Ras-related protein Rab-11A

Overview
NameRas-related protein Rab-11A
Smed IDSMED30005465
Length (bp)827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-11A (SMED30005465) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-11A (SMED30005465) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-11A (SMED30005465) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-11A (SMED30005465) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005465

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005465SMESG000073334.1 Contig1193GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30005465SMESG000073334.1 dd_Smed_v4_867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005465SMESG000073334.1 dd_Smed_v4_867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005465SMESG000073334.1 dd_Smed_v4_867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005465SMESG000073334.1 dd_Smed_v4_867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005465SMESG000073334.1 dd_Smed_v4_867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005465SMESG000073334.1 dd_Smed_v4_867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005465SMESG000073334.1 Contig39860newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005465SMESG000073334.1 Contig39860uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30005465SMESG000073334.1 GU591870smed_ncbi_20200123PMID:21356107
Fernández-Taboada et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB11B (RAB11B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9761])

HSP 1 Score: 323.939 bits (829), Expect = 2.681e-112
Identity = 154/176 (87.50%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB11A (RAB11A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9760])

HSP 1 Score: 320.087 bits (819), Expect = 8.203e-111
Identity = 153/176 (86.93%), Postives = 167/176 (94.89%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SFIETSAL++TNVE AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB11B (RAB11B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9761])

HSP 1 Score: 308.916 bits (790), Expect = 6.229e-107
Identity = 147/168 (87.50%), Postives = 161/168 (95.83%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSA 568
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ 
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTG 171          
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB11A (RAB11A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9760])

HSP 1 Score: 275.789 bits (704), Expect = 3.714e-94
Identity = 131/150 (87.33%), Postives = 142/150 (94.67%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIET 514
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++  +  +T
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNEANVRQT 153          
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB11A (RAB11A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9760])

HSP 1 Score: 275.018 bits (702), Expect = 5.880e-94
Identity = 131/145 (90.34%), Postives = 139/145 (95.86%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNI 499
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE + I
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEIYRI 148          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: rab-11.1 (Ras-related protein rab-11.1 [Source:UniProtKB/Swiss-Prot;Acc:O01803])

HSP 1 Score: 315.079 bits (806), Expect = 3.038e-109
Identity = 154/197 (78.17%), Postives = 174/197 (88.32%), Query Frame = 2
Query:   62 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPS 652
            +RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+++EGKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD NIVIMLVGNKSDLRHLR+VP ++AK +AER+ +SFIETSAL++TNVE AF  IL+ IY+ VS +  + +   G+   +  IIPS
Sbjct:    3 SRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRAVPTDEAKIYAERNQLSFIETSALDSTNVEAAFTNILTEIYKSVSNK-HVGTDRQGYGGGSGTIIPS 198          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: rab-11.1 (Ras-related protein rab-11.1 [Source:UniProtKB/Swiss-Prot;Acc:O01803])

HSP 1 Score: 315.079 bits (806), Expect = 3.038e-109
Identity = 154/197 (78.17%), Postives = 174/197 (88.32%), Query Frame = 2
Query:   62 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPS 652
            +RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+++EGKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD NIVIMLVGNKSDLRHLR+VP ++AK +AER+ +SFIETSAL++TNVE AF  IL+ IY+ VS +  + +   G+   +  IIPS
Sbjct:    3 SRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRAVPTDEAKIYAERNQLSFIETSALDSTNVEAAFTNILTEIYKSVSNK-HVGTDRQGYGGGSGTIIPS 198          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: rab-11.2 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q1ZXR4])

HSP 1 Score: 254.603 bits (649), Expect = 1.454e-85
Identity = 128/210 (60.95%), Postives = 162/210 (77.14%), Query Frame = 2
Query:   71 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPSLDDTMRNSNGKRTAVP 700
            +EY YLFK+VLIG+ GVGKSNLLSRFTRNEFNL+SK TIGVEFAT+ +++EGK +K QIWDTAG ER+R   S+YYRGA+GALLVYDI KH TYE+VE+WLK LRDHA+ +IVI LVGNKSDL H  +VP ++AK +AER++ISFIETSAL+ TNVE AF  I++ IY++VS++         +K ++  IIPS   T  N+   +   P
Sbjct:    3 NEYYYLFKIVLIGNPGVGKSNLLSRFTRNEFNLKSKPTIGVEFATKIISVEGKAVKVQIWDTAGMERFRCGASSYYRGALGALLVYDISKHKTYESVEQWLKVLRDHANEDIVITLVGNKSDLSH--AVPTDEAKIYAERNHISFIETSALDNTNVEAAFTNIVTEIYKLVSEK---------YKDHSGTIIPS---TASNTPKNQCCFP 198          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3824947:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 201.445 bits (511), Expect = 1.740e-64
Identity = 97/171 (56.73%), Postives = 122/171 (71.35%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R VTI+GK IK QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H++SN+VIML+GNKSDL   R V RE+ +AFA  H + F+ETSA  A NVE+AFI     IYR + +
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQE 173          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3822883:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 201.83 bits (512), Expect = 1.781e-64
Identity = 97/171 (56.73%), Postives = 122/171 (71.35%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R VTI+GK IK QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H++SN+VIML+GNKSDL   R V RE+ +AFA  H + F+ETSA  A NVE+AFI     IYR + +
Sbjct:   12 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQE 182          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab11 (gene:FBgn0015790 transcript:FBtr0084011)

