SMED30005459

Overview
NameSMED30005459
Smed IDSMED30005459
Length (bp)1942
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005459 (SMED30005459) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005459 (SMED30005459) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005459 (SMED30005459) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005459 (SMED30005459) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005459

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005459SMESG000014884.1 Contig46404newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005459SMESG000014884.1 Contig46404uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30005459SMESG000014884.1 dd_Smed_v4_2661_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005459 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002637:4777..15120 +9492
Homology
BLAST of SMED30005459 vs. Ensembl Human
Match: IFIH1 (interferon induced with helicase C domain 1 [Source:HGNC Symbol;Acc:HGNC:18873])

HSP 1 Score: 51.6026 bits (122), Expect = 4.496e-6
Identity = 35/123 (28.46%), Postives = 57/123 (46.34%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNN----------CSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHD 1362
            F CKNC    C   DI V   +H+V +  E F  + I +    + Q KC +          C    G    + G   P +KI+ F +V +N +++ Q +KKW ++P+  P +  +E   FS +
Sbjct:  905 FLCKNCSVLACSGEDIHVIEKMHHVNMTPE-FKELYI-VRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQ-YKKWVELPITFPNLDYSECCLFSDE 1024          
BLAST of SMED30005459 vs. Ensembl Human
Match: IFIH1 (interferon induced with helicase C domain 1 [Source:HGNC Symbol;Acc:HGNC:18873])

HSP 1 Score: 51.6026 bits (122), Expect = 4.531e-6
Identity = 35/123 (28.46%), Postives = 57/123 (46.34%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNN----------CSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHD 1362
            F CKNC    C   DI V   +H+V +  E F  + I +    + Q KC +          C    G    + G   P +KI+ F +V +N +++ Q +KKW ++P+  P +  +E   FS +
Sbjct:  866 FLCKNCSVLACSGEDIHVIEKMHHVNMTPE-FKELYI-VRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQ-YKKWVELPITFPNLDYSECCLFSDE 985          
BLAST of SMED30005459 vs. TrEMBL
Match: G3UQR7 (Interferon induced with helicase C domain 1 OS=Meleagris gallopavo OX=9103 GN=IFIH1 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.316e-7
Identity = 35/114 (30.70%), Postives = 54/114 (47.37%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKI---------EILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSA 1338
            F CKNC + IC   DIRV  N+H+V +  +      I             Q + +I C +C    G+   Y G   P +KI+ F +V E+  +  + FKKW ++P+  P +  A
Sbjct:  879 FLCKNCHKVICSGEDIRVIENMHHVSVKKDFQHLYHIRENRTLQDKHADYQTNVEIICKDCGQPWGNMMVYRGLDLPCLKIRNFVVVFEDKKTTKEIFKKWGELPITFPNLDYA 992          
BLAST of SMED30005459 vs. TrEMBL
Match: A0A093J523 (Interferon-induced helicase C domain-containing protein 1 (Fragment) OS=Fulmarus glacialis OX=30455 GN=N327_11813 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.340e-7
Identity = 35/115 (30.43%), Postives = 58/115 (50.43%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTECFSSM----------KIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSA 1338
            F CKNC + IC   DI+V  N+H+V +  + F S+             +  Q + +I C +C    G+   + G   P +KI+ F +V E+  +  Q FKKW ++P++ P+   A
Sbjct:  796 FLCKNCHKLICSGEDIQVIENMHHVSVKKD-FQSLYHTRENKTLQDKHVDYQTNGEIICKDCGQAWGNMMVHRGLDLPCLKIRNFVVVFEDKKTTKQIFKKWGELPVRFPSFDYA 909          
BLAST of SMED30005459 vs. TrEMBL
Match: G1NEI2 (Interferon induced with helicase C domain 1 OS=Meleagris gallopavo OX=9103 GN=IFIH1 PE=4 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 2.360e-7
Identity = 35/114 (30.70%), Postives = 56/114 (49.12%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTE---CFSSMKIEILN------QNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSA 1338
            F CKNC + IC   DIRV  N+H+V +  +    +   +   L       Q + +I C +C    G+   Y G   P +KI+ F +V E+  +  + FKKW ++P+  P +  A
Sbjct:  884 FLCKNCHKVICSGEDIRVIENMHHVSVKKDFQHLYHIRENRTLQDKHADYQTNVEIICKDCGQPWGNMMVYRGLDLPCLKIRNFVVVFEDKKTTKEIFKKWGELPITFPNLDYA 997          
BLAST of SMED30005459 vs. TrEMBL
Match: A0A091JAB7 (Interferon-induced helicase C domain-containing protein 1 (Fragment) OS=Egretta garzetta OX=188379 GN=Z169_02803 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.609e-7
Identity = 36/115 (31.30%), Postives = 58/115 (50.43%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILN----------QNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSA 1338
            F CKNC + IC   DI+V  N+H+V +  + F S+     N          Q + +I C +C    G+   + G   P +KI+ F +V E+  +  Q FKKW ++P++ P+   A
Sbjct:  809 FLCKNCHKLICSGDDIQVIENMHHVSVKKD-FQSLYHTRENKTLQDKHADYQTNGEIICKDCGQAWGNMMVHRGLDLPCLKIRNFVVVFEDKKTTKQIFKKWGELPIRFPSFDYA 922          
BLAST of SMED30005459 vs. TrEMBL
Match: A0A093BYE3 (Interferon-induced helicase C domain-containing protein 1 OS=Pterocles gutturalis OX=240206 GN=N339_08600 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.943e-7
Identity = 36/115 (31.30%), Postives = 58/115 (50.43%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILN----------QNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSA 1338
            F CKNC + IC   DI+V  N+H+V +  + F S+     N          Q + +I C +C    G+   + G   P +KI+ F +V E+  +  Q FKKW ++P++ P+   A
Sbjct:  878 FLCKNCHKLICSGEDIQVIENMHHVSVKKD-FQSLYHTRENKTLQDKHADYQTNGEIICKDCGQAWGNMMVHRGLDLPCLKIRNFVVVFEDKKTTKQIFKKWGELPVRFPSFDYA 991          
BLAST of SMED30005459 vs. Ensembl Sea Lamprey
Match: DDX58 (DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:19102])

