits (1234), Expect = 2.226e-161
Identity = 249/480 (51.88%), Postives = 324/480 (67.50%), Query Frame = 2
Query:  341 NMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYA-LVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANI-PIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKN-YLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQ 1771
             MQ +  +   Q+ SNK  Q  +    +G+C         KR+LLA +++ GFM+SFGIRCN   A   M  +    +T+    + +H      F W++ + S+++ S+F+GYL TQIP G +A KFP  ++FGF +   + LN+LLP   K     LV  ++I QGLV+GV YPA HG+WRYWAPP+ERS+LAT AF GSYAGAVLGL LS  L   + W APFY YG+ G+ W I WF   +EKPA HP I+ +E+I+IE  +   S +   I  IPW+ I TS PV+AIIVANFARSW+FYLL+     Y+ + L   +   G L+A+PHLVM  +V +GGQLADYLR N  L+TT VRKIFNCGGFGGEA F+L+V YT S   A+ +L+ AVG SGFAISG+NVNHLDIAPRYA+ILMG SNG+GTL+G+ CP V E FT + ++  W+ VFL+ASLIH  GVTFYA++ASGE Q
Sbjct:   37 QMQEEGNENPMQMHSNKVLQV-MEQTWIGKC--------RKRWLLAILANMGFMISFGIRCNFGAAKTHMYKN----YTDPYGKVHMHE-----FNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAIGHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFT-AHSKHGWTSVFLLASLIHFTGVTFYAVYASGELQ 497          
BLAST of slc17a-1 vs. Ensembl Celegans
Match: vglu-3 (Potential vesicular glutamate transporter vglu-3 [Source:UniProtKB/Swiss-Prot;Acc:Q10046])

HSP 1 Score: 319.316 bits (817), Expect = 7.805e-100
Identity = 177/448 (39.51%), Postives = 259/448 (57.81%), Query Frame = 2
Query:  464 RYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAH---YALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANI-PIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKN-YLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPE 1792
            R+ +A ++ FGF +SFGIR N   A   M N+    FT+      +H   +  F+W+  +  +++ SFF+GY  +QIP G++A KF   ++F   +   S +N+L   +   H      VM+V+ +QGL  GV YPA HG+W++WAPPLERS+LAT AF GS  G + GL  S  L  +  W  PFY +G++GI W + W       P  H YI+DDE+  +   + + +  + ++  +PWR + TS  V+AII+  F RSW F+LL+     Y+ D+L  ++   G +S  P   M I+    GQL DYLR +  ++T  VRK  N  GF  EA+ L  + +     +AV+ LV+A   SG  +SG+NVNH DIAPRYA ILMGI+NG+G ++G+    +V N    +  + W +VFL+A  I I GV F+ IFA G+  PWA  PE
Sbjct:   47 RWQIAILAHFGFAISFGIRSNFGVAKNRMVNN----FTDAYGE--VH---EREFLWTGAEVGMMESSFFYGYAASQIPAGVLAAKFAPNKIFMLGILVASFMNILSAISFNFHPYTDIFVMVVQAVQGLALGVLYPAMHGVWKFWAPPLERSKLATTAFTGSSVGVMTGLPASAYLVSHFSWSTPFYVFGVVGIIWSLIWMYVSSHSPETHGYISDDEKKQVTEKIGDVAVKNMSLTTLPWRDMMTSSAVWAIIICTFCRSWGFFLLLGNQLTYMKDVLHIDIKNSGFISIFPQFGMCIVTLATGQLCDYLRSSGKMSTEAVRKSVNTFGFTVEAMMLGCLAFVRDPVIAVTCLVIACTGSGSVLSGFNVNHFDIAPRYAPILMGIANGLGAVAGVG--GMVTNTVTYQNPDGWKWVFLLAMAIDIFGVIFFLIFAKGDVLPWAREPE 483          
BLAST of slc17a-1 vs. Ensembl Celegans
Match: vglu-2 (Vesicular GLUtamate transporter [Source:UniProtKB/TrEMBL;Acc:G5EEK1])

HSP 1 Score: 311.997 bits (798), Expect = 1.062e-96
Identity = 180/450 (40.00%), Postives = 262/450 (58.22%), Query Frame = 2
Query:  464 RYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAH---YALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANI---PIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKN-YLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPE 1792
            R+ +A ++ FGF +SFGIR N   A   M N+    FT+      +H   +  F W+  +  +++ SFF+GY  +QIP G+IA KF   ++F   +   S LN++    L  H      VM+++++QGL  GV YPA HG+W+YWAPPLERS+LAT  F G+  G ++GL  S  L  +  W  PFY +G +GI W I W       P  H YI+ DE+ YI  T   GS +  N+    +PWR + TS  V+AII+ +F RSWSF+LL+     Y+ D+L  ++   G ++  P L M I+    GQL+DYLR +  ++T  VRK  N  GF  EA+ L  + +     +AV+ L++A   +G  +SG+NVNH DIAPR+A ILMGI+NG+G ++G+    +V N    +  + W +VFL+A  I I G+ F+ IFA G+  PWA  PE
Sbjct:   47 RWQIALLAHFGFAISFGIRSNFGVAKNRMINN----FTDAYGE--VH---EKEFFWTGTEVGMMESSFFYGYAASQIPAGVIAAKFAPNKLFMLGILFASLLNIVTAICLNFHPFTDIFVMVIQVMQGLALGVCYPAMHGVWKYWAPPLERSKLATTTFTGASVGVMVGLPASAYLVSHFSWSTPFYVFGALGIVWSILWIYVSGTSPETHGYISADEKKYI--TEKVGSVAVKNMTLTTLPWRDMMTSTAVWAIIICSFCRSWSFFLLLGNQLTYMKDVLHIDIKNSGLIAIFPQLGMCIVTLTSGQLSDYLRSSGKMSTEAVRKSVNTFGFTVEAVMLGCLAFVRDPVIAVTFLIIACSGAGAVLSGFNVNHFDIAPRHAPILMGIANGLGAIAGV--GGIVTNSLTYQNPDGWQWVFLLAMSIDIFGIIFFLIFAKGDVLPWAREPE 483          
BLAST of slc17a-1 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 272.322 bits (695), Expect = 7.961e-83
Identity = 145/441 (32.88%), Postives = 246/441 (55.78%), Query Frame = 2
Query:  461 KRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKN-YLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWA 1780
            +R+++A ++  GF   + +R N+S A+V+M++         +  ++          W+   + +V  SFF+GY+ +Q+PGG +A    A  +F      T+   LL P   +  Y +++  R ++GL+EGV+YPA H IW  WAPP+E+++LAT AF GSY G V+ + LS  L ++ GW   F+F+G +G+ W + W+  ++++P   P I+  E       L   + S  +  +PW +I  S PV+A+IVA+ A++  FY+++   PK L D+   N+ + G  S+LP+ +M   +  GGQL DYLR++ +  T  VRK+    GF G+++FL +V  T +  + V    +++G  G    G++VNHLD+AP+YA  LM  SN   T+ G+  P +V    ++ T   W+ +  +    +++G   +  FA    QPWA
Sbjct:   32 RRHVVAILALLGFANIYAMRANLSIAIVEMTSGTERKVNGTTLHVLGDFEN-----WTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSEL----ALLQRDAVSQNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWA 463          
BLAST of slc17a-1 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0307078)

HSP 1 Score: 470.7 bits (1210), Expect = 6.185e-157
Identity = 240/474 (50.63%), Postives = 315/474 (66.46%), Query Frame = 2
Query:  455 MSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALK-AHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIP----IPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKN-YLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYD 1858
            M  RY +A M+  GFM++FG+RCN+S A +   ++  + F N                W++  +S VD SFF+GYL TQIPGG IA+KFPA ++FG ++ S++ L+L +P A+   H  +V+ VR+LQGL EGV+YPACHGIWR+WAPP+ERSRLAT+AF GSYAG V+GL LSGLL D +G+QAPFY YG+ GI W + W    +E P  HP I+  E  YIE +L E +     +P     PWR +  SMPVYAIIVANF RSW+FYLL++    +L       + + G + +LPHL+M  IVP GG LAD+LRKN  L+TT VRK+FNCGGFG E LF L V ++ +   A+ +L   V FSGFAISGYNVNHLDIAPRYASILMG+SNG+GTL+G+I P  ++   ++     W+ VF +A+ +H+VG TFY IFASGE QPWA+ P +    W  P     P  +T  D
Sbjct:   92 MPARYTIATMACVGFMIAFGMRCNMSAAKLKGEHNGTV-FMN----------------WTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESA--HPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQKVWAPP-----PGAITNTD 541          
BLAST of slc17a-1 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0331202)

HSP 1 Score: 470.7 bits (1210), Expect = 6.185e-157
Identity = 240/474 (50.63%), Postives = 315/474 (66.46%), Query Frame = 2
Query:  455 MSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALK-AHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIP----IPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKN-YLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYD 1858
            M  RY +A M+  GFM++FG+RCN+S A +   ++  + F N                W++  +S VD SFF+GYL TQIPGG IA+KFPA ++FG ++ S++ L+L +P A+   H  +V+ VR+LQGL EGV+YPACHGIWR+WAPP+ERSRLAT+AF GSYAG V+GL LSGLL D +G+QAPFY YG+ GI W + W    +E P  HP I+  E  YIE +L E +     +P     PWR +  SMPVYAIIVANF RSW+FYLL++    +L       + + G + +LPHL+M  IVP GG LAD+LRKN  L+TT VRK+FNCGGFG E LF L V ++ +   A+ +L   V FSGFAISGYNVNHLDIAPRYASILMG+SNG+GTL+G+I P  ++   ++     W+ VF +A+ +H+VG TFY IFASGE QPWA+ P +    W  P     P  +T  D
Sbjct:   92 MPARYTIATMACVGFMIAFGMRCNMSAAKLKGEHNGTV-FMN----------------WTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESA--HPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQKVWAPP-----PGAITNTD 541          
BLAST of slc17a-1 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0077769)

HSP 1 Score: 470.7 bits (1210), Expect = 6.185e-157
Identity = 240/474 (50.63%), Postives = 315/474 (66.46%), Query Frame = 2
Query:  455 MSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALK-AHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIP----IPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKN-YLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYD 1858
            M  RY +A M+  GFM++FG+RCN+S A +   ++  + F N                W++  +S VD SFF+GYL TQIPGG IA+KFPA ++FG ++ S++ L+L +P A+   H  +V+ VR+LQGL EGV+YPACHGIWR+WAPP+ERSRLAT+AF GSYAG V+GL LSGLL D +G+QAPFY YG+ GI W + W    +E P  HP I+  E  YIE +L E +     +P     PWR +  SMPVYAIIVANF RSW+FYLL++    +L       + + G + +LPHL+M  IVP GG LAD+LRKN  L+TT VRK+FNCGGFG E LF L V ++ +   A+ +L   V FSGFAISGYNVNHLDIAPRYASILMG+SNG+GTL+G+I P  ++   ++     W+ VF +A+ +H+VG TFY IFASGE QPWA+ P +    W  P     P  +T  D
Sbjct:   92 MPARYTIATMACVGFMIAFGMRCNMSAAKLKGEHNGTV-FMN----------------WTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESA--HPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQKVWAPP-----PGAITNTD 541          
BLAST of slc17a-1 vs. Ensembl Fly
Match: MFS9 (gene:FBgn0038799 transcript:FBtr0083889)

