SMED30005457

Overview
NameSMED30005457
Smed IDSMED30005457
Length (bp)1408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005457 (SMED30005457) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005457 (SMED30005457) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005457 (SMED30005457) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005457 (SMED30005457) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005457

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30005457SMESG000035312.1 SmedASXL_009678SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30005457SMESG000035312.1 SmedASXL_009678SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30005457SMESG000035312.1 dd_Smed_v4_131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005457SMESG000035312.1 dd_Smed_v4_131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005457SMESG000035312.1 dd_Smed_v4_131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005457SMESG000035312.1 Contig54132uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005457SMESG000035312.1 Contig54132newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005457SMESG000035312.1 Contig46975uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005457SMESG000035312.1 Contig46975newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005457SMESG000035313.1 SMESG000035312.1 Contig7310uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005457SMESG000035313.1 SMESG000035312.1 Contig7310newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30005457SMESG000035312.1 SMESG000035313.1 dd_131dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30005457SMESG000035312.1 dd_Smed_v6_131_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30005457SMESG000035312.1 dd_Smed_v4_131_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30005457SMESG000035313.1 SMESG000035312.1 dd_Smed_v6_131_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30005457SMESG000035313.1 SMESG000035312.1 dd_Smed_v6_131_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005457 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006101:11970..15535 -6771
v31.006101:3366..7626 +3756
Homology
BLAST of SMED30005457 vs. Planmine SMEST
Match: SMESG000035312.1 (SMESG000035312.1)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 415/418 (99.28%), Postives = 416/418 (99.52%), Query Frame = 3
Query:   63 MIAYFLLFLTISLVSSTPLEQNELKLQERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGSVAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNEKQKTERGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDPDVIAIREHLNILEQRXXXXXXXXXXXXXXXXXQATKPESDYPYAVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNATKE 1316
            MIAYFLLFLTISLVSSTPLEQNE KLQERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGIL+HLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGS AFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNEKQKTERGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDPDVIAIREHLNILEQRIIDSIIKKFIEIFDKIDQATKPESDYPYAVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNATKE
Sbjct:    1 MIAYFLLFLTISLVSSTPLEQNEFKLQERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGSAAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNEKQKTERGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDPDVIAIREHLNILEQRIIDSIIKKFIEIFDKIDQATKPESDYPYAVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNATKE 418          
BLAST of SMED30005457 vs. Planmine SMEST
Match: SMESG000035313.1 (SMESG000035313.1)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 336/418 (80.38%), Postives = 383/418 (91.63%), Query Frame = 3
Query:   63 MIAYFLLFLTISLVSSTPLEQNELKLQERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGSVAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNEKQKTERGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDPDVIAIREHLNILEQRXXXXXXXXXXXXXXXXXQATKPESDYPYAVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNATKE 1316
            MI+YF+L LTISLVS    E   L+ +ERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFREL++K+DEATKEKTE++KRDFKESS+ LLKKL +IL +AF+KGS AF +A+ DPDVKEILNSL  +SRRTANF+IEKFKELVIK+DE T EK K+ERGLI+++  N K LIQILI AS++G+EYF  I++DPD +AI+E+LN +EQ+II+SII+KF++IFDKID+ATKP SD P+AVSDW+EDA  QLK+LTQILLKAYR+GGEYF+KV+ND DVQNILQHLGPLTR++A S+I+NFRELIEKIDNATKE
Sbjct:    1 MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKE 418          

HSP 2 Score: 140.584 bits (353), Expect = 8.018e-37
Identity = 75/157 (47.77%), Postives = 110/157 (70.06%), Query Frame = 3
Query:  144 ERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEP--SKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELLEKLDEATKEKT 608
            ER   E S +   +LI+ L  A  KGAE F  +I+D D   I ++++++ +++  SII KF ++  KID+ATKP S+   +  + +E +T  +K+L QILL AY+QG EYF++V+NDSDVQ IL+HLGPL+R+IA  +I+ FREL+EK+D ATKE T
Sbjct:  264 ERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKEST 420          
BLAST of SMED30005457 vs. Planmine SMEST
Match: SMESG000035313.1 (SMESG000035313.1)

HSP 1 Score: 491.115 bits (1263), Expect = 3.461e-171
Identity = 256/390 (65.64%), Postives = 331/390 (84.87%), Query Frame = 3
Query:  147 RYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGSVAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNEKQKTERGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDPDVIAIREHLNILEQRXXXXXXXXXXXXXXXXXQATKPESDYPYAVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNATKE 1316
            R  KE S+ L+  L++ L  AY++G E FDRV+NDSD++GIL+H+  L+R++A+ IIN+F+ELI+KIDEATK      KR+  ESS +L+K+L +ILL AY +G EY  +V+ND +V+ IL+HLGPLSR++A+ IIN FREL++K+DEATKEKTE++KRDFKESS+ LLKKL +IL +AF+KGS AF +A+ DPDVKEILNSL  +SRRTANF+IEKFKELVIK+DE T EK K+ERGLI+++  N K LIQILI AS++G+EYF  I++DPD +AI+E+LN +EQ+II+SII+KF++IFDKID+ATKP SD P+AVSDW+EDA  QLK+LTQILLKAYR+GGEYF+KV+ND DVQNILQHLGPLTR++A S+I+NFRELIEKIDNATKE
Sbjct:  108 RNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRS--ESSIELLKKLNEILLKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKE 495          