HSP 1 Score: 51.9878 bits (123), Expect = 3.787e-7
Identity = 36/120 (30.00%), Postives = 52/120 (43.33%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQ-------------IKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAEL 1344
             +C  C++ +CKS+DIR+  N HY +I     SS  +E+++    Q             I    C+   G    Y     P IKIQ+F    EN+   +    KWKD P  I   S  E+
Sbjct:  455 LHCIKCKELVCKSSDIRLVENTHYTVI-----SSAFMELVDHKPHQKPMSFDGISKIGKIHHKTCTKDWGITAIYKSLKLPIIKIQSFIFKKENSNVHIV-LNKWKDFPGIIAVFSFEEI 568          
BLAST of SMED30005459 vs. Ensembl Nematostella
Match: EDO44228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWA2])

HSP 1 Score: 51.9878 bits (123), Expect = 1.622e-7
Identity = 31/114 (27.19%), Postives = 48/114 (42.11%), Query Frame = 1
Query: 1021 NFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQN----------SCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAIS 1332
             FYC+ C    C++ D R  S  HYV+I+ E F   KIE+                ++ C  C    G      G  +P +KI +F +  E    +L  ++KW +  L I  + 
Sbjct:  123 RFYCRKCNTFACEACDFRCVSGSHYVVISPE-FKRDKIELKPHKKPKLITGITMDTKVHCKKCGQDWGRTAKIHGAEWPLLKINSFVVQIEGGPRKL--YRKWTEAALNIKQVD 233          
BLAST of SMED30005459 vs. Ensembl Nematostella
Match: EDO47177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMY2])

HSP 1 Score: 51.9878 bits (123), Expect = 7.186e-7
Identity = 32/119 (26.89%), Postives = 56/119 (47.06%), Query Frame = 1
Query: 1030 CKNCRQNICKSTDI-RVASNIHYVI-------INTECFSSMKIEILN--QNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSL-VCENAASQLQKFKKWKDVPLQIPAISSAELLSF 1353
            C+ C   IC++ +I RV  + H  I       ++TE      +++ +    + ++KC  C+  LG   +Y G   P IKI  F + +  N   +   +K+WK VP ++  +   ELL  
Sbjct:  568 CRKCHVFICQAHEIKRVRDSYHVTIADDFSERVDTEEIPPEHVKVFDGFMFNKKMKCKKCAEPLGAMVNYKGMELPCIKIAQFQVAIMRNGRREFATYKQWKKVPFEVEDMDFCELLEL 686          
BLAST of SMED30005459 vs. Ensembl Nematostella
Match: EDO44279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWA7])