HSP 1 Score: 319.701 bits (818), Expect = 6.199e-111
Identity = 160/197 (81.22%), Postives = 173/197 (87.82%), Query Frame = 2
Query:   62 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ---RPPMESAPIGHKLNTQPI 643
            AR+DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWL+ELRDHAD NIVIMLVGNKSDLRHLRSVP ++AK FAER+ +SFIETSAL++TNVE AF  IL+ IYRIVSQ   R P E   I    N +PI
Sbjct:    3 AREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVI-RPSNVEPI 198          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab11 (gene:FBgn0015790 transcript:FBtr0084010)

HSP 1 Score: 319.701 bits (818), Expect = 6.199e-111
Identity = 160/197 (81.22%), Postives = 173/197 (87.82%), Query Frame = 2
Query:   62 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ---RPPMESAPIGHKLNTQPI 643
            AR+DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWL+ELRDHAD NIVIMLVGNKSDLRHLRSVP ++AK FAER+ +SFIETSAL++TNVE AF  IL+ IYRIVSQ   R P E   I    N +PI
Sbjct:    3 AREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVI-RPSNVEPI 198          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab2 (gene:FBgn0014009 transcript:FBtr0336658)

HSP 1 Score: 197.593 bits (501), Expect = 6.137e-63
Identity = 101/196 (51.53%), Postives = 131/196 (66.84%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRP-PMESAPIGHKLNTQ--PIIPSL 655
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R +TI+GK IK QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H++SN+VIML+GNKSDL   R V +E+ +AFA  H + F+ETSA  A NVE+AFI     IY  + +    + +   G K+  Q  P  PSL
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSL 198          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab2 (gene:FBgn0014009 transcript:FBtr0086124)

HSP 1 Score: 197.593 bits (501), Expect = 6.137e-63
Identity = 101/196 (51.53%), Postives = 131/196 (66.84%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRP-PMESAPIGHKLNTQ--PIIPSL 655
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R +TI+GK IK QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H++SN+VIML+GNKSDL   R V +E+ +AFA  H + F+ETSA  A NVE+AFI     IY  + +    + +   G K+  Q  P  PSL
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSL 198          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0343678)

HSP 1 Score: 186.037 bits (471), Expect = 2.182e-58
Identity = 85/171 (49.71%), Postives = 119/171 (69.59%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            Y+Y+FK ++IGD GVGKS LL +FT  +F      TIGVEF TR + ++ K IK QIWDTAGQER+RA+T +YYRGA GAL+VYDI + +TY ++  WL + R+  + + VI L+GNKSDL   R V  E+AK FA+ + + F+E SA+   NVE+AF++    IY+ + +
Sbjct:    8 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQE 178          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11ba (RAB11B, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-040426-2860])

HSP 1 Score: 324.324 bits (830), Expect = 1.529e-112
Identity = 159/203 (78.33%), Postives = 180/203 (88.67%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ-----RPPMESAPIGHKLNTQPIIPSLD 658
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ     RP  + +P G+ +    + P+ D
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQMVDRPGHDESP-GNNVVDISVPPTTD 205          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11bb (RAB11B, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-040718-293])

HSP 1 Score: 322.013 bits (824), Expect = 1.026e-111
Identity = 153/180 (85.00%), Postives = 170/180 (94.44%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPME 604
            RDDEYD+LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+   E
Sbjct:    4 RDDEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIAE 183          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11al (RAB11a, member RAS oncogene family, like [Source:ZFIN;Acc:ZDB-GENE-031118-188])

HSP 1 Score: 320.087 bits (819), Expect = 5.050e-111
Identity = 158/212 (74.53%), Postives = 181/212 (85.38%), Query Frame = 2
Query:   62 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPSLDDTMRNSNGKRTAV 697
             R+DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ +EGKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYEN ERWLKEL+DHADSNIVIMLVGNKSDLRHLR+VP ++AKAFAE+H +SF+ETSAL+++NVE AF  IL+ IYRIVSQR        G   +++ ++P      +NS GK++A 
Sbjct:    3 GREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIHVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWLKELQDHADSNIVIMLVGNKSDLRHLRAVPMDEAKAFAEKHGLSFLETSALDSSNVELAFQTILTEIYRIVSQRQMSGRGDDGFSPSSK-VVPITVQPTQNS-GKQSAC 212          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11a (RAB11a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-041114-53])

HSP 1 Score: 320.087 bits (819), Expect = 6.342e-111
Identity = 151/176 (85.80%), Postives = 167/176 (94.89%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SF+ETSAL++TNVE AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11a (RAB11a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-041114-53])

HSP 1 Score: 320.087 bits (819), Expect = 6.342e-111
Identity = 151/176 (85.80%), Postives = 167/176 (94.89%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SF+ETSAL++TNVE AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: hivep3 (HIVEP zinc finger 3 [Source:Xenbase;Acc:XB-GENE-482557])

HSP 1 Score: 325.479 bits (833), Expect = 7.453e-113
Identity = 158/203 (77.83%), Postives = 180/203 (88.67%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ-----RPPMESAPIGHKLNTQPIIPSLD 658
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE++F  IL+ IYRIVSQ     R   E +P G+ +    + P++D
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEESFKNILTEIYRIVSQKQMADRAAHEDSP-GNNVVDISVTPTMD 205          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: lrrc8a (leucine rich repeat containing 8 VRAC subunit A [Source:Xenbase;Acc:XB-GENE-1012024])