HSP 2 Score: 477.248 bits (1227), Expect = 7.956e-166
Identity = 267/418 (63.88%), Postives = 320/418 (76.56%), Query Frame = 3
Query:   63 MIAYFLLFLTISLVSSTPLEQNELKLQERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGSVAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNEKQKTE-RGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDPDVIAIREHLNILEQRXXXXXXXXXXXXXXXXXQATKPESDYPYAVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNATK 1313
            MI+YF+L LTISLVS    E   L+ +ERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFREL+EK+DEATKE    +KR   ESSI LLKKL  IL +A+ KG     + + DP+VK IL+ L  +SRR A  +I  F+EL+ KIDEAT EK + E R   +++ + +K L+ IL+KA ++GSE F   +NDPDV  I   L+ L +R  + II+KF E+  K+D+ T   ++ P +     ED+K+  K+L QIL+ A RKG EYF  +++DPD   I ++L  + +K+ NSIIE F ++ +KID ATK
Sbjct:    1 MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRS--ESSIELLKKLNEILLKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELT---TEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATK 413          

HSP 3 Score: 140.198 bits (352), Expect = 2.797e-36
Identity = 75/157 (47.77%), Postives = 110/157 (70.06%), Query Frame = 3
Query:  144 ERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEP--SKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELLEKLDEATKEKT 608
            ER   E S +   +LI+ L  A  KGAE F  +I+D D   I ++++++ +++  SII KF ++  KID+ATKP S+   +  + +E +T  +K+L QILL AY+QG EYF++V+NDSDVQ IL+HLGPL+R+IA  +I+ FREL+EK+D ATKE T
Sbjct:  341 ERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKEST 497          
BLAST of SMED30005457 vs. Planmine SMEST
Match: SMESG000035252.1 (SMESG000035252.1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.991e-22
Identity = 42/73 (57.53%), Postives = 59/73 (80.82%), Query Frame = 3
Query: 1092 AVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNAT 1310
             V ++KE + + +K+LT+IL  AY KG E F KV+NDPDV+ IL+ LGPL++KVANSII++F+EL++KID AT
Sbjct:   25 TVKEFKESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKAT 97          

HSP 2 Score: 83.5741 bits (205), Expect = 1.913e-19
Identity = 38/71 (53.52%), Postives = 55/71 (77.46%), Query Frame = 3
Query:  384 RNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELLEKLDEAT 596
            +  KESS  L+K+L +IL +AY +G E F +V+ND DV+ ILE LGPLS+K+A+ II  F+EL++K+D+AT
Sbjct:   27 KEFKESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKAT 97          

HSP 3 Score: 82.8037 bits (203), Expect = 3.286e-19
Identity = 43/99 (43.43%), Postives = 68/99 (68.69%), Query Frame = 3
Query:   63 MIAYFLLFLTISLVSSTPLEQNELKLQERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEAT 359
            MI YF+    +SLV S   + ++  ++E  FKE S +L+ +L + L+ AY KG+E F +V+ND D+K IL+ +  L++++A SII  FKEL++KID+AT
Sbjct:    1 MIKYFIFLALLSLVLSDDKKTDDSTVKE--FKESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKAT 97          

HSP 4 Score: 80.4925 bits (197), Expect = 2.853e-18
Identity = 40/73 (54.79%), Postives = 56/73 (76.71%), Query Frame = 3
Query:  621 RDFKESSISLLKKLTHILTQAFQKGSVAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNE 839
            ++FKESS++L+KKLT IL  A+ KGS +F++ L DPDVK IL  L  +S++ AN +I+ FKELV KID+AT +
Sbjct:   27 KEFKESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKATGK 99          
BLAST of SMED30005457 vs. Planmine SMEST
Match: SMESG000035316.1 (SMESG000035316.1)