HSP 1 Score: 50.8322 bits (120), Expect = 1.287e-6
Identity = 31/114 (27.19%), Postives = 48/114 (42.11%), Query Frame = 1
Query: 1024 FYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQN----------SCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISS 1335
            FYC+ C    C++ D R  S  HYV+I+ E F   KIE+                ++ C  C    G      G  +P +KI +F +  E    +L  ++KW +  L I  +  
Sbjct:  536 FYCRKCNTFACEARDFRCVSGSHYVVISPE-FKRDKIELKPHKKPKLIDGITMDTKVHCKKCGEDWGVTAKIHGAEWPLLKINSFVVQIEGGPRKL--YRKWTEAALNIKQVDD 646          
BLAST of SMED30005459 vs. Ensembl Medaka
Match: dhx58 (DExH-box helicase 58 [Source:NCBI gene;Acc:101162602])

HSP 1 Score: 36.5798 bits (83), Expect = 6.322e-6
Identity = 13/27 (48.15%), Postives = 19/27 (70.37%), Query Frame = 3
Query:  366 CKNCFQGICKSTDIRLAENIYYIVINP 446
            C+NCFQ +   +DIRL E  +++ INP
Sbjct:  558 CRNCFQPVASGSDIRLLEKAHFVNINP 584          

HSP 2 Score: 33.113 bits (74), Expect = 6.322e-6
Identity = 21/59 (35.59%), Postives = 29/59 (49.15%), Query Frame = 1
Query:  478 SCQIKC--SKCSSTLGT*RTYKERL-FPTLKIDSLRLELEGDASSSRLFKKWKDVPFQV 645
             C+I C    C+   G    YK+ +  P + I +  LE  G+  +    KKWKDVPF V
Sbjct:  608 GCRISCNNGNCNKEWGFQMKYKKAIILPNMAICNFALETPGERMT---VKKWKDVPFAV 663          
BLAST of SMED30005459 vs. Ensembl Medaka
Match: dhx58 (DExH-box helicase 58 [Source:NCBI gene;Acc:101162602])

HSP 1 Score: 36.965 bits (84), Expect = 6.353e-6
Identity = 13/27 (48.15%), Postives = 19/27 (70.37%), Query Frame = 3
Query:  366 CKNCFQGICKSTDIRLAENIYYIVINP 446
            C+NCFQ +   +DIRL E  +++ INP
Sbjct:  608 CRNCFQPVASGSDIRLLEKAHFVNINP 634          

HSP 2 Score: 33.113 bits (74), Expect = 6.353e-6
Identity = 21/59 (35.59%), Postives = 29/59 (49.15%), Query Frame = 1
Query:  478 SCQIKC--SKCSSTLGT*RTYKERL-FPTLKIDSLRLELEGDASSSRLFKKWKDVPFQV 645
             C+I C    C+   G    YK+ +  P + I +  LE  G+  +    KKWKDVPF V
Sbjct:  658 GCRISCNNGNCNKEWGFQMKYKKAIILPNMAICNFALETPGERMT---VKKWKDVPFAV 713          
BLAST of SMED30005459 vs. Planmine SMEST
Match: SMESG000014884.1 (SMESG000014884.1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 294/324 (90.74%), Postives = 300/324 (92.59%), Query Frame = 1
Query:  415 QKIFIILLSIR---SLMTVFTNPASCQIKCSKCSSTLGT*RTYKERLFPTLKIDSLRLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSXXXXXXXXXXXWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN 1377
            + I+ I+++ +   SLMTVFTNPASCQIKCSKCSSTLGT                  LELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSLATLPPLTPPLWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN
Sbjct:  187 ENIYYIVINPKCFSSLMTVFTNPASCQIKCSKCSSTLGT------------------LELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSLATLPPLTPPLWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN 492          

HSP 2 Score: 194.126 bits (492), Expect = 1.495e-54
Identity = 112/113 (99.12%), Postives = 112/113 (99.12%), Query Frame = 3
Query:  111 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNT-SVKLKEKSNKQAXXXXXXXXXXXXXXNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP 446
            CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNT SVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP
Sbjct:   84 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNTASVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP 196          