HSP 1 Score: 324.709 bits (831), Expect = 1.391e-112
Identity = 154/177 (87.01%), Postives = 170/177 (96.05%), Query Frame = 2
Query:   62 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    3 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: rab11a (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:549235])

HSP 1 Score: 315.464 bits (807), Expect = 4.600e-109
Identity = 151/175 (86.29%), Postives = 165/175 (94.29%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+ IVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SFIETSAL++TNVE AF  IL+ IYRIVSQ
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNKIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQ 178          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: hivep3 (HIVEP zinc finger 3 [Source:Xenbase;Acc:XB-GENE-482557])

HSP 1 Score: 307.375 bits (786), Expect = 2.065e-106
Identity = 145/168 (86.31%), Postives = 161/168 (95.83%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSA 568
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE++F  IL+ 
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEESFKNILTG 171          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: lrrc8a (leucine rich repeat containing 8 VRAC subunit A [Source:Xenbase;Acc:XB-GENE-1012024])

HSP 1 Score: 305.834 bits (782), Expect = 3.607e-105
Identity = 148/187 (79.14%), Postives = 171/187 (91.44%), Query Frame = 2
Query:   32 RKLIITIITMARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RK+++++ T     E +Y+F  VLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    2 RKILLSLFTC----ETEYVF--VLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 182          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab11b (RAB11B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:99425])

HSP 1 Score: 323.553 bits (828), Expect = 2.528e-112
Identity = 154/176 (87.50%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab11a (RAB11A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1858202])

HSP 1 Score: 320.087 bits (819), Expect = 5.632e-111
Identity = 153/176 (86.93%), Postives = 167/176 (94.89%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SFIETSAL++TNVE AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab11a (RAB11A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1858202])

HSP 1 Score: 275.789 bits (704), Expect = 2.516e-94
Identity = 131/150 (87.33%), Postives = 142/150 (94.67%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIET 514
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++  +  +T
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNEANVRQT 153          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab11a (RAB11A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1858202])

HSP 1 Score: 275.018 bits (702), Expect = 4.037e-94
Identity = 131/145 (90.34%), Postives = 139/145 (95.86%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNI 499
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE + I
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEIYRI 148          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab11b (RAB11B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:99425])

HSP 1 Score: 273.863 bits (699), Expect = 9.823e-94
Identity = 130/142 (91.55%), Postives = 138/142 (97.18%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAER 490
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEQ 145          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|O35509|RB11B_RAT (Ras-related protein Rab-11B OS=Rattus norvegicus OX=10116 GN=Rab11b PE=1 SV=4)

HSP 1 Score: 323.939 bits (829), Expect = 1.287e-111
Identity = 154/176 (87.50%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|Q15907|RB11B_HUMAN (Ras-related protein Rab-11B OS=Homo sapiens OX=9606 GN=RAB11B PE=1 SV=4)

HSP 1 Score: 323.939 bits (829), Expect = 1.287e-111
Identity = 154/176 (87.50%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|Q3MHP2|RB11B_BOVIN (Ras-related protein Rab-11B OS=Bos taurus OX=9913 GN=RAB11B PE=2 SV=3)

HSP 1 Score: 323.939 bits (829), Expect = 1.287e-111
Identity = 154/176 (87.50%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|P46638|RB11B_MOUSE (Ras-related protein Rab-11B OS=Mus musculus OX=10090 GN=Rab11b PE=1 SV=3)

HSP 1 Score: 323.553 bits (828), Expect = 1.768e-111
Identity = 154/176 (87.50%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|P22129|RB11B_DIPOM (Ras-related protein Rab-11B OS=Diplobatis ommata OX=1870830 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 2.893e-111
Identity = 153/176 (86.93%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: A0A162CY40 (Ras-related protein Rab-11A OS=Daphnia magna OX=35525 GN=APZ42_012229 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 8.575e-113
Identity = 168/215 (78.14%), Postives = 181/215 (84.19%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRP----PMESAPIGHKLNTQPIIPSLDDTMRNSNGKRTAV 697
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD NIVIMLVGNKSDLRHLRSVP ++A+AFAERH++SFIETSAL+ TNVE AF  IL+ IYRIVSQRP    P E +P G   N+ PI   +  T  NS  K    
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRSVPTDEARAFAERHSLSFIETSALDCTNVETAFHNILTEIYRIVSQRPMHDSPDEDSPPG---NSGPI--QISPTEPNSGSKSNCC 213          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: E9GJA1 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_304112 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.329e-112
Identity = 164/197 (83.25%), Postives = 176/197 (89.34%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRP----PMESAPIGHKLNTQPI 643
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD NIVIMLVGNKSDLRHLRSVP ++A+AFAERH++SFIETSAL+ TNVE AF  IL+ IYRIVSQRP    P E +P G   N+ PI
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRSVPTDEARAFAERHSLSFIETSALDCTNVETAFHNILTEIYRIVSQRPMHDSPDEDSPPG---NSGPI 197          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: A0A1C9TA77 (Ras-related protein Rab-11-like protein OS=Saccoglossus kowalevskii OX=10224 PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.586e-111
Identity = 163/209 (77.99%), Postives = 183/209 (87.56%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKL---NTQP--IIPSLDDTMRNS 676
            +DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++AKAFAE++N+SFIETSAL++TNVE AF  IL+ IYRIVSQ+   + +     L   NT+P  I P+ DDT + S
Sbjct:    4 KDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEAKAFAEKNNLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRQGSGEQDDLKTDNTKPIHIAPTEDDTRKKS 212          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: A0A1S3J7B9 (ras-related protein Rab-11A OS=Lingula unguis OX=7574 GN=LOC106170712 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 2.427e-111
Identity = 158/202 (78.22%), Postives = 179/202 (88.61%), Query Frame = 2
Query:   59 MARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR----PPMESAPIGHKLNTQPIIPS 652
            MA+DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++AKAFAE+HN+SFIETSAL++TNVE AF  IL+ IY+IVSQ+     P +   + + + T  + P+
Sbjct:    1 MAKDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEAKAFAEKHNLSFIETSALDSTNVEAAFQNILTEIYKIVSQKQIRDSPDDDNTLSNDVRTIQVAPT 202          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: Q6XP57 (Rab11-2 OS=Limulus polyphemus OX=6850 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 5.672e-110
Identity = 158/197 (80.20%), Postives = 176/197 (89.34%), Query Frame = 2
Query:   62 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ---RPPMESAPIGHKLNTQPI 643
            ++DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE AF QIL+ IYRIVSQ   R   ++ P     N +PI
Sbjct:    3 SKDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVESAFQQILTEIYRIVSQKQIRNDTDNDPSPSGDNVKPI 199          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: rab11bb (ras-related protein Rab-11B [Source:NCBI gene;Acc:111194513])