HSP 1 Score: 68.5514 bits (166), Expect = 8.753e-13
Identity = 70/275 (25.45%), Postives = 125/275 (45.45%), Query Frame = 3
Query:   63 MIAYFLLFLTISLVSSTPLEQNELKLQERYFKE----KSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGSVAFNEALEDPDVKEILNSLSGISRRTANFM------IEKFKELVIKIDEATNEKQKTER 857
            M  Y    L+ SL    P +  +   Q    K     KSS LL + I  L   YEKG  E++ +  D  I+ +++ MD  T+ +AES++ +F++ I   D       +  KR   ++S  L      I  N  + G             + I  +   LSR+  + ++ + RE+++++DEATK K   +KR+ K   +++ K+ +       QKG            ++++++ LS  S+R + ++      I  FK+L+    E  +EK K E+
Sbjct:    1 MTFYLTFVLSFSLAFCNPYKGGQFSNQPETIKRQEIGKSSQLLSKFIVELAKLYEKGIYEYNEIFQDPKIRKLIEKMDEFTKLVAESLVIQFEDEIISRDSPKSEFDDFEKRYTYKTSKSLSLIQRSIKGNGIRSG------------EKEITNNFEQLSRRRTEFLVRKLREIVDQIDEATKLKAANEKRNIKLYKVNVYKRNSS----PDQKGY-----------IQDLIDILSEASKRGSEYLIIFDKVIANFKQLI----ELVDEKMKKEK 244          
The following BLAST results are available for this feature:
BLAST of SMED30005457 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005457 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035312.10.000e+099.28SMESG000035312.1[more]
SMESG000035313.18.018e-3780.38SMESG000035313.1[more]
SMESG000035313.13.461e-17165.64SMESG000035313.1[more]
SMESG000035252.14.991e-2257.53SMESG000035252.1[more]
SMESG000035316.18.753e-1325.45SMESG000035316.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005457 ID=SMED30005457|Name=SMED30005457|organism=Schmidtea mediterranea sexual|type=transcript|length=1408bp
GCTTCGTAAACAGATAAATACTGTTTGTGTTTCAAAATATTACAAATTTA
CGATTAGGTAAAATGATTGCATACTTCCTTCTATTTTTGACAATTTCTTT
GGTATCCTCCACTCCTCTTGAGCAAAATGAATTGAAATTACAAGAAAGAT
ATTTTAAAGAGAAGTCATCAAGCTTATTGGTAGAACTGATCCGAACTCTC
CGAACTGCGTATGAGAAAGGTGCTGAAGAATTCGACAGAGTTATCAATGA
TTCTGATATCAAAGGAATTTTAGATCATATGGACGCACTGACCCGACGAC
TGGCGGAGTCTATCATCAATAAATTCAAAGAGCTGATCAAAAAAATCGAC
GAAGCAACAAAACCGATTTCCGAACCATCCAAGCGAAACCTAAAAGAAAG
CTCAACAAAGCTCATGAAGAGATTGGTCCAGATTTTATTGAATGCCTACA
AACAAGGATTGGAATATTTTGACAGAGTTGTCAATGATTCTGATGTTCAA
GGAATTCTCGAACATCTTGGACCTCTGTCAAGAAAGATCGCAGATGGAAT
TATCAACCAATTCAGAGAGTTATTGGAAAAACTCGACGAAGCTACTAAAG
AGAAAACAGAAATTCAGAAAAGAGACTTCAAAGAAAGTTCAATCAGTCTT
CTAAAGAAATTAACACATATTTTAACACAAGCTTTCCAAAAAGGTTCCGT
AGCATTTAATGAAGCTCTCGAAGATCCAGATGTTAAAGAAATTCTCAACA
GTCTTTCTGGTATCAGTCGAAGAACGGCGAATTTCATGATTGAAAAATTT
AAAGAGTTGGTCATCAAAATAGACGAGGCAACGAATGAAAAACAAAAAAC
AGAAAGAGGACTTATTGATAATACTACGAAAAATGTGAAAAACTTGATTC
AAATTCTAATAAAGGCTTCAAAGCAAGGATCTGAATATTTTCGCACTATT
TTAAATGATCCCGATGTTATTGCTATCCGAGAACACCTCAATATCCTCGA
GCAAAGAATCATTGATTCAATTATTAAAAAATTCATTGAAATTTTCGACA
AAATTGACCAAGCTACAAAGCCGGAATCGGATTATCCATATGCAGTTTCT
GATTGGAAAGAAGATGCAAAGGATCAACTGAAACGATTGACCCAAATTTT
ACTGAAAGCATATCGAAAGGGTGGAGAGTATTTTGATAAAGTTGTCAATG
ATCCAGACGTTCAAAATATTTTACAACATCTTGGTCCCTTGACTAGGAAA
GTCGCTAATTCAATTATTGAGAACTTCAGAGAGTTAATAGAGAAAATTGA
CAATGCAACAAAAGAATAGCTGAATTTTTTATTCGAATTGTTTCAAACAA
AAGCTAAAAAAGGCTTTAACTGTCACTAAATTGATTTAATTTTAATAAAT
TTTGTATA
back to top

protein sequence of SMED30005457-orf-1

>SMED30005457-orf-1 ID=SMED30005457-orf-1|Name=SMED30005457-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=419bp
MIAYFLLFLTISLVSSTPLEQNELKLQERYFKEKSSSLLVELIRTLRTAY
EKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATK
PISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILE
HLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKL
THILTQAFQKGSVAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELV
IKIDEATNEKQKTERGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDP
DVIAIREHLNILEQRIIDSIIKKFIEIFDKIDQATKPESDYPYAVSDWKE
DAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANS
IIENFRELIEKIDNATKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000240body wall musculature
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 398..418
NoneNo IPR availableCOILSCoilCoilcoord: 160..187
NoneNo IPR availableCOILSCoilCoilcoord: 246..266
NoneNo IPR availableCOILSCoilCoilcoord: 349..369
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.866
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 80..370