HSP 3 Score: 118.627 bits (296), Expect = 5.483e-28
Identity = 60/118 (50.85%), Postives = 75/118 (63.56%), Query Frame = 1
Query: 1018 WNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSL 1371
            WNF CKNC Q ICKSTDIR+A NI+Y++IN +CFSS+     N  SCQIKC+ CSS LG                  +L  E  AS  + FKKWKDVP Q+PAI+  ELL+F+ ++SL
Sbjct:  166 WNFNCKNCFQGICKSTDIRLAENIYYIVINPKCFSSLMTVFTNPASCQIKCSKCSSTLG------------------TLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSL 265          

HSP 4 Score: 57.7658 bits (138), Expect = 1.515e-8
Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 3
Query:  348 PVWNFNCKNCFQGICKSTDIRLAENIYYIVIN 443
            P+WNF CKNC Q ICKSTDIR+A NI+Y++IN
Sbjct:  371 PLWNFYCKNCRQNICKSTDIRVASNIHYVIIN 402          
BLAST of SMED30005459 vs. Planmine SMEST
Match: SMESG000014884.1 (SMESG000014884.1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 294/324 (90.74%), Postives = 300/324 (92.59%), Query Frame = 1
Query:  415 QKIFIILLSIR---SLMTVFTNPASCQIKCSKCSSTLGT*RTYKERLFPTLKIDSLRLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSXXXXXXXXXXXWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN 1377
            + I+ I+++ +   SLMTVFTNPASCQIKCSKCSSTLGT                  LELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSLATLPPLTPPLWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN
Sbjct:  186 ENIYYIVINPKCFSSLMTVFTNPASCQIKCSKCSSTLGT------------------LELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSLATLPPLTPPLWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN 491          

HSP 2 Score: 198.749 bits (504), Expect = 3.023e-56
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 3
Query:  111 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNTSVKLKEKSNKQAXXXXXXXXXXXXXXNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP 446
            CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNTSVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP
Sbjct:   84 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNTSVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP 195          

HSP 3 Score: 118.242 bits (295), Expect = 5.686e-28
Identity = 60/118 (50.85%), Postives = 75/118 (63.56%), Query Frame = 1
Query: 1018 WNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSL 1371
            WNF CKNC Q ICKSTDIR+A NI+Y++IN +CFSS+     N  SCQIKC+ CSS LG                  +L  E  AS  + FKKWKDVP Q+PAI+  ELL+F+ ++SL
Sbjct:  165 WNFNCKNCFQGICKSTDIRLAENIYYIVINPKCFSSLMTVFTNPASCQIKCSKCSSTLG------------------TLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSL 264          

HSP 4 Score: 58.151 bits (139), Expect = 1.238e-8
Identity = 27/46 (58.70%), Postives = 34/46 (73.91%), Query Frame = 3
Query:  306 DSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVIN 443
            D   L+  P L+  P+WNF CKNC Q ICKSTDIR+A NI+Y++IN
Sbjct:  357 DQQSLATLPPLTP-PLWNFYCKNCRQNICKSTDIRVASNIHYVIIN 401          
BLAST of SMED30005459 vs. Planmine SMEST
Match: SMESG000014884.1 (SMESG000014884.1)

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 284/284 (100.00%), Postives = 284/284 (100.00%), Query Frame = 1
Query:  526 RTYKERLFPTLKIDSLRLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSXXXXXXXXXXXWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN 1377
            RTYKERLFPTLKIDSLRLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSLATLPPLTPPLWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN
Sbjct:  199 RTYKERLFPTLKIDSLRLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSLATLPPLTPPLWNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSLCN 482          

HSP 2 Score: 196.052 bits (497), Expect = 0.000e+0
Identity = 113/114 (99.12%), Postives = 113/114 (99.12%), Query Frame = 3
Query:  111 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNT-SVKLKEKSNKQAXXXXXXXXXXXXXXNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINPL 449
            CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNT SVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINPL
Sbjct:   84 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNTASVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINPL 197          