HSP 1 Score: 348.206 bits (892), Expect = 2.536e-111
Identity = 176/454 (38.77%), Postives = 267/454 (58.81%), Query Frame = 2
Query:  443 LPWNM--SKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPED 1795
            L W     +RY++  ++ FGF   + +R N+S A+V M+ +  +   +       + S +  F W   +K L+  SFF+GY+ TQ  GG I  K     VFG  + ST+ L LL P A      + + VRI++G  EGV++P  H +W  W+PPLERSR+A+IAF G+YAG V+ +  SG L    GW++ FY +G IG+ W ITW   +   P +  + + +E  YI+ T+  G     ++  PWR IFTSMP YAI+ ++F+ +W FY L+ + P +L D L  +L + G LSA+P+L M I++ + G LAD+L+ K   TTT VR+ FNCG F  + +F+++  Y      +V SL +AVG   FA SG+ VNHLDIAP++AS+LMGI N   T+ G++ P +      ++T + W  +F +++ I++VG   Y  + SG+ Q WA  PE 
Sbjct:   29 LTWRFWRKQRYIVVLLAFFGFFNVYSLRVNLSVAIVAMTENRTVFDADG------NVSYQQDFPWDSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAASHSLEMFLFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTI--GYVGSKHVKHPWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIYWFYCSGDLQEWAKTPEQ 474          
BLAST of slc17a-1 vs. Ensembl Fly
Match: MFS9 (gene:FBgn0038799 transcript:FBtr0083888)