HSP 1 Score: 321.242 bits (822), Expect = 1.870e-111
Identity = 152/176 (86.36%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYD+LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: ENSAMXT00000055778.1 (ras-related protein Rab-11B [Source:NCBI gene;Acc:103047600])

HSP 1 Score: 320.472 bits (820), Expect = 4.112e-111
Identity = 152/176 (86.36%), Postives = 169/176 (96.02%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++++SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNSLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: rab11a (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:103028965])

HSP 1 Score: 318.546 bits (815), Expect = 1.892e-110
Identity = 151/176 (85.80%), Postives = 167/176 (94.89%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SF+ETSAL++TNVE AF  IL+ IYRIVSQ+
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVSQK 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: rab11bb (ras-related protein Rab-11B [Source:NCBI gene;Acc:111194513])

HSP 1 Score: 280.411 bits (716), Expect = 1.689e-95
Identity = 138/174 (79.31%), Postives = 156/174 (89.66%), Query Frame = 2
Query:   71 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            ++Y YLF      DS    SNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+
Sbjct:    6 NQYVYLF-----SDS----SNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQK 170          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: rab11al (RAB11a, member RAS oncogene family, like [Source:ZFIN;Acc:ZDB-GENE-031118-188])

HSP 1 Score: 272.322 bits (695), Expect = 2.354e-92
Identity = 130/158 (82.28%), Postives = 145/158 (91.77%), Query Frame = 2
Query:   95 VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSA 568
            VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ +EGKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYEN ERWLKEL+DHADSNIVIMLVGNKSDLRHLR+VP ++AK   ++H +SF+ETSAL+++NVE AF  IL+ 
Sbjct:   16 VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWLKELQDHADSNIVIMLVGNKSDLRHLRAVPTDEAKHL-QKHGLSFLETSALDSSNVELAFQTILTG 172          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: rab11ba (RAB11B, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-040426-2860])