HSP 3 Score: 81.6481 bits (200), Expect = 1.338e-26
Identity = 42/83 (50.60%), Postives = 55/83 (66.27%), Query Frame = 1
Query:  448 SLMTVFTNPASCQIKCSKCSSTLGT*RTYKERLFPTLKIDSLRLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSL 696
            S+     N  SCQIKC+ CSS LG  ++Y   LFPT+KI +  L  E  AS  + FKKWKDVP Q+PAI+  ELL+F+ ++SL
Sbjct:  398 SMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSL 480          

HSP 4 Score: 58.151 bits (139), Expect = 1.338e-26
Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 3
Query:  348 PVWNFNCKNCFQGICKSTDIRLAENIYYIVIN 443
            P+WNF CKNC Q ICKSTDIR+A NI+Y++IN
Sbjct:  361 PLWNFYCKNCRQNICKSTDIRVASNIHYVIIN 392          

HSP 5 Score: 95.9005 bits (237), Expect = 1.392e-20
Identity = 51/118 (43.22%), Postives = 66/118 (55.93%), Query Frame = 1
Query: 1018 WNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSL 1371
            WNF CKNC Q ICKSTDIR+A NI+Y++IN                               ++Y   LFPT+KI +  L  E  AS  + FKKWKDVP Q+PAI+  ELL+F+ ++SL
Sbjct:  166 WNFNCKNCFQGICKSTDIRLAENIYYIVINP----------------------------LPRTYKERLFPTLKIDSLRLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSL 255          
BLAST of SMED30005459 vs. Planmine SMEST
Match: SMESG000014884.1 (SMESG000014884.1)

HSP 1 Score: 375.941 bits (964), Expect = 7.070e-125
Identity = 205/235 (87.23%), Postives = 211/235 (89.79%), Query Frame = 1
Query:  415 QKIFIILLSIR---SLMTVFTNPASCQIKCSKCSSTLGT*RTYKERLFPTLKIDSLRLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSXXXXXXXXXXXWNFYCKNCRQNICKSTDIRVASNIHYVIINT 1110
            + I+ I+++ +   SLMTVFTNPASCQIKCSKCSSTLGT                  LELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSLATLPPLTPPLWNFYCKNCRQNICKSTDIRVASNIHYVIINT
Sbjct:  187 ENIYYIVINPKCFSSLMTVFTNPASCQIKCSKCSSTLGT------------------LELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSLSYCKSLTAKKLEFKKEYTSNSGNSTVGEYTHEFKAVDITGQTEENVEEKTLENNLEYKITLTKFQETSKDGKSEEIKNCQSGRELQETVPNLDQQSLATLPPLTPPLWNFYCKNCRQNICKSTDIRVASNIHYVIINT 403          

HSP 2 Score: 194.897 bits (494), Expect = 1.398e-55
Identity = 112/113 (99.12%), Postives = 112/113 (99.12%), Query Frame = 3
Query:  111 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNT-SVKLKEKSNKQAXXXXXXXXXXXXXXNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP 446
            CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNT SVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP
Sbjct:   84 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNTASVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINP 196          

HSP 3 Score: 118.242 bits (295), Expect = 2.105e-28
Identity = 60/118 (50.85%), Postives = 75/118 (63.56%), Query Frame = 1
Query: 1018 WNFYCKNCRQNICKSTDIRVASNIHYVIINTECFSSMKIEILNQNSCQIKCNNCSSLLGHRQSYIGCLFPTIKIQAFSLVCENAASQLQKFKKWKDVPLQIPAISSAELLSFSHDHSL 1371
            WNF CKNC Q ICKSTDIR+A NI+Y++IN +CFSS+     N  SCQIKC+ CSS LG                  +L  E  AS  + FKKWKDVP Q+PAI+  ELL+F+ ++SL
Sbjct:  166 WNFNCKNCFQGICKSTDIRLAENIYYIVINPKCFSSLMTVFTNPASCQIKCSKCSSTLG------------------TLELEGDASSSRLFKKWKDVPFQVPAITEPELLNFTENNSL 265          

HSP 4 Score: 59.3066 bits (142), Expect = 4.062e-9
Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = 3
Query:  348 PVWNFNCKNCFQGICKSTDIRLAENIYYIVINPL 449
            P+WNF CKNC Q ICKSTDIR+A NI+Y++IN L
Sbjct:  371 PLWNFYCKNCRQNICKSTDIRVASNIHYVIINTL 404          
BLAST of SMED30005459 vs. Planmine SMEST
Match: SMESG000014884.1 (SMESG000014884.1)