HSP 1 Score: 348.206 bits (892), Expect = 2.536e-111
Identity = 176/454 (38.77%), Postives = 267/454 (58.81%), Query Frame = 2
Query:  443 LPWNM--SKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPED 1795
            L W     +RY++  ++ FGF   + +R N+S A+V M+ +  +   +       + S +  F W   +K L+  SFF+GY+ TQ  GG I  K     VFG  + ST+ L LL P A      + + VRI++G  EGV++P  H +W  W+PPLERSR+A+IAF G+YAG V+ +  SG L    GW++ FY +G IG+ W ITW   +   P +  + + +E  YI+ T+  G     ++  PWR IFTSMP YAI+ ++F+ +W FY L+ + P +L D L  +L + G LSA+P+L M I++ + G LAD+L+ K   TTT VR+ FNCG F  + +F+++  Y      +V SL +AVG   FA SG+ VNHLDIAP++AS+LMGI N   T+ G++ P +      ++T + W  +F +++ I++VG   Y  + SG+ Q WA  PE 
Sbjct:   29 LTWRFWRKQRYIVVLLAFFGFFNVYSLRVNLSVAIVAMTENRTVFDADG------NVSYQQDFPWDSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAASHSLEMFLFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTI--GYVGSKHVKHPWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIYWFYCSGDLQEWAKTPEQ 474          
BLAST of slc17a-1 vs. Ensembl Zebrafish
Match: slc17a7b (solute carrier family 17 member 7b [Source:ZFIN;Acc:ZDB-GENE-131125-32])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 298/522 (57.09%), Postives = 362/522 (69.35%), Query Frame = 2
Query:  347 QYDELDEVEQLSSNKKPQ----KHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDY-----GYGS 1873
            +  E  E  +LS+  +P+    K L   P+  C     + + +RY++A +S  GF +SFGIRCN+  A+V M N  N T     KP I+    K  F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFAV STS LN+++P A + H+  V++VRILQGLVEGVSYPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  G+CW + W    YE PA HP IT +ER YIE  + E +G          PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++ K  +++VG LSALPHLVM I+VPIGGQLADYLR  N +TTT VRK+ NCGGFG EA FLLVVG++H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTRE W YVFL+ASL+H  GV FY +FASGEKQPWA+ PE+ +   C    ED   + TE  Y     GYG+
Sbjct:   20 KRQENGETIELSAEGRPELQEEKEL---PVVDCT---CFGLPRRYIIAILSGLGFCISFGIRCNLGVAVVSMVN--NHTVYRDGKPYIV----KAQFSWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAVVSTSILNMMIPTAARMHFGCVILVRILQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGVLVQYSGWSSVFYVYGSFGVCWYLFWILVSYESPAAHPTITPEERKYIEDAIGESAGLVNPLTKFNTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFKFEISKVGILSALPHLVMTIVVPIGGQLADYLRTHNLMTTTNVRKLMNCGGFGLEATFLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVIFYGLFASGEKQPWAE-PENTSEEKCGILGEDELADETEELYRSAGGGYGA 528          
BLAST of slc17a-1 vs. Ensembl Zebrafish
Match: slc17a6a (solute carrier family 17 member 6a [Source:NCBI gene;Acc:494492])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 299/547 (54.66%), Postives = 371/547 (67.82%), Query Frame = 2
Query:  230 ETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDE-LDEVEQLSSNKKPQKHL--FVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVT 1849
            +T+KE+   +P  +K K+        + G+     +  M+  +   EV +L+ + +P  H+     P+  C     + + +RY++A MS  GF +SFGIRCN+  A+VDM N+  I   +    +II    K  F W      ++ GSFF+GY+ TQIPGG I+++  A RVFG A+  TS LN+ +P A + HY  VM VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA HP ITD+ER YIE ++ E +   G+      PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQLADYLR KN LTTT VRKI NCGGFG EA  LLVVG++HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTRE W  VFL+ASL+H  GV FY IFASGEKQPWAD PE+ +   C    ED   E T
Sbjct:    2 DTVKERV-LAPGKEKMKN--------LAGKTLGHMHRVMERKQKTGEVIELTEDGRPM-HMPEKKAPLVDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI---HKGGKIIIKE--KAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGILVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERTYIEESIGESAKLLGAMEKYKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVIFYGIFASGEKQPWAD-PEETSDEKCGFIDEDELAEET 529          
BLAST of slc17a-1 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 296/563 (52.58%), Postives = 377/563 (66.96%), Query Frame = 2
Query:  212 MVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPS-FVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTE--YDYGYGSDQ 1879
            M LG F  +KEK N      K   G DS+  +   +K +  ++  + D ++  E       P++     P+  C     + + KRY++A +S  GF +SFGIRCN+  A+V+M N+ N  + N +      + M+P+ F W      L+ GSFF+GY+ TQIPGG I+NK  A RVFG A+  TS LN+ +P A + HY  VM VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W I W    Y  PAVHP I+++ER YIE ++ EG+    S      PWR  FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PH+VM IIVPIGGQLAD+LR +  L+TT VRKI NCGGFG EA  LLVVG++H+  VA+S L+LAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTR  W +VF++AS++H  GV FYAIFASGEKQ WAD PE+ +   C    ED   + TE   D G  + Q
Sbjct:    1 MPLGGFAGLKEKLNPGKEELKNNVG-DSLGNL---QKKIDGSNVTEEDNIELTEDGRPVAAPKRS---PPLLDCG---CFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNN-NTVYINGT------AVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWAD-PENTSDEKCGIIGEDELADETEPSSDSGLATRQ 545          
BLAST of slc17a-1 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 296/563 (52.58%), Postives = 377/563 (66.96%), Query Frame = 2
Query:  212 MVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPS-FVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTE--YDYGYGSDQ 1879
            M LG F  +KEK N      K   G DS+  +   +K +  ++  + D ++  E       P++     P+  C     + + KRY++A +S  GF +SFGIRCN+  A+V+M N+ N  + N +      + M+P+ F W      L+ GSFF+GY+ TQIPGG I+NK  A RVFG A+  TS LN+ +P A + HY  VM VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W I W    Y  PAVHP I+++ER YIE ++ EG+    S      PWR  FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PH+VM IIVPIGGQLAD+LR +  L+TT VRKI NCGGFG EA  LLVVG++H+  VA+S L+LAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTR  W +VF++AS++H  GV FYAIFASGEKQ WAD PE+ +   C    ED   + TE   D G  + Q
Sbjct:    1 MPLGGFAGLKEKLNPGKEELKNNVG-DSLGNL---QKKIDGSNVNEEDNIELTEDGRPVAAPKRS---PPLLDCG---CFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNN-NTVYINGT------AVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWAD-PENTSDEKCGIIGEDELADETEPSSDSGLATRQ 545          
BLAST of slc17a-1 vs. Ensembl Zebrafish
Match: slc17a7a (solute carrier family 17 member 7a [Source:ZFIN;Acc:ZDB-GENE-050105-5])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 289/512 (56.45%), Postives = 352/512 (68.75%), Query Frame = 2
Query:  365 EVEQLSSNKKPQ----KHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSD 1876
            E  +LS+  +P+    K L   P+  C     + + +RY++A +S  GF +SFGIRCN+  A+V M ND   T  +  KP+I+ +     F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + HY  V++VR+ QGLVEGVSYPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG +GI W + W    YE PA HP IT +ER YIE  + E +G          PWR  FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQLADYLR  N +TTT VRK+ NCGGFG EA  LLVVG++H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+A+L+H  GV FY +FASGEKQPWAD  E+ +   C    ED     TE  Y  G  
Sbjct:   31 ETIELSAEGRPELVEEKEL---PIVDCT---CFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNDH--TVYSGKKPVIVAAQ----FTWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIMVRVCQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYTGWSSVFYVYGSVGIFWYLFWILVSYESPAAHPTITPEERKYIEDAIGESAGLVNPLQKFKTPWRHFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRTHNLMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIAALVHYGGVIFYGLFASGEKQPWAD-AENTSEEKCGILGEDELANETEELYRTGGQ 529          
BLAST of slc17a-1 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 281/480 (58.54%), Postives = 346/480 (72.08%), Query Frame = 2
Query:  449 WNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            + + +RY++A MS  GF +SFGIRCN+  A+V M N++ +   N    ++I    +  F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + H+A V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++E+ YIE ++ E +G     A    PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+AD+LR K  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY IFASGEKQPWA+ PE+ +   C    ED +  E  E    YG+
Sbjct:   57 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYKGNK---IVIE---QAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAE-PEETSDEKCGFIHEDELADESEEQSQAYGA 529          
BLAST of slc17a-1 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 281/480 (58.54%), Postives = 346/480 (72.08%), Query Frame = 2
Query:  449 WNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            + + +RY++A MS  GF +SFGIRCN+  A+V M N++ +   N    ++I    +  F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + H+A V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++E+ YIE ++ E +G     A    PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+AD+LR K  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY IFASGEKQPWA+ PE+ +   C    ED +  E  E    YG+
Sbjct:   47 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYKGNK---IVIE---QAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAE-PEETSDEKCGFIHEDELADESEEQSQAYGA 519          
BLAST of slc17a-1 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 281/480 (58.54%), Postives = 346/480 (72.08%), Query Frame = 2
Query:  449 WNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            + + +RY++A MS  GF +SFGIRCN+  A+V M N++ +   N    ++I    +  F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + H+A V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++E+ YIE ++ E +G     A    PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+AD+LR K  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY IFASGEKQPWA+ PE+ +   C    ED +  E  E    YG+
Sbjct:   41 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYKGNK---IVIE---QAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAE-PEETSDEKCGFIHEDELADESEEQSQAYGA 513          
BLAST of slc17a-1 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 281/480 (58.54%), Postives = 346/480 (72.08%), Query Frame = 2
Query:  449 WNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            + + +RY++A MS  GF +SFGIRCN+  A+V M N++ +   N    ++I    +  F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + H+A V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++E+ YIE ++ E +G     A    PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+AD+LR K  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY IFASGEKQPWA+ PE+ +   C    ED +  E  E    YG+
Sbjct:   36 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYKGNK---IVIE---QAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAE-PEETSDEKCGFIHEDELADESEEQSQAYGA 508          
BLAST of slc17a-1 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 282/493 (57.20%), Postives = 347/493 (70.39%), Query Frame = 2
Query:  449 WNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNI-------------TFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            + + +RY++A MS  GF +SFGIRCN+  A+V M N++ +               ++  K    H S +  F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + H+A V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++E+ YIE ++ E +G     A    PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+AD+LR K  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY IFASGEKQPWA+ PE+ +   C    ED +  E  E    YG+
Sbjct:   57 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYKGNKIVIEVRINILSHKRKTCSPHISPQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAE-PEETSDEKCGFIHEDELADESEEQSQAYGA 548          
BLAST of slc17a-1 vs. Ensembl Mouse
Match: Slc17a6 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [Source:MGI Symbol;Acc:MGI:2156052])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 284/505 (56.24%), Postives = 350/505 (69.31%), Query Frame = 2
Query:  347 QYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVT 1849
            + D  + +E     K  +      P+  C     + + +RY++A MS  GF +SFGIRCN+  A+VDM N+  I    H    +I    K  F W      ++ GSFF+GY+ TQIPGG IA++  A RVFG A+  TS LN+L+P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L    GW + FY YG  G+ W + W    YE PA HP ITD+ER YIE ++ E +   G+      PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PHLVM IIVPIGGQ+AD+LR K  L+TT VRKI NCGGFG EA  LLVVGY+H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+K+RE W YVFL+A+L+H  GV FYA+FASGEKQPWAD PE+ +   C    ED   E T
Sbjct:   34 KQDNRETIELTEDGKPLEVPEKKAPLCDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HRGGKVIKE--KAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWAD-PEETSEEKCGFIHEDELDEET 528          
BLAST of slc17a-1 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 296/562 (52.67%), Postives = 373/562 (66.37%), Query Frame = 2
Query:  212 MVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLP---------WNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS--GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDY 1861
            M    F+T KEK  + P  +  K+       I+  + D    +N + D ++  E+    +  + H  V     C   +P           + KRY++A MS  GF +SFGIRCN+  A+V+M N  N T     KP I        F W      L+ GSFF+GY+ TQIPGG I+NKF A+RVFG A+  TS LN+ +P A + HY  VM VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W + W    YE PA HP I++ ER YIE ++ EG+   S +    PWRR FTS+PVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PH+VM I+VPIGGQLADYLR +  LTTT VRKI NCGGFG EA  LLVVG++H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W  VFL+A+L+H  GV FY +FASGEKQ WAD PE+++ + C    +D   E TE ++
Sbjct:    1 MPFKAFDTFKEKILK-PGKEGVKNAVGDSLGILQRKID---GTNEEEDAIELNEEGRPVQTSRAHRPVCDCSCCG--IPKRYICDCSCCGIPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVN--NSTVYVDGKPEI----QTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLTSTLNMFIPSAARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWAD-PENLSEDKCGIIDQDELAEETELNH 549          
BLAST of slc17a-1 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 282/495 (56.97%), Postives = 348/495 (70.30%), Query Frame = 2
Query:  347 QYDELDEVEQLSSNKKP-QKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCA 1816
            +  E  E  +LS++ +P   H    P+  C     + + +RY++A MS  GF +SFGIRCN+  A+V M N+     T H    ++    K  F W      L+ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++ER YIE  + E +           PWRR FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQ+AD+LR ++ ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY +FASGEKQPWA+ PE+++   C 
Sbjct:   25 KRQEGAETLELSADGRPVTTHTRDPPVVDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNS----TTHRGGHVV--VQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAE-PEEMSEEKCG 509          
BLAST of slc17a-1 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 282/514 (54.86%), Postives = 348/514 (67.70%), Query Frame = 2
Query:  347 QYDELDEVEQLSSNKKP-QKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSM-------------------KPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCA 1816
            +  E  E  +LS++ +P   H    P+  C     + + +RY++A MS  GF +SFGIRCN+  A+V M N+       H      + S+                   K  F W      L+ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++ER YIE  + E +           PWRR FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQ+AD+LR ++ ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY +FASGEKQPWA+ PE+++   C 
Sbjct:   25 KRQEGAETLELSADGRPVTTHTRDPPVVDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQTPYRSVHKQEAVTPTLGDIQGGDTEKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAE-PEEMSEEKCG 534          
BLAST of slc17a-1 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 466.848 bits (1200), Expect = 2.346e-158
Identity = 226/366 (61.75%), Postives = 276/366 (75.41%), Query Frame = 2
Query:  773 LLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS--GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDY 1861
            + +P A + HY  VM VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W + W    YE PA HP I++ ER YIE ++ EG+   S +    PWRR FTS+PVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PH+VM I+VPIGGQLADYLR +  LTTT VRKI NCGGFG EA  LLVVG++H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W  VFL+A+L+H  GV FY +FASGEKQ WAD PE+++ + C    +D   E TE ++
Sbjct:    1 MFIPSAARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWAD-PENLSEDKCGIIDQDELAEETELNH 365          
BLAST of slc17a-1 vs. UniProt/SwissProt
Match: sp|Q7TSF2|VGLU3_RAT (Vesicular glutamate transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc17a8 PE=1 SV=2)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 297/554 (53.61%), Postives = 369/554 (66.61%), Query Frame = 2
Query:  212 MVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKD-LQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS--GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDY 1861
            M    F+T KEK          K G + +K  +      LQ   +   +E D +E     +  Q      P+  C+      + KRY++A MS  GF +SFGIRCN+  A+V+M N  N T     KP I        F W      L+ GSFF+GY+ TQIPGG I+NKF A RVFG A+  TS LN+ +P A + HY  VM VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W + W    YE PAVHP I+++ER YIE ++ EG+   S +    PWRR FTS+PVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PH+VM I+VPIGGQLADYLR +  LTTT VRKI NCGGFG EA  LLVVG++H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W  VFL+A+L+H  GV FY +FASGEKQ WAD PE+++   C    +D   E TE ++
Sbjct:    1 MPFNAFDTFKEKI--------LKPGKEGVKNAVGDSLGILQRKLDGTNEEGDAIELSEEGRPVQTSRARAPVCDCSCC---GIPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVN--NSTVYVDGKPEI----QTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAVHPTISNEERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDWAD-PENLSEEKCGIIDQDELAEETELNH 536          
BLAST of slc17a-1 vs. UniProt/SwissProt
Match: sp|Q6INC8|VGLU1_XENLA (Vesicular glutamate transporter 1 OS=Xenopus laevis OX=8355 GN=slc17a7 PE=2 SV=1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 290/515 (56.31%), Postives = 360/515 (69.90%), Query Frame = 2
Query:  353 DELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCA----PKIEDIPKEVTEYDYGYGS 1873
            + ++  E+     K +KH    P+  C     + + +RY++A MS  GF +SFGIRCN+  A+V M N++ +   N    L+I  +    F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + H+A V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA HP I+++ER YIE ++ E +G     A    PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+AD+LR K  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY IFASGEKQPWA+ PE+ +   C      ++ D  +E T+   GYGS
Sbjct:   31 ETIELTEEGQPVVKEEKHQ---PVVDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYKGNK---LVIEQA---QFNWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGITWYMFWILVSYESPAQHPTISEEERKYIEESIGESTGFMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWAE-PEETSDEKCGFIHEDELADESEEQTQAHGGYGS 532          
BLAST of slc17a-1 vs. UniProt/SwissProt
Match: sp|Q05B21|VGLU1_XENTR (Vesicular glutamate transporter 1 OS=Xenopus tropicalis OX=8364 GN=slc17a7 PE=2 SV=1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 281/480 (58.54%), Postives = 346/480 (72.08%), Query Frame = 2
Query:  449 WNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            + + +RY++A MS  GF +SFGIRCN+  A+V M N++ +   N    ++I    +  F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + H+A V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA+HP I+++E+ YIE ++ E +G     A    PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+AD+LR K  ++TT VRK+ NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY IFASGEKQPWA+ PE+ +   C    ED +  E  E    YG+
Sbjct:   57 FGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYKGNK---IVIE---QAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAE-PEETSDEKCGFIHEDELADESEEQSQAYGA 529          
BLAST of slc17a-1 vs. UniProt/SwissProt
Match: sp|Q9P2U8|VGLU2_HUMAN (Vesicular glutamate transporter 2 OS=Homo sapiens OX=9606 GN=SLC17A6 PE=2 SV=1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 286/504 (56.75%), Postives = 352/504 (69.84%), Query Frame = 2
Query:  353 DELDEVEQLSSNKKP-QKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVT 1849
             +  E  +L+ + KP +      P+  C     + + +RY++A MS  GF +SFGIRCN+  A+VDM N+  I    H    +I    K  F W      ++ GSFF+GY+ TQIPGG IA++  A RVFG A+  TS LN+L+P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L    GW + FY YG  G+ W + W    YE PA HP ITD+ER YIE ++ E +   G+      PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PHLVM IIVPIGGQ+AD+LR K  L+TT VRKI NCGGFG EA  LLVVGY+H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+K+RE W YVFL+A+L+H  GV FYAIFASGEKQPWAD PE+ +   C    ED   E T
Sbjct:   35 QDTGETIELTEDGKPLEVPERKAPLCDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HRGGKVIKE--KAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWAD-PEETSEEKCGFIHEDELDEET 528          
BLAST of slc17a-1 vs. UniProt/SwissProt
Match: sp|Q1L8X9|VGLU3_DANRE (Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 296/563 (52.58%), Postives = 377/563 (66.96%), Query Frame = 2
Query:  212 MVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPS-FVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTE--YDYGYGSDQ 1879
            M LG F  +KEK N      K   G DS+  +   +K +  ++  + D ++  E       P++     P+  C     + + KRY++A +S  GF +SFGIRCN+  A+V+M N+ N  + N +      + M+P+ F W      L+ GSFF+GY+ TQIPGG I+NK  A RVFG A+  TS LN+ +P A + HY  VM VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W I W    Y  PAVHP I+++ER YIE ++ EG+    S      PWR  FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PH+VM IIVPIGGQLAD+LR +  L+TT VRKI NCGGFG EA  LLVVG++H+  VA+S L+LAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTR  W +VF++AS++H  GV FYAIFASGEKQ WAD PE+ +   C    ED   + TE   D G  + Q
Sbjct:    1 MPLGGFAGLKEKLNPGKEELKNNVG-DSLGNL---QKKIDGSNVTEEDNIELTEDGRPVAAPKRS---PPLLDCG---CFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNN-NTVYINGT------AVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWAD-PENTSDEKCGIIGEDELADETEPSSDSGLATRQ 545          
BLAST of slc17a-1 vs. TrEMBL
Match: V5SK48 (Slc17a-1 OS=Schmidtea mediterranea OX=79327 GN=vglut PE=2 SV=1)