HSP 1 Score: 295.819 bits (756), Expect = 2.429e-102
Identity = 143/165 (86.67%), Postives = 153/165 (92.73%), Query Frame = 2
Query:   95 VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGA GALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+V  ++AKAFAE H +SFIETSAL++TNVE AFI IL+ IYR VSQ
Sbjct:    1 VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAYGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVTTDEAKAFAENHGLSFIETSALDSTNVESAFITILTEIYRTVSQ 165          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 199.134 bits (505), Expect = 3.272e-64
Identity = 94/171 (54.97%), Postives = 122/171 (71.35%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R +TI+GK +K QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H++SN+VIML+GNKSDL   R V RE+ +AFA  H + F+ETSA  A+NVE+AFI     IY  + +
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTASNVEEAFINTAKEIYEKIQE 173          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 194.512 bits (493), Expect = 1.094e-62
Identity = 92/167 (55.09%), Postives = 118/167 (70.66%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYR 577
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R + I+GK +K QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H+ SN++IML+GNKSDL   R V RE+ +AFA  H + F+ETSA  A NVE+AFI     IY+
Sbjct:    8 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMIIMLIGNKSDLESRRDVKREEGEAFAREHGLVFMETSAKTAANVEEAFINTAKEIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 191.815 bits (486), Expect = 2.806e-61
Identity = 92/171 (53.80%), Postives = 118/171 (69.01%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R + I GK +K QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H++SN+VIML+GNKSDL   R V  E+ +AFA  H + F+ETSA  A NVE+AFI     IY  + +
Sbjct:    8 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHSNSNMVIMLIGNKSDLESRREVKCEEGEAFAREHGLVFMETSAKTAANVEEAFINTAREIYEKIQE 178          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002219.1 (pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene:ENSPMAG00000002006.1 transcript:ENSPMAT00000002219.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 5.145e-59
Identity = 85/167 (50.90%), Postives = 116/167 (69.46%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYR 577
            Y Y+FK ++IGD GVGKS LL +FT  +F  +   TIGVEF TR + + G+ +K QIWDTAGQER+RA+T +YYRGA GAL+VYDI + +TY ++  WL + R+  + N VI L+GNK+DL   R V  E+AK FAE + + F+E SA    NVE+AF++    IY+
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGDNVEEAFLETAKKIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 257.684 bits (657), Expect = 3.339e-87
Identity = 124/210 (59.05%), Postives = 159/210 (75.71%), Query Frame = 2
Query:   74 EYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPSLDDTMRNSNGKRTAVPN 703
            +YD LFK+VLIGDSGVGKSNLLSRFT+NEFN++SKSTIGVEFATR++ I+GK IKAQIWDTAGQERYRAITSAYYRGAVGAL+VYDI K ++YEN   WL ELR++AD N+ + L+GNKSDL HLR+VP E++K FA+ + + F ETSAL + NV+ AF ++++ IY+ VS+          H+++       L D+  N N    + PN
Sbjct:    9 DYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSK----------HQMD-------LGDSSANGNANGASAPN 201          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 253.832 bits (647), Expect = 1.038e-85
Identity = 127/221 (57.47%), Postives = 162/221 (73.30%), Query Frame = 2
Query:   59 MARDD---EYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRP-----------PMESAPIGHKLNTQPIIPSLDDTMRNSN 679
            M+ +D   +YDYLFK+VLIGDSGVGKSNLLSRFT +EFN+ESKSTIGVEFATR++ +E K IKAQIWDTAGQERYRAITSAYYRGAVGAL+VYDI K ++YEN   WL ELR++AD N+ + L+GNKSDL HLR+VP ++AK FA  + + F ETSAL + NV+ AF +++ AI+++VS+                 AP G  ++  P  P  D   ++SN
Sbjct:    1 MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTP-APKEDKKKKSSN 220          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 189.119 bits (479), Expect = 1.419e-60
Identity = 89/180 (49.44%), Postives = 130/180 (72.22%), Query Frame = 2
Query:   74 EYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAP 613
            EYDYLFK++LIG+SGVGKS LL RF+ + +  +  STIGV+F  ++V ++GKT+K QIWDTAGQER+R ITS+YYRG+ G ++VYD+    ++  V+ WL+E+  +A S ++ +LVGNK DL+  R V  + AK FA+ + + F+ETSAL++TNVEDAF+ +   I   +SQ+   E+  
Sbjct:    4 EYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQ 183          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 165.236 bits (417), Expect = 3.775e-51
Identity = 78/165 (47.27%), Postives = 111/165 (67.27%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAI 571
            YD + K++LIGDSGVGKS LL RF  ++FN    +TIG++F  ++V I GK +K Q+WDTAGQER+R IT+AYYRGA+G +LVYD+    T+ N+++W K + +HA+    ++LVGNKSD+   R V  +  +A A+   I FIE+SA    NV + F  +   I
Sbjct:   17 YDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM-ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLI 180          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 138.658 bits (348), Expect = 7.076e-41
Identity = 70/159 (44.03%), Postives = 98/159 (61.64%), Query Frame = 2
Query:   92 KVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRH---LRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQI 559
            K+VL+G++ VGKS+++ RF  N+F    + TIG  F T+ VTI   T+K +IWDTAGQER+ ++   YYR A  AL+VYD+ K  ++     W+KEL + A  +I+I LVGNK D+      R V RE+ +  AE   + F ETSA    NV D F+ I
Sbjct:    9 KLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGI 167          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO33171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST02])

HSP 1 Score: 321.242 bits (822), Expect = 6.326e-112
Identity = 157/204 (76.96%), Postives = 177/204 (86.76%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR-----PPMESAPIGHKLNTQPIIPSLDD 661
            +DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++AKAFAE++ +SFIETSAL++TNVE AF  IL+ IY IVSQ+     P  + +   + + T  + P+ DD
Sbjct:    4 KDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEAKAFAEKNGLSFIETSALDSTNVEVAFHNILTEIYHIVSQKQIHDSPSSDGSHPSNNVQTIHVAPTTDD 207          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO33074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST94])

HSP 1 Score: 267.314 bits (682), Expect = 1.176e-90
Identity = 120/173 (69.36%), Postives = 150/173 (86.71%), Query Frame = 2
Query:   62 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRI 580
             R D YDYL+K+VLIGDSGVGKS+LLSRFTRNEF++ESKSTIGVEFATRS+ +EGK IKAQ+WDTAGQERYRAITSAYYRGAVGA+LVYD+ K  T+++VERWL E+R+HAD  IV+MLVGNK DL+HLR+V  +DAK + + H ++FIE SAL+ATNVE+AF Q ++ ++ +
Sbjct:    4 GRYDHYDYLYKIVLIGDSGVGKSSLLSRFTRNEFDIESKSTIGVEFATRSIQVEGKIIKAQVWDTAGQERYRAITSAYYRGAVGAVLVYDLTKQKTFQDVERWLLEVREHADPTIVVMLVGNKCDLKHLRAVASDDAKKYGDEHGLAFIEASALDATNVEEAFQQTITKLHHV 176          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO49117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU7])