HSP 1 Score: 206.453 bits (524), Expect = 2.025e-62
Identity = 119/120 (99.17%), Postives = 119/120 (99.17%), Query Frame = 3
Query:  111 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNT-SVKLKEKSNKQAXXXXXXXXXXXXXXNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINPLLDDGIY 467
            CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNT SVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINPLLDDGIY
Sbjct:   84 CGYDESEDFEGQCNQLSNVHITPGLQLLNSKRKETRNTASVKLKEKSNKQAKEIIKKEKEKVKVKNDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINPLLDDGIY 203          

HSP 2 Score: 55.0694 bits (131), Expect = 2.437e-8
Identity = 22/30 (73.33%), Postives = 26/30 (86.67%), Query Frame = 1
Query: 1018 WNFYCKNCRQNICKSTDIRVASNIHYVIIN 1107
            WNF CKNC Q ICKSTDIR+A NI+Y++IN
Sbjct:  166 WNFNCKNCFQGICKSTDIRLAENIYYIVIN 195          
The following BLAST results are available for this feature:
BLAST of SMED30005459 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
IFIH14.496e-628.46interferon induced with helicase C domain 1 [Sourc... [more]
IFIH14.531e-628.46interferon induced with helicase C domain 1 [Sourc... [more]
back to top
BLAST of SMED30005459 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005459 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005459 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005459 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005459 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005459 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005459 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3UQR72.316e-730.70Interferon induced with helicase C domain 1 OS=Mel... [more]
A0A093J5232.340e-730.43Interferon-induced helicase C domain-containing pr... [more]
G1NEI22.360e-730.70Interferon induced with helicase C domain 1 OS=Mel... [more]
A0A091JAB72.609e-731.30Interferon-induced helicase C domain-containing pr... [more]
A0A093BYE32.943e-731.30Interferon-induced helicase C domain-containing pr... [more]
back to top
BLAST of SMED30005459 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005459 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DDX583.787e-730.00DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of SMED30005459 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005459 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO442281.622e-727.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471777.186e-726.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442791.287e-627.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30005459 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dhx586.322e-648.15DExH-box helicase 58 [Source:NCBI gene;Acc:1011626... [more]
dhx586.353e-648.15DExH-box helicase 58 [Source:NCBI gene;Acc:1011626... [more]
back to top
BLAST of SMED30005459 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014884.11.495e-5490.74SMESG000014884.1[more]
SMESG000014884.13.023e-5690.74SMESG000014884.1[more]
SMESG000014884.11.338e-26100.00SMESG000014884.1[more]
SMESG000014884.17.070e-12587.23SMESG000014884.1[more]