HSP 1 Score: 1269.99 bits (3285), Expect = 0.000e+0
Identity = 631/631 (100.00%), Postives = 631/631 (100.00%), Query Frame = 2
Query:  185 MALVMKFFGMVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQAXXXXXXXXXXXXXXXXDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY 2077
            MALVMKFFGMVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY
Sbjct:    1 MALVMKFFGMVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY 631          
BLAST of slc17a-1 vs. TrEMBL
Match: A0A3Q0KLG2 (Putative solute carrier family 17, member 7 (Vesicular glutamate transporter) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 329/575 (57.22%), Postives = 403/575 (70.09%), Query Frame = 2
Query:  425 GRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDD---NITFTNHSKPL----------------IIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEG-SGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQAXXXXXXXXXXXXXXXXDAQQEYGMN------YNDPNQNPQYVQIE-RRYSRKSRDSTGSQDNDP 2068
            G+C   L  + SKRY  AW+SS GFM++FGIRCN+S+AM+ M       N++   HSK                  +++ + KP F W+ G++  VD SFF+GYL TQIPGG+IA KFPA R+FG AV  ++ LNLLLP A K H+ LVMI+R+LQGLVEG SYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGL LSGLL   +GWQ+PFYFYG++G+ W   W+   +E+P++HP I++ ER YIE ++ E  + +++ IPIPWR+ FTS PVYAIIVANFARSWSFYLLI K+PKY  ++   NL + G LSALPHLVMA+IVPIGGQLAD LRKN L+TT VRKIFNCGGFG EA+FL+ VGY+ +I  A+  LVLAVGFSGFAISGYNVNHLDIAPRYASILMG+SNGVGT+SGMICP   E  TK++ +E W  VFL+ASL+H VGVTFYAIFASGEKQPWAD PE+   NW  P   D+P E+   +YGY    P  ++ NN +    S       D+ Q Y  N      YN    N   V  +   Y      +T  Q+ +P
Sbjct:   38 GKCLYFLCCHCSKRYYTAWLSSLGFMITFGIRCNMSWAMLTMQARHIAANLSHLPHSKHYEHTHHESGDHVVGFGGLMNVTAKPDFYWTAGQRGFVDSSFFYGYLITQIPGGVIAAKFPANRLFGIAVGGSAFLNLLLPAACKIHFGLVMIIRMLQGLVEGTSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLSLSGLLAQQMGWQSPFYFYGVVGLMWFFWWWNVTHERPSLHPTISEAERTYIETSIGESPTINESKIPIPWRKFFTSPPVYAIIVANFARSWSFYLLITKSPKYFREVFGYNLAETGFLSALPHLVMAVIVPIGGQLADKLRKNTLSTTAVRKIFNCGGFGIEAIFLIGVGYSKTITSALVCLVLAVGFSGFAISGYNVNHLDIAPRYASILMGLSNGVGTISGMICPITTELLTKNQNKEGWPIVFLIASLVHFVGVTFYAIFASGEKQPWADAPEEAQCNWQPPT--DLPAEMMHGEYGYA--DPTERKNNNLSFRRVSNQRNSSTDSNQIYTSNSRYTTGYNQSTVNDSLVNSQGYGYGETISGTTKGQNVNP 608          
BLAST of slc17a-1 vs. TrEMBL
Match: G4V9I0 (Putative solute carrier family 17, member 7 (Vesicular glutamate transporter) OS=Schistosoma mansoni OX=6183 GN=Smp_129060 PE=4 SV=1)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 329/575 (57.22%), Postives = 403/575 (70.09%), Query Frame = 2
Query:  425 GRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDD---NITFTNHSKPL----------------IIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEG-SGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQAXXXXXXXXXXXXXXXXDAQQEYGMN------YNDPNQNPQYVQIE-RRYSRKSRDSTGSQDNDP 2068
            G+C   L  + SKRY  AW+SS GFM++FGIRCN+S+AM+ M       N++   HSK                  +++ + KP F W+ G++  VD SFF+GYL TQIPGG+IA KFPA R+FG AV  ++ LNLLLP A K H+ LVMI+R+LQGLVEG SYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGL LSGLL   +GWQ+PFYFYG++G+ W   W+   +E+P++HP I++ ER YIE ++ E  + +++ IPIPWR+ FTS PVYAIIVANFARSWSFYLLI K+PKY  ++   NL + G LSALPHLVMA+IVPIGGQLAD LRKN L+TT VRKIFNCGGFG EA+FL+ VGY+ +I  A+  LVLAVGFSGFAISGYNVNHLDIAPRYASILMG+SNGVGT+SGMICP   E  TK++ +E W  VFL+ASL+H VGVTFYAIFASGEKQPWAD PE+   NW  P   D+P E+   +YGY    P  ++ NN +    S       D+ Q Y  N      YN    N   V  +   Y      +T  Q+ +P
Sbjct:   18 GKCLYFLCCHCSKRYYTAWLSSLGFMITFGIRCNMSWAMLTMQARHIAANLSHLPHSKHYEHTHHESGDHVVGFGGLMNVTAKPDFYWTAGQRGFVDSSFFYGYLITQIPGGVIAAKFPANRLFGIAVGGSAFLNLLLPAACKIHFGLVMIIRMLQGLVEGTSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLSLSGLLAQQMGWQSPFYFYGVVGLMWFFWWWNVTHERPSLHPTISEAERTYIETSIGESPTINESKIPIPWRKFFTSPPVYAIIVANFARSWSFYLLITKSPKYFREVFGYNLAETGFLSALPHLVMAVIVPIGGQLADKLRKNTLSTTAVRKIFNCGGFGIEAIFLIGVGYSKTITSALVCLVLAVGFSGFAISGYNVNHLDIAPRYASILMGLSNGVGTISGMICPITTELLTKNQNKEGWPIVFLIASLVHFVGVTFYAIFASGEKQPWADAPEEAQCNWQPPT--DLPAEMMHGEYGYA--DPTERKNNNLSFRRVSNQRNSSTDSNQIYTSNSRYTTGYNQSTVNDSLVNSQGYGYGETISGTTKGQNVNP 588          
BLAST of slc17a-1 vs. TrEMBL
Match: A0A095ANM9 (Vesicular glutamate transporter 1 OS=Schistosoma haematobium OX=6185 GN=MS3_04121 PE=4 SV=1)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 311/501 (62.08%), Postives = 377/501 (75.25%), Query Frame = 2
Query:  425 GRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDD---NITFTNHSKPL----------------IIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEG-SGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGY 1867
            G+C   L  + SKRY  AW+SS GFM++FGIRCN+S+AM+ M       N++   HSK                  +++ + KP F W+ G++  VD SFF+GYL TQIPGG+IA KFPA R+F  AV  ++ LNLLLP A K H+ LVM +R+LQGLVEG SYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGL LSGLL   +GWQ+PFYFYG+IGI W   W+   +E+P++HP I++ ER YIE ++ E  + +++ IPIPWR+ FTS+PVYAII+ANFARSWSFYLLI K+PKY  ++   NL + G LSALPHLVMA+IVPIGGQLAD LRKN L+TT VRKIFNCGGFG EA+FL+ VGY+ +I  A+  LVLAVGFSGFAISGYNVNHLDIAPRYASILMG+SNGVGT+SGMICP   E  TK++ +E W  VFL+ASL+H  GVTFYAIFASGEKQPWAD PE+   NW  P   D+P E+   +YGY
Sbjct:   39 GKCMYFLCCHCSKRYYTAWLSSLGFMITFGIRCNMSWAMLTMQARHIAANLSHLPHSKHYEHTHHESGDHVVGFGGLMNVTAKPDFYWTAGQRGFVDSSFFYGYLITQIPGGVIAAKFPANRLFSIAVGGSAFLNLLLPAACKIHFGLVMTIRMLQGLVEGTSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLSLSGLLAQQMGWQSPFYFYGVIGIMWFFWWWNVTHERPSLHPTISEAERTYIETSIGESPTINESKIPIPWRKFFTSLPVYAIIIANFARSWSFYLLITKSPKYFREVFGYNLAETGFLSALPHLVMAVIVPIGGQLADKLRKNTLSTTAVRKIFNCGGFGIEAIFLIGVGYSKTITSALVCLVLAVGFSGFAISGYNVNHLDIAPRYASILMGLSNGVGTISGMICPITTELLTKNQNKEGWPIVFLIASLVHFAGVTFYAIFASGEKQPWADAPEEAQCNWQPPT--DLPAEMMHGEYGY 537          
BLAST of slc17a-1 vs. TrEMBL
Match: A0A4S2LWB1 (MFS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005893 PE=4 SV=1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 309/567 (54.50%), Postives = 392/567 (69.14%), Query Frame = 2
Query:  230 ETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANS----NMQYDELDEVEQLSSNKK-PQKHLFVGPM--GRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITF-------------------TNHSKPL--IIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGS-DANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKE 1843
            +T++ +    PV +K +S +DS K  +     L+++      M  D               ++H +      GRC        SKRY  A +SS GF+++FGIRCN+S+AM+ M    N T                     +H   L  II+ + KP F W+  ++ +VDGSFFFGYL TQIPGG+IA+KF A +VFG AV  ++ +NL +P + KAHY LVMI+R +QGLVEG SYPACHGIWR+WAPPLERSRLATIAFCGSYAGAV GL LSGLL  NLGWQ+PFYFYGI G+ W + W+   YE+PA+HP IT+ ER+YIE ++ +     +  IPIPWR+ F S+PV+AIIVANFARSWSFYLLI+KTPKY  ++   N+ + G LSALPHLVMAIIVP+GGQLAD LRKN L+TT VRK+FNCGGFG EA+FL+ VG + +   A++ LVLAVGFSGFAISGYNVNHLDIAPRYASILMG+SNGVGT+SGMICP   E  T+   +E W+ VF++AS++H  GV FYAIFASGEKQPWA++P++   NW  P   D+P +
Sbjct:    5 QTLRGQIIAVPVKEKLQSKFDSFKGALKNAGLLKSSEPGYGQMAADASGTTYDADGQAVIKEQHTYEDDTCRGRCMYYACCRCSKRYYTACLSSLGFLITFGIRCNMSWAMLSMIARHNQTLHEQAMNRAHHLGLRHGAGGVDHVVDLVGIINVTTKPDFYWTAKERGIVDGSFFFGYLVTQIPGGVIASKFAANKVFGVAVGGSALINLFIPWSCKAHYILVMILRTMQGLVEGTSYPACHGIWRFWAPPLERSRLATIAFCGSYAGAVFGLSLSGLLAQNLGWQSPFYFYGISGMFWFVWWWRVTYERPAIHPTITEAERVYIETSIGDNPNVLEHKIPIPWRQFFLSLPVWAIIVANFARSWSFYLLIMKTPKYFKEVFGYNMAETGFLSALPHLVMAIIVPLGGQLADRLRKNTLSTTTVRKLFNCGGFGMEAVFLIGVGCSKTTTSALACLVLAVGFSGFAISGYNVNHLDIAPRYASILMGLSNGVGTISGMICPLTAELLTQGGRKEGWTIVFVIASMVHFTGVIFYAIFASGEKQPWAEIPDEALSNWQPPT--DLPPD 569          
BLAST of slc17a-1 vs. Ensembl Cavefish
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:103044031])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 300/545 (55.05%), Postives = 364/545 (66.79%), Query Frame = 2
Query:  230 ETIKEKFNQSPVSDKAKSGYDSIKKIIMGR-KDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVT 1849
            ET+KEK     V    K+G  ++    +G    L        +EL+  E     +  +K     P   C     + + +RY +A MS  GF +SFGIRCN+  A+VDM N+  I    H    II    K  F W      ++ GSFF+GY+ TQIPGG I+++  A RVFG A+  TS LN+ +P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA HP ITD+ER+YIE ++ EG+   G+      PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VGA+SALPHLVM IIVPIGGQLADYLR  N L+TT VRKI NCGGFG EA  LLVVG++HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTRE W  VFL+ASL+H  GV FY IFASGEKQPWAD PE+ +   C    ED   E T
Sbjct:    2 ETVKEK-----VLGPGKAGLKNLAGKTLGHMHRLMEKKQKGGEELELTEDGRPAEVKKKR---APPIDCT---CFGIPRRYTIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HKDGKIIIKE-KAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERLYIEESIGEGANLLGATEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGAVSALPHLVMTIIVPIGGQLADYLRSNNILSTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVVFYGIFASGEKQPWAD-PEETSDEKCGFIDEDELAEET 529          
BLAST of slc17a-1 vs. Ensembl Cavefish
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:103044031])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 300/545 (55.05%), Postives = 364/545 (66.79%), Query Frame = 2
Query:  230 ETIKEKFNQSPVSDKAKSGYDSIKKIIMGR-KDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVT 1849
            ET+KEK     V    K+G  ++    +G    L        +EL+  E     +  +K     P   C     + + +RY +A MS  GF +SFGIRCN+  A+VDM N+  I    H    II    K  F W      ++ GSFF+GY+ TQIPGG I+++  A RVFG A+  TS LN+ +P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA HP ITD+ER+YIE ++ EG+   G+      PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VGA+SALPHLVM IIVPIGGQLADYLR  N L+TT VRKI NCGGFG EA  LLVVG++HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTRE W  VFL+ASL+H  GV FY IFASGEKQPWAD PE+ +   C    ED   E T
Sbjct:    2 ETVKEK-----VLGPGKAGLKNLAGKTLGHMHRLMEKKQKGGEELELTEDGRPAEVKKKR---APPIDCT---CFGIPRRYTIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTI----HKDGKIIIKE-KAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERLYIEESIGEGANLLGATEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGAVSALPHLVMTIIVPIGGQLADYLRSNNILSTTTVRKIMNCGGFGMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQNVFLIASLVHYGGVVFYGIFASGEKQPWAD-PEETSDEKCGFIDEDELAEET 529          
BLAST of slc17a-1 vs. Ensembl Cavefish
Match: slc17a7a (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:103024379])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 293/518 (56.56%), Postives = 352/518 (67.95%), Query Frame = 2
Query:  365 EVEQLSSNKKPQ----KHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQ 1894
            E  +LS+  +P+    K L   P+  C     + + +RY++A +S  GF +SFGIRCN+  A+V M N+   T     KP+I        F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + HY  V++VRI QGLVEGVSYPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG +GI W + W    YE PAVHP IT +ER YIE  + E +G          PWR  FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQLADYLR  N +TTT VRK+ NCGGFG EA  LLVVG++H+  +A+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY IFASGEKQPWAD  ED +   C    ED     TE  Y  G     + Q
Sbjct:   31 ETIELSAEGRPELVEEKEL---PIVDCT---CFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNEH--TVFRGKKPII----EAAQFTWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPAAARVHYGCVIMVRICQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYTGWSSVFYVYGSVGILWYMFWILVSYESPAVHPTITPEERKYIEEAIGESAGLVNPLQKFKTPWRHFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQLADYLRTHNIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKVIAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWAD-AEDTSEEKCGILGEDELANETEEMYRTGGQYGAINQ 535          
BLAST of slc17a-1 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 288/529 (54.44%), Postives = 360/529 (68.05%), Query Frame = 2
Query:  302 KIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            ++I+GR   +     +  EL E       +  Q+     P+  C     + + +RY++A MS  GF +SFGIRCN+  A+V M N+  I   + +  +II    K  F W      ++ GSFF+GY+ TQIPGG I+++  A RVFG A+  TS LN+ +P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L    GW + FY YG  G+ W + W    YE PA HP ITD+ER YIE ++ E +   G       PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+ADYLR KN ++TT VRKI NCGGFG EA  LL+VGY+HS  +A+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTRE W YVFL+AS++H  GV FY IFASGEKQPWAD PE  +   C    ED + +E  +    YG+
Sbjct:    2 RLIIGRAMERRQKPGESIELTE-----DGRPAQRSERKTPLCDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTI---HENGKIIIKE--KAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWAD-PELTSEEKCGFIDEDELAEETGDITQSYGA 516          
BLAST of slc17a-1 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 283/509 (55.60%), Postives = 352/509 (69.16%), Query Frame = 2
Query:  362 DEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            + +E     +  Q+     P+  C     + + +RY++A MS  GF +SFGIRCN+  A+V M N+  I   + +  +II    K  F W      ++ GSFF+GY+ TQIPGG I+++  A RVFG A+  TS LN+ +P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L    GW + FY YG  G+ W + W    YE PA HP ITD+ER YIE ++ E +   G       PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQ+ADYLR KN ++TT VRKI NCGGFG EA  LL+VGY+HS  +A+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTRE W YVFL+AS++H  GV FY IFASGEKQPWAD PE  +   C    ED + +E  +    YG+
Sbjct:   39 ESIELTEDGRPAQRSERKTPLCDCT---CFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTI---HENGKIIIKE--KAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWAD-PELTSEEKCGFIDEDELAEETGDITQSYGA 538          
BLAST of slc17a-1 vs. Ensembl Sea Lamprey
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 461.07 bits (1185), Expect = 8.843e-155
Identity = 252/503 (50.10%), Postives = 318/503 (63.22%), Query Frame = 2
Query:  356 ELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHY-------ALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED 1831
            EL E  +    K P++     P+  C     + M KRY++A MS  GF +SFGIRCN+  A+VDM N  N ++ +  K ++   S+  S   ++    L +   FF +      G I+      +R      CST     L P  L  H           +    L  + +GV+YPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  G+ W I W    YE PA HP I+D+E+ YIE ++ E  G   S      PW++ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM I+VPIGGQLAD+ R K  ++TT VRK+ NCGGFG EA  LLVVG++H   +A++ LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W  VFL+A+L+H  GV FY +FASGEKQPWAD PE+ +   C    ED
Sbjct:    2 ELTEDGRPVQVKPPKE-----PLCECR---CFGMPKRYVIAVMSGLGFCISFGIRCNLGVAVVDMVN--NSSYHSGDKLIVQKGSLGWSMDLAMQLHELYN---FFLFFLATWQGHIVVKSM--SREERLHQCST-----LPPHWLPVHVEERRAVPCACLTSLSLSSVEQGVTYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYAGWSSVFYVYGSFGLFWYIFWLCIAYESPAKHPTISDEEKTYIEESIGESYGILGSTQKFKTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIISALPHLVMTIVVPIGGQLADFFRSKKIMSTTTVRKMMNCGGFGMEATLLLVVGFSHGKGIAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKGKTREEWQNVFLIAALVHYGGVIFYGLFASGEKQPWAD-PEETSDEKCGFINED 483          
BLAST of slc17a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010352.1 (pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene:ENSPMAG00000009375.1 transcript:ENSPMAT00000010352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.185 bits (461), Expect = 1.505e-52
Identity = 95/255 (37.25%), Postives = 142/255 (55.69%), Query Frame = 2
Query: 1022 GIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIK-VAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWA 1780
            G  G+ W I WF   ++ P  HP I+ +ER +I  +L     ++    IPWR ++T MP++AI VA F   W FY+L+   P Y+  +L   + Q G LSALP+L   +    GG  AD LR +  L+ T +RK+    G    +L L+  G+      +AVS L L+V F  F  +G  +N LDIAP+YA +L+GISN    L G + P++    T+  T + W  VF +++ I++ G  FY +F SG++Q WA
Sbjct:    1 GGTGLLWSIVWFLFAFDSPERHPRISAEEREFILKSLQAERQANHGTSIPWRHVWTCMPLWAINVAMFCSGWGFYVLLTSLPTYMSTVLHYEMQQNGLLSALPYLAGWVFTVAGGMAADALRIRGLLSITAIRKVATTLGLAVPSLCLVASGFVGCNHLLAVSFLTLSVAFGAFTTAGCGINQLDIAPQYAGVLLGISNTFNNLPGFLAPTLTGYLTEHDTLKEWHMVFFISAAINMFGALFYLVFGSGKQQSWA 255          
BLAST of slc17a-1 vs. Ensembl Nematostella
Match: EDO31704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX52])