HSP 1 Score: 242.662 bits (618), Expect = 1.112e-80
Identity = 120/211 (56.87%), Postives = 154/211 (72.99%), Query Frame = 2
Query:   68 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPII--PSLDDTMRNSNGKRTA 694
            +D YDYLFK+VLIGDSGVGKSNLLSR+T+NEF+L SK+TIGVE A R+V IEGKT++AQIWDTAGQERYRAITSAYYRGA+GA+LVYDI K  ++ N+ +W++ELR HA  ++ I+L+GNKSDL+HLR +     K FA  H + F+ETSAL++TNV +AF  I + I+  V Q    +S     K N + I+    L +     NGK  A
Sbjct:   12 EDNYDYLFKIVLIGDSGVGKSNLLSRYTKNEFHLGSKATIGVELAHRNVEIEGKTVRAQIWDTAGQERYRAITSAYYRGAMGAVLVYDIAKGTSFMNLNKWVEELRQHASDDLSIILIGNKSDLKHLRMIENRRGKQFAAEHGMLFMETSALDSTNVAEAFEFIFAHIFDKVRQNELEKSGQAHEKPNGESIVIKAELAELPATPNGKEHA 222          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO36687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU3])

HSP 1 Score: 197.208 bits (500), Expect = 4.297e-63
Identity = 94/171 (54.97%), Postives = 121/171 (70.76%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R +TI+GK IK QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H+ SN+VIML+GNKSDL   R V +E+ +AFA  H + F+ETSA  A NVE+AFI     IY+ + +
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMVIMLIGNKSDLEARRDVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYQKIQE 173          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO43319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ04])

HSP 1 Score: 188.734 bits (478), Expect = 9.785e-60
Identity = 88/167 (52.69%), Postives = 115/167 (68.86%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYR 577
            Y Y+FK ++IGD GVGKS LL +FT  +F  +   TIGVEF TR + + G+ IK QIWDTAGQER+RA+T +YYRGA GAL+VYDI + +TY ++  WL + R+  + N VI L+GNKSDL   R V  E+AK FAE + + F E SA    NVEDAF++    IY+
Sbjct:    9 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKSDLDAQRDVTYEEAKQFAEENGLLFCEASAKTGENVEDAFLETAKKIYQ 175          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: rab11ba (ras-related protein Rab-11B [Source:NCBI gene;Acc:101160399])

HSP 1 Score: 322.013 bits (824), Expect = 7.746e-112
Identity = 154/176 (87.50%), Postives = 168/176 (95.45%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SFIETSAL++TNVE+AF  IL+ IYRIVSQR
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVSQR 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: rab11bb (ras-related protein Rab-11B [Source:NCBI gene;Acc:101156358])

HSP 1 Score: 322.013 bits (824), Expect = 1.052e-111
Identity = 153/180 (85.00%), Postives = 170/180 (94.44%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPME 604
            RDDEYD+LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHAD+NIVIMLVGNKSDLRHLR+VP ++A+AFAE++N+SFIETSAL++TNVE+AF  IL+ IYRIVSQ+   E
Sbjct:    4 RDDEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIAE 183          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: RAB11A (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:101157275])

HSP 1 Score: 320.472 bits (820), Expect = 3.524e-111
Identity = 155/196 (79.08%), Postives = 174/196 (88.78%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ-----RPPMESAPIGHKLNTQ 637
            RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SF+ETSAL++TNVE AF  IL+ IYRIVSQ     R   + +P  + +N Q
Sbjct:    4 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVSQKQMSERQESDMSPSNNVVNIQ 199          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: rab11al (ras-related protein Rab-11A [Source:NCBI gene;Acc:101171030])

HSP 1 Score: 318.161 bits (814), Expect = 2.423e-110
Identity = 150/176 (85.23%), Postives = 166/176 (94.32%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            R+DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ +EGKT+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYEN ERWLKEL+DHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE+H +SF+ETSAL+++NVE AF  IL+AIY IVSQR
Sbjct:    4 REDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWLKELQDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKHGLSFLETSALDSSNVELAFQTILTAIYNIVSQR 179          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: ENSORLT00000019146.2 (ras-related protein Rab-11B [Source:NCBI gene;Acc:101159906])

HSP 1 Score: 319.701 bits (818), Expect = 1.086e-109
Identity = 151/176 (85.80%), Postives = 168/176 (95.45%), Query Frame = 2
Query:   65 RDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQR 592
            RDDEYD+LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRS+ ++GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI KH TYENVERWLKELRDHADSNIVIMLVGNKSDLRHLR+VP ++A+AFAE++ +SFIETSAL++TNVE+AF  +L+ IYRIVSQ+
Sbjct:   87 RDDEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNVLTEIYRIVSQK 262          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000073334.1 (SMESG000073334.1)

HSP 1 Score: 433.721 bits (1114), Expect = 3.687e-156
Identity = 209/213 (98.12%), Postives = 210/213 (98.59%), Query Frame = 2
Query:   59 MARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPSLDDTMRNSNGKRTAV 697
            MARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPSLDDTMRNSNGK+   
Sbjct:    1 MARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPSLDDTMRNSNGKKNCC 213          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000023556.1 (SMESG000023556.1)

HSP 1 Score: 313.538 bits (802), Expect = 1.393e-108
Identity = 152/202 (75.25%), Postives = 177/202 (87.62%), Query Frame = 2
Query:   59 MARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRP---PMESAPIGHKLNTQPIIPSL 655
            M++DDEYD+LFK+VLIGDSG GKSNLLSRFTRNEFNLESKSTIGVEFATRSV I+GKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDI K ++++N ERWL+ELRDHADS+ V+ LVGNK DLRHLR+V ++DA+ +AE+ +I F+ETSAL+ATNVE+AF QILS+IYRIVSQ P   P  +A   H  +TQPII SL
Sbjct:    1 MSKDDEYDFLFKIVLIGDSGTGKSNLLSRFTRNEFNLESKSTIGVEFATRSVHIDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKQSSFQNKERWLQELRDHADSSTVVTLVGNKVDLRHLRAVGKQDAQVYAEQQDIYFLETSALDATNVEEAFTQILSSIYRIVSQNPSINPNYNATENH--HTQPIISSL 200          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000016036.1 (SMESG000016036.1)