SMESG000014884.12.025e-6299.17SMESG000014884.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005459 ID=SMED30005459|Name=SMED30005459|organism=Schmidtea mediterranea sexual|type=transcript|length=1942bp
TATATAACGGCTATGGCTGTGATGACTATGACGACTTTGATAACGGCTAT
GGCTATGATGACTATGACGACTTTGATGATGGCTTTCTTTATGACGACTT
GCACGATGGTTGTGGGTACGACGAATCCGAAGACTTTGAAGGTCAATGCA
ACCAATTAAGCAATGTTCACATAACTCCAGGGCTTCAATTGTTGAATTCC
AAAAGAAAAGAAACACGAAATACATCGGTGAAGTTAAAAGAAAAATCTAA
TAAGCAAGCAAAAGAAATTATTAAAAAAGAAAAAGAAAAGGTAAAGGTAA
AAAATGATAGTTTTCAGTTGTCTCTGGATCCTAATTTATCGGGCCTTCCT
GTGTGGAATTTTAATTGTAAAAATTGTTTTCAAGGTATCTGTAAGTCAAC
GGATATTAGGCTGGCAGAAAATATTTATTATATTGTTATCAATCCGCTCC
TTGATGACGGTATTTACTAATCCAGCTTCCTGTCAGATCAAGTGCAGCAA
ATGCAGCAGTACTTTAGGGACGTAGAGAACCTATAAAGAGCGCTTATTTC
CTACATTAAAAATCGACTCATTGAGATTGGAACTCGAAGGAGACGCATCA
TCATCACGGCTATTCAAAAAATGGAAAGATGTACCTTTTCAAGTTCCAGC
TATTACAGAGCCAGAATTGCTGAATTTTACAGAGAATAACTCACTATCTT
ATTGCAAAAGTCTTACTGCTAAGAAACTAGAATTCAAGAAAGAGTATACT
TCTAACTCTGGAAATTCAACTGTTGGAGAATACACTCATGAGTTCAAAGC
GGTTGACATAACCGGTCAAACGGAAGAGAACGTTGAGGAGAAAACTTTGG
AAAATAATTTGGAATATAAAATAACTTTGACAAAGTTTCAAGAAACAAGT
AAAGACGGAAAATCAGAAGAAATCAAAAACTGTCAAAGTGGAAGGGAGTT
GCAAGAAACTGTCCCAAACCTTGATCAACAGTCCCTTGCAACGTTACCGC
CACTAACGCCACCATTGTGGAATTTCTACTGTAAAAATTGCAGACAAAAC
ATCTGTAAATCCACGGATATTAGAGTGGCTAGCAATATTCATTATGTCAT
CATAAATACCGAATGTTTCAGCTCCATGAAAATTGAAATTCTCAATCAGA
ATTCTTGTCAAATCAAATGCAACAATTGCAGTAGCCTTCTTGGACATCGG
CAAAGTTACATCGGCTGTTTATTCCCGACAATAAAAATTCAGGCTTTCAG
TTTGGTTTGTGAAAATGCCGCTTCTCAACTCCAGAAATTCAAAAAATGGA
AGGATGTACCTTTACAAATACCGGCCATCTCATCGGCAGAATTGTTGAGT
TTCAGTCATGACCACTCGCTGTGCAACTGAAACCAGTGAAGCATAAATGG
ACACAAATTAAAAATTGCACCTTTTGTAATGTTAAATTAAAACAAAATAA
GATTTTGTGATTTAATTTGTTTGATGAAGCGTTAAATTATAAATCTCACA
TAAATCAAGAAGGATAATTTCCTATATTTGTCGTAATTGTTGAAAATGCT
CTACTTTTTATATCTCTTTAATAGAGAAGATTTATGTAAATTGCTCATTT
TTGGTTTTTCCTCTCATTCTCATACAAAGTAACGTTTCTCACTCAGCTGG
CTAAGGAATTAAATGCGAAATGTGAATGTGTACCCTGTTTGTTCAAGATT
TTCATAAAATGGCTACTTCTCTCGCAGAGGTTGGTCGTCCAGCTCATATA
TAACTCGATAATTTTATTCCTCAAAGTAATATAGATATGACACGTGTAAG
CCCCCCGCCATCAGCTCAGAACCCCTCATTGCACCCTGTACGAATTCAAA
CGAAGAAAATCCCACCAACCTCCGATAATCAAAACCGAAAGCTAGTTTTT
CAATTACGTGAATAACTCTAGAATTATCGAGTCAGTATCTCC
back to top

protein sequence of SMED30005459-orf-1

>SMED30005459-orf-1 ID=SMED30005459-orf-1|Name=SMED30005459-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
YNGYGCDDYDDFDNGYGYDDYDDFDDGFLYDDLHDGCGYDESEDFEGQCN
QLSNVHITPGLQLLNSKRKETRNTSVKLKEKSNKQAKEIIKKEKEKVKVK
NDSFQLSLDPNLSGLPVWNFNCKNCFQGICKSTDIRLAENIYYIVINPLL
DDGIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038557RLR_C_sf
IPR021673RLR_CTR
Vocabulary: molecular function
TermDefinition
GO:0016817hydrolase activity, acting on acid anhydrides
GO:0003677DNA binding
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 61..96
IPR038557RIG-I-like receptor, C-terminal domain superfamilyGENE3DG3DSA:2.170.150.30coord: 116..154
e-value: 1.3E-5
score: 26.9
IPR021673RIG-I-like receptor, C-terminal regulatory domainPFAMPF11648RIG-I_C-RDcoord: 119..150
e-value: 6.6E-6
score: 26.4
IPR021673RIG-I-like receptor, C-terminal regulatory domainPROSITEPS51789RLR_CTRcoord: 103..155
score: 11.991