HSP 1 Score: 319.701 bits (818), Expect = 8.806e-101
Identity = 178/460 (38.70%), Postives = 250/460 (54.35%), Query Frame = 2
Query:  434 ARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTD---NLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYL-RKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVN 1801
            A+   W + KRY+L  M+  GF+  + +R N++ A+V M ND  I+         +H   K  F W    + LV GSFF+GY   QIPG  +A +   TRVFG+ V  TS L LL P A +     ++ VRI QGL  GV++P  H IW  WAPP ERS L TI+  G   G ++ + L+GLL+    + GW + FY +G  GI W   W   ++E PA HP I+ +ER  IE ++A          +PW  I     V+AI++ +F   W +Y L    P Y  D+L  ++ Q G L+A P+L  A++ P+GG LADYL + N L    VR IF   G     +F++   Y  +  + V  LVL VGFSG    GY VNHLDIAP+YA +LMG++N   +  G I P +    TK K +E W  VF +  ++++V V  Y+   SG +QPWA   + V 
Sbjct:   29 AKTTKWGIPKRYVLLAMTWLGFINIYSMRVNLNVAIVGMVNDQTISKGR------LHFIKKAEFNWDSALQGLVLGSFFYGYWVLQIPGAWLAMRIGGTRVFGYGVFVTSLLALLTPVATRYSVWGLVGVRIFQGLFLGVTFPCNHAIWSKWAPPFERSTLITISIAGCPFGNIVAIPLTGLLSKYGFDGGWPSVFYCFGTSGIIWYCCWELVVHESPATHPTISKEERELIENSIASSDNKAQFEGLPWHHILRCKAVWAIVIGHFGACWGYYTLFTGMPTYFKDVLDFDIEQTGFLAACPYLFKALLAPLGGILADYLIKHNILRIGTVRVIFYAVGCLLAGVFIVATSYATTRHMCVIFLVLGVGFSGLNAIGYAVNHLDIAPQYAGVLMGLTNTFASTPGFISPQITGIVTKHKKQEEWRIVFWITMIVYVVAVIGYSALCSGYRQPWAGGRDQVE 482          
BLAST of slc17a-1 vs. Ensembl Nematostella
Match: EDO48671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA9])

HSP 1 Score: 315.464 bits (807), Expect = 1.027e-99
Identity = 166/452 (36.73%), Postives = 260/452 (57.52%), Query Frame = 2
Query:  464 RYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHS--KPLII-------HSSMKPS-FVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTD---NLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWA 1780
            RY++A M   G  V + +R N+S A+  M N   +T    +  K L++       H  + P+ F WS   +  + G+F++GY+  Q+PGG +  +F  TRVFG  +   S L +L P A +     ++ +R+++GL  G  +P  H IW  WAPP ER+RL TI   G   G +L + LSGL++    + GW + FY +G +G+ W   W  +I+  P+ HP I+++E++YIE  +A+  G    + IPW+ I TS PV+AII+ANF   W  Y ++I  PKY  ++LK +L + G L+ALP+++ A + P GG + D+L KN L+    R+     G    ++F+L  GY +   +AV  L + VG +G   +GY VN LDIAP+YA ++MG++N  G   G I P +V   T +KT + W  VF +  +++IVG+  + +  SG+KQ WA
Sbjct:    1 RYIVAIMVFLGICVQYALRVNLSVAIGAMCNPHTVTENGFTIKKVLVVYCVTVRRHQKVLPAEFDWSSKLQGTILGAFYYGYMTMQLPGGWLGQRFGGTRVFGICLGIASVLTMLTPLAARTSVVALITLRVIEGLTLGALFPCNHAIWSKWAPPSERTRLFTITVAGCPVGTILSMPLSGLMSKYGFDGGWASVFYCFGAVGLLWFFVWQLSIHATPSEHPTISEEEKVYIETAIADQPG--VKLSIPWKSILTSGPVWAIIIANFTADWGMYTILICLPKYFIEVLKFDLAKTGFLAALPYVLKAFVGPTGGVIVDWLIKNKLSVKNTRRCVFTVGCTVASIFVLATGYANQPYLAVGLLTIGVGITGINAAGYAVNILDIAPKYAGVIMGVTNVFGAAPGFISPQIVGIITPNKTAKEWRVVFWITFIVYIVGIVLFGLLVSGDKQKWA 450          
BLAST of slc17a-1 vs. Ensembl Nematostella
Match: EDO45514 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS9])