HSP 1 Score: 205.682 bits (522), Expect = 3.576e-66
Identity = 88/174 (50.57%), Postives = 136/174 (78.16%), Query Frame = 2
Query:   59 MARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRI 580
            M++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ V +EGK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+ K +++ N+ RWLK ++D+     VI L+GNK+DL + R V  E+AK +A+ + + ++ETSA  + NVE AFI++++ +Y++
Sbjct:    1 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKL 173          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000076159.1 (SMESG000076159.1)

HSP 1 Score: 200.675 bits (509), Expect = 3.184e-64
Identity = 95/171 (55.56%), Postives = 121/171 (70.76%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQ 589
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R +TI+GK +K QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T+ ++  WL++ R H+ SN+VIML+GNKSDL   R V RE+ +AFA  H + F+ETSA  A NVE+AFI    AIY  + +
Sbjct:    3 YSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSSSNMVIMLIGNKSDLEARRDVKREEGEAFAREHGLVFMETSAKTAANVEEAFINTAKAIYEKIQE 173          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000017457.1 (SMESG000017457.1)

HSP 1 Score: 199.904 bits (507), Expect = 6.239e-64
Identity = 94/166 (56.63%), Postives = 121/166 (72.89%), Query Frame = 2
Query:   77 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIY 574
            Y YLFK ++IGD+GVGKS LL +FT   F      TIGVEF  R +TI+GK +K QIWDTAGQE +R+IT +YYRGA GALLVYDI +  T++++  WL++ R H+ SN+VIML+GNKSDL + R V RE+ ++FA  H + F+ETSA  A NVE+AFI    AIY
Sbjct:    3 YSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFDHLTTWLEDARQHSSSNMVIMLIGNKSDLENRRDVKREEGESFAHEHGLVFMETSAKTALNVEEAFINTAKAIY 168          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB11B2.681e-11287.50RAB11B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB11A8.203e-11186.93RAB11A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB11B6.229e-10787.50RAB11B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB11A3.714e-9487.33RAB11A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB11A5.880e-9490.34RAB11A, member RAS oncogene family [Source:HGNC Sy... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-11.13.038e-10978.17Ras-related protein rab-11.1 [Source:UniProtKB/Sw... [more]
rab-11.13.038e-10978.17Ras-related protein rab-11.1 [Source:UniProtKB/Sw... [more]
rab-11.21.454e-8560.95RAB family [Source:UniProtKB/TrEMBL;Acc:Q1ZXR4][more]
unc-1081.740e-6456.73pep chromosome:WBcel235:I:3824947:3826514:1 gene:W... [more]
unc-1081.781e-6456.73pep chromosome:WBcel235:I:3822883:3826514:1 gene:W... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab116.199e-11181.22gene:FBgn0015790 transcript:FBtr0084011[more]
Rab116.199e-11181.22gene:FBgn0015790 transcript:FBtr0084010[more]
Rab26.137e-6351.53gene:FBgn0014009 transcript:FBtr0336658[more]
Rab26.137e-6351.53gene:FBgn0014009 transcript:FBtr0086124[more]
Rab142.182e-5849.71gene:FBgn0015791 transcript:FBtr0343678[more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11ba1.529e-11278.33RAB11B, member RAS oncogene family, a [Source:ZFIN... [more]
rab11bb1.026e-11185.00RAB11B, member RAS oncogene family, b [Source:ZFIN... [more]
rab11al5.050e-11174.53RAB11a, member RAS oncogene family, like [Source:Z... [more]
rab11a6.342e-11185.80RAB11a, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab11a6.342e-11185.80RAB11a, member RAS oncogene family [Source:ZFIN;Ac... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hivep37.453e-11377.83HIVEP zinc finger 3 [Source:Xenbase;Acc:XB-GENE-48... [more]
lrrc8a1.391e-11287.01leucine rich repeat containing 8 VRAC subunit A [S... [more]
rab11a4.600e-10986.29RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
hivep32.065e-10686.31HIVEP zinc finger 3 [Source:Xenbase;Acc:XB-GENE-48... [more]
lrrc8a3.607e-10579.14leucine rich repeat containing 8 VRAC subunit A [S... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab11b2.528e-11287.50RAB11B, member RAS oncogene family [Source:MGI Sym... [more]
Rab11a5.632e-11186.93RAB11A, member RAS oncogene family [Source:MGI Sym... [more]
Rab11a2.516e-9487.33RAB11A, member RAS oncogene family [Source:MGI Sym... [more]
Rab11a4.037e-9490.34RAB11A, member RAS oncogene family [Source:MGI Sym... [more]
Rab11b9.823e-9491.55RAB11B, member RAS oncogene family [Source:MGI Sym... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35509|RB11B_RAT1.287e-11187.50Ras-related protein Rab-11B OS=Rattus norvegicus O... [more]
sp|Q15907|RB11B_HUMAN1.287e-11187.50Ras-related protein Rab-11B OS=Homo sapiens OX=960... [more]
sp|Q3MHP2|RB11B_BOVIN1.287e-11187.50Ras-related protein Rab-11B OS=Bos taurus OX=9913 ... [more]
sp|P46638|RB11B_MOUSE1.768e-11187.50Ras-related protein Rab-11B OS=Mus musculus OX=100... [more]