HSP 1 Score: 295.819 bits (756), Expect = 9.802e-92
Identity = 177/474 (37.34%), Postives = 268/474 (56.54%), Query Frame = 2
Query:  425 GRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSND--DNITFTNHSK------PLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNL---GWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIP---IPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADY-LRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVL--AVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSK-TRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPE 1792
            G C R+       RY LA ++  GF V +G+R N+S A+V M N   D I    +S+      P   + +    F W    + L+ GSFF+GY+ TQ+PGG +A++F    +FGF V  TS   LL P A      +++ +RIL+GL EGV++PA H IW  WAPPLERS+L T+++ G   G ++ + L+G+L  +    GW + FY +G +GI W + W   + EKPA HP I++ ER YI  ++  G+  D        PW  I++S  V+AII+A+F  +W FY  +   P Y  ++L  ++   G LSA+P+    + + I GQ+AD+ LR+   + + VRK+F    F   A  L+   YT      +S  +   A+GF+GF +SG+NVNHLDIAPRYA ILMGI+N  GT+ G+  P V    T  K  R  W  VF +++ ++++G   +   + G ++ W ++PE
Sbjct:   19 GTCWRV-------RYTLALLACLGFCVVYGLRVNLSVALVAMVNSTYDGIDGNTNSECPGGNTPDTTYKN--GDFNWDQKTQGLILGSFFYGYICTQLPGGWLASQFGGKHLFGFGVLCTSIFTLLTPWAAHQGIPMLIALRILEGLGEGVTFPAMHAIWSSWAPPLERSKLLTLSYAGCQLGNIIFMPLAGVLCASEIAGGWPSVFYIFGSLGILWFVVWTLMVTEKPADHPTISEAERDYIISSI--GTSQDRKTTKQNTPWSAIWSSPAVWAIIIAHFCNNWGFYTFLTLLPSYFKEVLNFSILTNGFLSAVPYSTQWLFIVIAGQIADWLLRRRISSVSDVRKVFCVTAFIIPACLLVATSYTGCTTTTLSVCLFSTALGFTGFNLSGFNVNHLDIAPRYAGILMGITNSFGTVPGIAAPYVAGWITNKKPDRAHWQIVFFISAGLYVIGAISFVTLSKGSERRW-NIPE 480          
BLAST of slc17a-1 vs. Ensembl Nematostella
Match: EDO31712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX51])

HSP 1 Score: 267.7 bits (683), Expect = 4.247e-82
Identity = 154/429 (35.90%), Postives = 232/429 (54.08%), Query Frame = 2
Query:  509 FGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDN-LGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYIT--DDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWAD 1783
            + +R  +S A+V M ++  +   N  K     +   P F WS   + LV GSF++GY   QIP G    K     +FGF +   S L L+ P  +K  + + + +RI QGL  G+   A H IW  W+P  ER+ L TIA  G+  G ++ + ++GLL D+  GW   FYF G +G+ W I W   +YE P  HP IT  + E I +   + E + S     +PW  I  S PV+A     F   W FY ++I  P ++  +L  +L++ G +SALP ++M I+ P+ G  AD LR +  L+T  +RKIF C G    + F++ VGY     ++++ L L +G  G   +G   N +D++P+YA +LMG SN +G+LSG + P VV   T   T E W  VF + +++ + G+  Y  F SG+KQ WAD
Sbjct:    2 YAVRTCLSVAIVAMVSNSTV-LINGKK-----TVKPPEFAWSSEMQGLVLGSFYYGYAVLQIPAGWAVLKIGGKPIFGFGILVASVLALVTPPIVKQSFIVFICLRIAQGLSLGLIASAHHCIWATWSPIFERASLLTIAGSGTLVGTIVTMPVTGLLCDSPKGWPLAFYFIGSLGVLWFIAWQYFMYETPQDHPTITQAEIEFIGVPWNIDEATKSV----VPWASILCSTPVWAANFTMFISDWCFYSMLICIPLFMKQVLHFSLSETGFVSALPFVLMTIVSPVSGMYADRLRARGVLSTGAIRKIFQCAGLAASSCFVVAVGYESKPFLSLALLTLGIGSFGLIAAGVGPNLIDLSPKYAGLLMGFSNTMGSLSGFLAPGVVGVLTVHGTLEEWRLVFWLTAVLSLAGILVYVAFGSGKKQSWAD 420          
BLAST of slc17a-1 vs. Ensembl Nematostella
Match: EDO46366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH0])

HSP 1 Score: 265.388 bits (677), Expect = 2.210e-80
Identity = 159/465 (34.19%), Postives = 248/465 (53.33%), Query Frame = 2
Query:  419 PMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLL-TDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANI---PIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYL-RKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSK-TRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPED 1795
            P  +C  +LP     RY+LA +  FG  V+F +R N+S A+V M N      T   +P       +  F W    + ++ GSFF+GY+   IPGG +A +       G  V  +S L+LL P A +  Y +++++RIL+GL +GV YP+ + +   WAPP ERS++  I + G  AG ++GL +SGLL      W + FY +G  GI W + W   +Y+ P+VHP I+ +E+ YI    A G+  D  +   P PWR+I TS  V AI ++ F  +W F   +   P Y  ++L  N+T  G LSALP+          G LAD+L   + +T T VRKIF        +  ++ +G+T+   VAV+ L +   F      G+ ++ ++ APRY  +L  I+N +GT +G+  P VV   T  + TR+ W  V+ + + I++ G   +A   + ++QPW   PE+
Sbjct:    2 PQSKC--ILP----CRYILAVLGCFGLTVTFSLRVNLSVALVAMVNS-----TQTGQP------KEDYFSWDQQTRGIILGSFFYGYIVMLIPGGWLAERNGGKHFVGLGVLISSVLSLLTPLAARYSYKMLIVLRILEGLAQGVIYPSVNVLLSCWAPPEERSKMLVITWTGCQAGNIIGLVVSGLLCASRFQWPSVFYLFGASGIVWYLFWCFLVYDSPSVHPRISLEEKEYI--VTAIGASQDKVVKKHPTPWRQILTSRAVLAISISFFCSNWGFCTFLTSLPTYFQEVLHFNITTNGLLSALPYFCQYFTSLPAGFLADWLIHSHIITVTEVRKIFTLA-----SCIMVALGFTNQPVVAVTLLCVLFMFQTIDTCGHWISPMEFAPRYCGLLFAIANSIGTSTGIAAPFVVGYLTNGQPTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPWNTPPEE 442          
BLAST of slc17a-1 vs. Ensembl Medaka
Match: SLC17A6 (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:101166288])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 294/515 (57.09%), Postives = 360/515 (69.90%), Query Frame = 2
Query:  347 QYDELDEVEQLSSNKKPQKHLFVGP-MGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEG---SGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            +  +  EV +L+ + +P++     P +  C+    + + +RY++A MS  GF +SFGIRCN+  A+V M N+  I   + +  +II    K  F W      ++ GSFF+GY+ TQIPGG I ++  A RVFG A+  TS LN+ +P A + HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLATI+FCGSYAGAV+ + L+G+L    GW + FY YG +GI W I W    YE PA HP ITD+ER YIE ++ E    SG       PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVPIGGQLAD+LR KN LTTT VRKI NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTRE W YVFL+ASL+H  GV FY IFASGEKQPWAD PE  +   C    ED + +E  +    YG+
Sbjct:   29 RRQKTGEVIELTEDGRPREAAEKKPPLCDCS---CFGLPRRYIIAIMSGMGFCISFGIRCNLGVAIVGMVNNSTI---HQNGKIIIKE--KAKFNWDPETVGMIHGSFFWGYIVTQIPGGYICSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATISFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGCVGIFWYIFWILVSYESPADHPTITDEERCYIEESIGESARLSGPGEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQLADHLRSKNILTTTTVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWAD-PELTSEEKCGFIDEDELAEETGDITQSYGA 534          
BLAST of slc17a-1 vs. Ensembl Medaka
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:101175075])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 288/515 (55.92%), Postives = 359/515 (69.71%), Query Frame = 2
Query:  347 QYDELDEVEQLSSNKKPQKH-LFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGS---GSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRK-NYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIED-IPKEVTEYDYGYGS 1873
            +  +  EV +L+ + +P++      P+  C     + + +RY++A +S  GF +SFGIRCN+  A+V M N+  I    H    II    K  F W      ++ GSFF+GY+ TQIPGG I+++  A RVFG A+  TS LN+ +P A ++HY  V+ VRILQGLVEGV+YPACHGIW  WAPPLERSRLAT++FCGSYAGAV+ + L+G+L    GW + FY YG  GI W + W    YE PA HP IT++ER YIE ++ E +   G       PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSALPHLVM IIVP+GGQLADYLR  N ++TT+VRKI NCGGFG EA  LLVVGY+HS  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTRE W YVFL+ASL+H  GV FY IFASGEKQPWAD PE+     C    ED + +E  +   GYG+
Sbjct:   33 KRQQTGEVIELTEDGRPREDPERKAPLCDCT---CFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNNSTI----HQNGKIIVKE-KAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARSHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATLSFCGSYAGAVIAMPLAGVLVQYTGWSSVFYVYGSFGIFWYMFWILVSYESPAEHPTITEEERRYIEESIGESAQLMGPSEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPLGGQLADYLRSHNIMSTTMVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWAD-PEETKEEKCGFIDEDELAEETGDITQGYGA 538          
BLAST of slc17a-1 vs. Ensembl Medaka
Match: slc17a7a (vesicular glutamate transporter 1 [Source:NCBI gene;Acc:101175655])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 292/521 (56.05%), Postives = 360/521 (69.10%), Query Frame = 2
Query:  365 EVEQLSSNKKPQ----KHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG---SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRK-NYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDY----GYGS-DQPIL 1888
            E  +LS+  +P+    K +   P+  C     + + +RY++A +S  GF +SFGIRCN+  A+V M ND  +   N  K +++ +     F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TS LN+L+P A + HY+ V++VRI QGLVEGVSYPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L   +GW + FY YG  GI W + W    YE PA HP IT +ER YIE  + E S           PWR+ FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQLADYLR  N +TTT VRK+ NCGGFG EA  LLVVGY+H+  +A+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W YVFL+ASL+H  GV FY +FASGEKQPWAD+ ED +   C    ED     TE  Y     YG+ +QP++
Sbjct:   31 ETIELSAEGRPELVEEKEM---PVVDCT---CFGLPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNDHTVYKGN--KEVLVAAQ----FTWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARCHYSCVILVRICQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYIGWPSVFYVYGSFGIFWYLFWILVSYESPAAHPTITAEERKYIEEAIGESSSFLNPLQKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSHNLMTTTNVRKLMNCGGFGMEATLLLVVGYSHTKVIAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVVFYGLFASGEKQPWADI-EDTSDEKCGIIDEDELANETEELYRGGGQYGAINQPVV 538          
BLAST of slc17a-1 vs. Ensembl Medaka
Match: ENSORLT00000010014.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 291/534 (54.49%), Postives = 361/534 (67.60%), Query Frame = 2
Query:  317 RKDLQANSNMQYD---ELDEVEQLSSNKKPQ----KHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSG-SDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNY-LTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDY------GYGS 1873
            RK    NS +  +   E  E  +LS+  +P+    K +   P+  C     + + +RY++A +S  GF +SFGIRCN+  A+V M N   +   N  K +I+    K  F W      ++ GSFF+GY+ TQIPGG I  KF A RVFGFA+ +TSCLN+L+P A + H+  V+IVRI QGLVEGVSYPACHGIW  WAPPLERSRLAT AFCGSYAGAV+ + L+G+L    GW + FY YG  G+ W   W    YE PA HP IT++ER YIE ++ E +  +      PWR  FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG +SALPHLVM IIVPIGGQ+ADYLR N  +TTT VRK+ NCGGFG EA  LLVVG++H+  VA++ LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK KTRE W  VFL+ASL+H  GV FY +FASGEKQ WA+ PE+++   C    ED     TE  Y      GYG+
Sbjct:    9 RKQPGKNSFIALEKKQENGETIELSAEGRPELVQEKEM---PVVDCT---CFGLPRRYIIAILSGIGFCISFGIRCNLGVAVVSMVNSHKVLRGN--KEVIV----KAQFEWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSCLNMLIPAAARMHFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYIEESIGESAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQGVFLIASLVHYGGVIFYGLFASGEKQTWAE-PEELSVEKCGILDEDELANETEELYRTSGGGGYGA 529          
BLAST of slc17a-1 vs. Ensembl Medaka
Match: slc17a8 (vesicular glutamate transporter 3 [Source:NCBI gene;Acc:101165727])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 281/543 (51.75%), Postives = 369/543 (67.96%), Query Frame = 2
Query:  233 TIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQANSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYD 1858
            ++KE+  +    +   S  DS+ K+ +   +++   N +  E  +   ++S  +P       P+  C+      + KRY++A +S  GF +SFGIRCN+  A+V+M N+ N  + N +  L      +  F W      L+ GSFF+GY+ TQIPGG IANK  A RVFG A+  TS LN+ +P A + HY  V+ VRILQGLVEGV+YPACHG+W  WAPPLERSRLAT +FCGSYAGAV+ + L+G+L   +GW + FY YG+ GI W + W    Y  PA HP IT++ER+YIE  + E     +    PWRR FTSMPVYAIIVANF RSW+FYLL+I  P Y  ++    +++VG LSA+PH+VM I+VPIGGQLAD+LR K  ++TT VRK+ NCGGFG EA  LLVVG++H+  VA+S LVLAVGFSGFAISG+NVNHLDIAPRYASILMGISNGVGTLSGM+CP +V   TK+KTR  W +VF++AS++H  GV FYAIFASGE+Q WA+ PE ++ + C    ED   E +E +
Sbjct:    7 SLKEQVFKPGKEEVKNSVGDSLGKLKIDGSNVENEDNFELTE--DGRPVASAPRP------APLLDCS---CGGLPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNN-NTVYINGTPVL-----QRAQFNWDPETVGLIHGSFFWGYIVTQIPGGFIANKLSANRVFGAAIFLTSVLNMFIPSAARVHYGCVLFVRILQGLVEGVTYPACHGLWAKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQYVGWPSVFYIYGVFGIMWYVMWLLLAYGSPADHPTITEEERLYIEAAIGETVNQLSKFRTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIVVPIGGQLADFLRSKKIMSTTNVRKLMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKNKTRLEWQHVFVIASMVHYSGVIFYAIFASGEQQDWAN-PESLSEDKCGIIDEDELAEESELN 531          
BLAST of slc17a-1 vs. Planmine SMEST
Match: SMESG000080078.1 (SMESG000080078.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 295/295 (100.00%), Postives = 295/295 (100.00%), Query Frame = 2
Query: 1193 MPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQAXXXXXXXXXXXXXXXXDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY 2077
            MPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY
Sbjct:    1 MPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY 295          
BLAST of slc17a-1 vs. Planmine SMEST
Match: SMESG000080078.1 (SMESG000080078.1)

HSP 1 Score: 494.582 bits (1272), Expect = 2.489e-171
Identity = 261/274 (95.26%), Postives = 266/274 (97.08%), Query Frame = 2
Query: 1268 KYLHDLLKQN----LTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQAXXXXXXXXXXXXXXXXDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY 2077
            ++  + +K+N    L QVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY
Sbjct:   17 RWKKEGMKKNEISELLQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY 290          
BLAST of slc17a-1 vs. Planmine SMEST
Match: SMESG000052932.1 (SMESG000052932.1)

HSP 1 Score: 468.003 bits (1203), Expect = 1.214e-161
Identity = 246/246 (100.00%), Postives = 246/246 (100.00%), Query Frame = 2
Query: 1340 MAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQAXXXXXXXXXXXXXXXXDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY 2077
            MAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY
Sbjct:    1 MAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDIPKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDPNQNPQYVQIERRYSRKSRDSTGSQDNDPRAY 246          
BLAST of slc17a-1 vs. Planmine SMEST
Match: SMESG000019933.1 (SMESG000019933.1)

HSP 1 Score: 325.094 bits (832), Expect = 7.033e-103
Identity = 177/476 (37.18%), Postives = 271/476 (56.93%), Query Frame = 2
Query:  431 CARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITF----TNHSKPLIIHSSMKPSFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGAL--KAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLRKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFT-KSKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWA--DLPEDVNPNWCAPKIED 1831
            C ++L    +KRYLLA ++ FG ++  G+RC I  A++ ++   ++       N S+  +I         WS  K SL++ SF+ GY    IPGG ++  FPA +VFGFAV +++  N  +P  +  +  +  V ++RI QG+ EG  YP+ H  WRYWAP  ERS+L TI+F G   G ++G  +SG+LT    W A FYF+G   + W + W     + P+   +I++ E+ YIE   ++ + + + +P  W  I TS+PV+AII+AN  R+W++       P +L      +   +G   ++P++VMAI+ P  G +AD + K   +   VRK FN  GFG   L  L +G+   + +A ++L + +G  G  ISG+ VNHLDIA  YA +LMGISNG+GTL+G++ P V    T K    + W   F+++ +IH++ VTFYAIFASGE Q WA    PE +  +   P   D
Sbjct:    9 CQKVLG---NKRYLLAILACFGLLIPLGMRCEIGIAIIKLTELHDMVVPAGNNNISEFKVIQVR---EVAWSNTKVSLIEASFYIGYTLFSIPGGFLSTIFPANKVFGFAVFTSAFFNFAIPLLVIYQCGFVSVFVLRIFQGMSEGCLYPSVHSFWRYWAPKQERSKLVTISFFGMALGPIIGYPISGILTKRYDWPANFYFWGTAAMSWAVIWLAVSRKCPSQDSFISEAEKTYIEQNTSQMAITASQVP--WISILTSVPVWAIIIANIGRNWTYQFSFSGLPSFLRKKFNDSSINLGFHMSIPYIVMAILTPSCGIVADCMIKRKFSVAFVRKFFNSVGFGIAGLMFLFLGFIPYLWLATTTLSIGLGSFGIGISGFGVNHLDIADIYAGVLMGISNGIGTLAGILAPIVAMEITNKFSVNDGWLIFFIISGIIHLITVTFYAIFASGENQSWAVHTEPEGIKDSEKKPLPND 476          
BLAST of slc17a-1 vs. Planmine SMEST
Match: SMESG000066847.1 (SMESG000066847.1)