sp|P22129|RB11B_DIPOM2.893e-11186.93Ras-related protein Rab-11B OS=Diplobatis ommata O... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A162CY408.575e-11378.14Ras-related protein Rab-11A OS=Daphnia magna OX=35... [more]
E9GJA11.329e-11283.25Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
A0A1C9TA771.586e-11177.99Ras-related protein Rab-11-like protein OS=Saccogl... [more]
A0A1S3J7B92.427e-11178.22ras-related protein Rab-11A OS=Lingula unguis OX=7... [more]
Q6XP575.672e-11080.20Rab11-2 OS=Limulus polyphemus OX=6850 PE=2 SV=1[more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11bb1.870e-11186.36ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
ENSAMXT00000055778.14.112e-11186.36ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
rab11a1.892e-11085.80RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
rab11bb1.689e-9579.31ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
rab11al2.354e-9282.28RAB11a, member RAS oncogene family, like [Source:Z... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11ba2.429e-10286.67RAB11B, member RAS oncogene family, a [Source:ZFIN... [more]
rab2a3.272e-6454.97RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
RAB2B1.094e-6255.09RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2B2.806e-6153.80RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
ENSPMAT00000002219.15.145e-5950.90pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT313.339e-8759.05Rab family GTPase; involved in the exocytic pathwa... [more]
YPT321.038e-8557.47Rab family GTPase involved in the exocytic pathway... [more]
YPT11.419e-6049.44Rab family GTPase; involved in the ER-to-Golgi ste... [more]
SEC43.775e-5147.27Rab family GTPase; essential for vesicle-mediated ... [more]
VPS217.076e-4144.03Endosomal Rab family GTPase; required for endocyti... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO331716.326e-11276.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330741.176e-9069.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491171.112e-8056.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366874.297e-6354.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433199.785e-6052.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11ba7.746e-11287.50ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
rab11bb1.052e-11185.00ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
RAB11A3.524e-11179.08RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
rab11al2.423e-11085.23ras-related protein Rab-11A [Source:NCBI gene;Acc:... [more]
ENSORLT00000019146.21.086e-10985.80ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073334.13.687e-15698.12SMESG000073334.1[more]
SMESG000023556.11.393e-10875.25SMESG000023556.1[more]
SMESG000016036.13.576e-6650.57SMESG000016036.1[more]
SMESG000076159.13.184e-6455.56SMESG000076159.1[more]
SMESG000017457.16.239e-6456.63SMESG000017457.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005465 ID=SMED30005465|Name=Ras-related protein Rab-11A|organism=Schmidtea mediterranea sexual|type=transcript|length=827bp
CGATCTCAGCTGGTTACTTTCAGATCAGTAAAGGAAATTAATTATAACAA
TTATAACAATGGCAAGAGATGATGAATATGACTATCTCTTTAAAGTGGTC
TTGATAGGAGATTCAGGAGTTGGAAAAAGTAATTTATTATCAAGATTCAC
CAGAAATGAATTTAATTTGGAAAGTAAAAGTACGATTGGTGTTGAATTTG
CCACAAGAAGTGTTACGATTGAAGGTAAAACTATTAAAGCACAAATCTGG
GATACTGCAGGCCAAGAGCGTTATAGAGCTATTACTTCAGCGTATTATAG
AGGTGCTGTTGGTGCTCTACTTGTTTATGATATCGTGAAACATGCTACAT
ATGAAAATGTTGAACGGTGGTTGAAAGAACTTCGCGATCACGCAGACTCC
AATATCGTAATCATGTTAGTGGGAAACAAATCGGATTTAAGGCATTTGAG
GTCAGTTCCTCGAGAAGATGCAAAAGCTTTCGCTGAAAGGCATAATATAT
CATTTATTGAGACTTCAGCACTTGAAGCTACAAATGTTGAAGATGCGTTT
ATTCAGATATTGAGTGCCATTTACCGTATCGTTAGTCAACGGCCACCAAT
GGAGTCTGCTCCGATTGGACACAAATTGAATACGCAACCGATTATTCCAT
CACTGGATGATACAATGAGGAACAGTAACGGAAAAAGAACTGCTGTTCCT
AATTGATTCGATTCCGAAATTGTATGGATTGTTTTTGTGACTTGTGTTTA
GTAAAATAAAAAAATAATAATTAACGAAAATAAAACCCGGGTCAATTGAG
TGATCGTAAATTTTCAGAATATTAACG
back to top

protein sequence of SMED30005465-orf-1

>SMED30005465-orf-1 ID=SMED30005465-orf-1|Name=SMED30005465-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
MARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATR
SVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYEN
VERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFI
ETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIGHKLNTQPIIPSLD
DTMRNSNGKRTAVPN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0006898receptor-mediated endocytosis
GO:0009792embryo development ending in birth or egg hatching
GO:0015031protein transport
GO:0030703eggshell formation
GO:0032467positive regulation of cytokinesis
GO:0060471cortical granule exocytosis
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005737cytoplasm
GO:0005768endosome
GO:0005794Golgi apparatus
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030133transport vesicle
GO:0031410cytoplasmic vesicle
GO:0055037recycling endosome
GO:0055038recycling endosome membrane
GO:0060473cortical granule