HSP 1 Score: 299.286 bits (765), Expect = 1.473e-92
Identity = 192/509 (37.72%), Postives = 284/509 (55.80%), Query Frame = 2
Query:  299 KKIIMGRKDLQAN---SNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWMSSFGFMVSFGIRCNISYAMVDMSNDDNITFTN-HSKPLIIHSSMKP-----SFVWSLGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLPGALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFCGSYAGAVLGLFLSG-LLTDNL--GWQAPFYFYGIIGICWGITWFTNIYEKPAVHPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARSWSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYLR-KNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKV-AVSSLVLAVGFSGFAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTK-SKTRESWSYVFLVASLIHIVGVTFYAIFASGEKQPWA 1780
            K  ++   +L+ N   SN  YD LDE  +  S K+   + F  P              RY++A     GF V + +R N+S A++ M N+  I     +  P   +S++        FVW    + LV G+FF+GY+  QIP G IA K      FG  V  TS L LL P A +  Y  ++ +RIL+G  E ++YPA H +  YWAP +E + +  I + GS+AG V+GL  S  L+  N+  GW + FY  GIIGI W I W    +  PA HP IT  E+ +IE ++   S  + +  +PW+ I  S+PV+AI VANF   WS Y L+   P Y   +L  ++ Q G ++ALP+L+ AI+  + G++AD +R + +L+TTV RK+FN  G    A+F++ + Y    KV  V+ L +AV       +GYNVNH+D+AP+YA +L GI+N + T++G+I PSVV   T   +TR+ W  VF ++S I + G  F+ IF SG++Q WA
Sbjct:    4 KSNLLNVSNLRINYYTSNENYDNLDENSE--SPKEKWYNRFCIP-------------TRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDPGLNLTPECPNSNLSKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSV-NLSSEERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYVNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTVGMTINAIFIVAISYIGCNKVLVVTFLCIAVALGTSNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKQWQIVFYISSAITLFGAIFFLIFGSGDRQSWA 496          
The following BLAST results are available for this feature:
BLAST of slc17a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A60.000e+056.75solute carrier family 17 member 6 [Source:HGNC Sym... [more]
SLC17A80.000e+052.71solute carrier family 17 member 8 [Source:HGNC Sym... [more]
SLC17A70.000e+056.57solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A70.000e+060.13solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A84.998e-16248.55solute carrier family 17 member 8 [Source:HGNC Sym... [more]
back to top
BLAST of slc17a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-46.891e-16251.88Probable vesicular glutamate transporter eat-4 [S... [more]
eat-42.226e-16151.88Probable vesicular glutamate transporter eat-4 [S... [more]
vglu-37.805e-10039.51Potential vesicular glutamate transporter vglu-3 ... [more]
vglu-21.062e-9640.00Vesicular GLUtamate transporter [Source:UniProtKB... [more]
slc-17.17.961e-8332.88SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
back to top
BLAST of slc17a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VGlut6.185e-15750.63gene:FBgn0031424 transcript:FBtr0307078[more]
VGlut6.185e-15750.63gene:FBgn0031424 transcript:FBtr0331202[more]
VGlut6.185e-15750.63gene:FBgn0031424 transcript:FBtr0077769[more]
MFS92.536e-11138.77gene:FBgn0038799 transcript:FBtr0083889[more]
MFS92.536e-11138.77gene:FBgn0038799 transcript:FBtr0083888[more]
back to top
BLAST of slc17a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a7b0.000e+057.09solute carrier family 17 member 7b [Source:ZFIN;Ac... [more]
slc17a6a0.000e+054.66solute carrier family 17 member 6a [Source:NCBI ge... [more]
slc17a80.000e+052.58solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a80.000e+052.58solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a7a0.000e+056.45solute carrier family 17 member 7a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc17a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hgf0.000e+058.54hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf0.000e+058.54hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf0.000e+058.54hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf0.000e+058.54hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf0.000e+057.20hepatocyte growth factor (hepapoietin A; scatter f... [more]
back to top
BLAST of slc17a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc17a60.000e+056.24solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a80.000e+052.67solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a70.000e+056.97solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a70.000e+054.86solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a82.346e-15861.75solute carrier family 17 (sodium-dependent inorgan... [more]
back to top
BLAST of slc17a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TSF2|VGLU3_RAT0.000e+053.61Vesicular glutamate transporter 3 OS=Rattus norveg... [more]
sp|Q6INC8|VGLU1_XENLA0.000e+056.31Vesicular glutamate transporter 1 OS=Xenopus laevi... [more]
sp|Q05B21|VGLU1_XENTR0.000e+058.54Vesicular glutamate transporter 1 OS=Xenopus tropi... [more]
sp|Q9P2U8|VGLU2_HUMAN0.000e+056.75Vesicular glutamate transporter 2 OS=Homo sapiens ... [more]
sp|Q1L8X9|VGLU3_DANRE0.000e+052.58Vesicular glutamate transporter 3 OS=Danio rerio O... [more]
back to top
BLAST of slc17a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5SK480.000e+0100.00Slc17a-1 OS=Schmidtea mediterranea OX=79327 GN=vgl... [more]
A0A3Q0KLG20.000e+057.22Putative solute carrier family 17, member 7 (Vesic... [more]
G4V9I00.000e+057.22Putative solute carrier family 17, member 7 (Vesic... [more]
A0A095ANM90.000e+062.08Vesicular glutamate transporter 1 OS=Schistosoma h... [more]
A0A4S2LWB10.000e+054.50MFS domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of slc17a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a6a0.000e+055.05solute carrier family 17 member 6 [Source:NCBI gen... [more]
slc17a6a0.000e+055.05solute carrier family 17 member 6 [Source:NCBI gen... [more]
slc17a7a0.000e+056.56vesicular glutamate transporter 1-like [Source:NCB... [more]
slc17a6b0.000e+054.44vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6b0.000e+055.60vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
back to top
BLAST of slc17a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc17a6b8.843e-15550.10solute carrier family 17 member 6b [Source:NCBI ge... [more]
ENSPMAT00000010352.11.505e-5237.25pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene... [more]
back to top
BLAST of slc17a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc17a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317048.806e-10138.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486711.027e-9936.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455149.802e-9237.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317124.247e-8235.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463662.210e-8034.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc17a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A60.000e+057.09vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6a0.000e+055.92solute carrier family 17 member 6 [Source:NCBI gen... [more]
slc17a7a0.000e+056.05vesicular glutamate transporter 1 [Source:NCBI gen... [more]
ENSORLT00000010014.20.000e+054.49vesicular glutamate transporter 1-like [Source:NCB... [more]
slc17a80.000e+051.75vesicular glutamate transporter 3 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080078.10.000e+0100.00SMESG000080078.1[more]
SMESG000080078.12.489e-17195.26SMESG000080078.1[more]
SMESG000052932.11.214e-161100.00SMESG000052932.1[more]
SMESG000019933.17.033e-10337.18SMESG000019933.1[more]
SMESG000066847.11.473e-9237.72SMESG000066847.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005469
GenBankAHB51762.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005469 ID=SMED30005469|Name=slc17a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2310bp
CTCGAATATGATTGGTTATCTGTTAAAAATTGAGGAACTTTTGCATTCAG
ACTTTCCTCATCCATGACGACAAATTTTGTTGTTGAGTATCAATTAAACA
TAATAAAATATTGATTTTTTACTAGCCATATAATAATCGATTTTTCACAA
CTCCCATCGATCAGTTTTTTAATTAAAATCCAATATGGCGTTAGTTATGA
AGTTTTTCGGAATGGTGCTAGGCGTTTTTGAAACCATTAAGGAAAAATTC
AACCAATCTCCTGTTTCTGATAAAGCAAAATCCGGCTACGATAGCATTAA
AAAGATAATTATGGGTCGAAAAGATCTACAGGCCAATTCTAATATGCAAT
ATGATGAACTGGATGAAGTAGAACAATTATCCTCCAACAAAAAGCCTCAA
AAACATCTTTTCGTTGGACCAATGGGTAGATGTGCCAGAATGTTACCTTG
GAACATGTCGAAACGATATCTATTGGCATGGATGAGCAGTTTCGGATTTA
TGGTCTCATTCGGAATCCGATGCAACATATCTTACGCAATGGTAGATATG
TCGAATGACGACAACATTACATTTACTAACCACTCAAAGCCTTTAATAAT
CCACTCTTCAATGAAACCAAGTTTCGTTTGGTCATTGGGTAAAAAAAGTC
TAGTGGATGGATCTTTCTTTTTCGGGTATTTATTTACTCAGATACCAGGC
GGAATCATAGCGAATAAATTCCCCGCAACTCGTGTTTTTGGATTCGCTGT
TTGTTCTACGTCCTGTCTGAATTTGCTGCTACCCGGTGCACTGAAAGCCC
ATTATGCTCTAGTTATGATTGTTAGGATTTTGCAGGGTTTAGTTGAGGGA
GTCTCATATCCTGCATGTCACGGAATCTGGAGGTATTGGGCACCGCCATT
AGAGCGTTCCCGATTAGCAACAATAGCATTTTGCGGTTCATACGCTGGAG
CGGTTCTAGGACTGTTTCTCTCTGGTTTACTCACAGATAATCTTGGATGG
CAGGCGCCATTTTATTTCTATGGAATAATTGGAATTTGTTGGGGTATAAC
ATGGTTTACTAACATTTATGAAAAGCCGGCCGTTCATCCTTATATCACTG
ATGACGAAAGAATCTACATAGAAGGAACACTAGCAGAAGGATCAGGTTCA
GATGCGAATATTCCAATTCCCTGGCGAAGGATATTCACTTCTATGCCAGT
TTATGCGATAATTGTGGCAAACTTTGCTAGGAGTTGGTCGTTTTATCTCC
TCATAATCAAAACTCCGAAATACTTGCATGACCTATTGAAACAAAATCTA
ACCCAAGTTGGGGCTTTATCAGCTCTTCCACATTTGGTAATGGCTATCAT
TGTACCAATTGGTGGACAGTTGGCGGACTATTTGCGAAAGAATTATCTGA
CAACAACGGTGGTAAGAAAGATCTTTAACTGTGGAGGTTTTGGAGGAGAG
GCGTTATTTTTATTAGTTGTTGGGTACACACATTCGATTAAAGTTGCTGT
TAGTAGTTTAGTTTTAGCTGTTGGATTTAGTGGCTTCGCTATATCAGGAT
ATAACGTCAATCATCTCGATATCGCTCCGAGATATGCCAGTATTTTAATG
GGTATATCCAATGGCGTTGGAACTCTCAGTGGAATGATTTGTCCGAGTGT
GGTAGAAAATTTCACCAAATCAAAGACTCGCGAATCATGGTCATACGTAT
TCCTAGTTGCCAGTCTGATTCACATAGTAGGAGTTACTTTCTATGCGATA
TTTGCGTCCGGTGAAAAACAGCCATGGGCGGATTTGCCGGAGGACGTAAA
TCCAAATTGGTGTGCTCCTAAAATCGAAGACATTCCTAAAGAAGTCACAG
AATATGACTATGGATATGGCAGCGATCAACCGATTCTTAAGCAGGCGAAC
AATTATAATTCTTTATCCTCGTCTTATAATTCTCCTTATGGCTATGACGC
CCAACAAGAATATGGAATGAACTATAATGATCCAAATCAAAATCCACAAT
ATGTCCAAATTGAAAGGAGGTACAGTCGTAAATCTAGAGATAGTACTGGT
AGTCAAGACAATGATCCTCGAGCATACTAAAAAGAGGTGATCCGCTTCTC
TGTTACAGCAACGGCCAAACTCTCACCTCCCTGCTTCTAGGAGAGAGACA
TGTCTCTGTAAAATCCATTTACATCGCATTGCTGGTATACATATATATAT
GTCGAATTATTATTATTAATATTTCTTTTCGATTAATATTTAAAACTACG
TTTTAAACAAAAAATCTCATTTTTAATTAAAAATTTTGTTTGAAATGAAA
ATAATTAAAT
back to top

protein sequence of SMED30005469-orf-1

>SMED30005469-orf-1 ID=SMED30005469-orf-1|Name=SMED30005469-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=632bp
MALVMKFFGMVLGVFETIKEKFNQSPVSDKAKSGYDSIKKIIMGRKDLQA
NSNMQYDELDEVEQLSSNKKPQKHLFVGPMGRCARMLPWNMSKRYLLAWM
SSFGFMVSFGIRCNISYAMVDMSNDDNITFTNHSKPLIIHSSMKPSFVWS
LGKKSLVDGSFFFGYLFTQIPGGIIANKFPATRVFGFAVCSTSCLNLLLP
GALKAHYALVMIVRILQGLVEGVSYPACHGIWRYWAPPLERSRLATIAFC
GSYAGAVLGLFLSGLLTDNLGWQAPFYFYGIIGICWGITWFTNIYEKPAV
HPYITDDERIYIEGTLAEGSGSDANIPIPWRRIFTSMPVYAIIVANFARS
WSFYLLIIKTPKYLHDLLKQNLTQVGALSALPHLVMAIIVPIGGQLADYL
RKNYLTTTVVRKIFNCGGFGGEALFLLVVGYTHSIKVAVSSLVLAVGFSG
FAISGYNVNHLDIAPRYASILMGISNGVGTLSGMICPSVVENFTKSKTRE
SWSYVFLVASLIHIVGVTFYAIFASGEKQPWADLPEDVNPNWCAPKIEDI
PKEVTEYDYGYGSDQPILKQANNYNSLSSSYNSPYGYDAQQEYGMNYNDP
NQNPQYVQIERRYSRKSRDSTGSQDNDPRAY*
back to top
Aliases
The feature 'slc17a-1' has the following synonyms
Synonym
slc17a-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 327..531
e-value: 1.2E-27
score: 98.6
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 91..302
e-value: 1.4E-32
score: 114.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 599..631
NoneNo IPR availablePANTHERPTHR11662:SF207VESICULAR GLUTAMATE TRANSPORTER 3coord: 12..549
NoneNo IPR availablePANTHERPTHR11662SODIUM-DEPENDENT PHOSPHATE TRANSPORTERScoord: 12..549
NoneNo IPR availableCDDcd17382MFS_SLC17A6_7_8_VGluTcoord: 98..524
e-value: 0.0
score: 602.407
NoneNo IPR availableTMHMMTMhelixcoord: 407..429
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 468..490
NoneNo IPR availableTMHMMTMhelixcoord: 155..177
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 244..266
NoneNo IPR availableTMHMMTMhelixcoord: 333..355
NoneNo IPR availableTMHMMTMhelixcoord: 502..524
NoneNo IPR availableTMHMMTMhelixcoord: 436..458
NoneNo IPR availableTMHMMTMhelixcoord: 184..203
NoneNo IPR availableTMHMMTMhelixcoord: 275..294
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 106..487
e-value: 2.5E-42
score: 145.1
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 94..528
score: 15.61
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 86..525