slc16a-18

Overview
Nameslc16a-18 (AKN21513.1)
Smed IDSMED30005453
Length (bp)3507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-18 (SMED30005453) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-18 (SMED30005453) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-18 (SMED30005453) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-18 (SMED30005453) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005453

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005453SMESG000003109.1 dd_Smed_v4_10147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005453SMESG000003109.1 dd_Smed_v4_10147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005453SMESG000003109.1 dd_Smed_v4_10147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30005453SMESG000003109.1 SMED30005453smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30005453SMESG000003109.1 SMED30005453smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-18 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 86.2705 bits (212), Expect = 1.057e-16
Identity = 73/223 (32.74%), Postives = 113/223 (50.67%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE-------------LHLRMQQLSKIRSTIRQMRREEDE 1193
            DGGWAW++VL+SFF  I I G+    G+L  E +E F ++  ++  W  SL  G  + +GP      N    R  A+ GG+++ +  +LS++  N+    I FGV  G+G  + YLPA+ +VG +F ++R +A GL+  G+G GTFL   L+  L     W+  +++  AV     V   L RPL                L       ++ST +Q R EE +
Sbjct:   29 DGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRGLT-AWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKD 250          
BLAST of slc16a-18 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 86.2705 bits (212), Expect = 1.111e-16
Identity = 73/223 (32.74%), Postives = 113/223 (50.67%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE-------------LHLRMQQLSKIRSTIRQMRREEDE 1193
            DGGWAW++VL+SFF  I I G+    G+L  E +E F ++  ++  W  SL  G  + +GP      N    R  A+ GG+++ +  +LS++  N+    I FGV  G+G  + YLPA+ +VG +F ++R +A GL+  G+G GTFL   L+  L     W+  +++  AV     V   L RPL                L       ++ST +Q R EE +
Sbjct:   29 DGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRGLT-AWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKD 250          
BLAST of slc16a-18 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 85.1149 bits (209), Expect = 2.601e-16
Identity = 73/223 (32.74%), Postives = 113/223 (50.67%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE-------------LHLRMQQLSKIRSTIRQMRREEDE 1193
            DGGWAW++VL+SFF  I I G+    G+L  E +E F ++  ++  W  SL  G  + +GP      N    R  A+ GG+++ +  +LS++  N+    I FGV  G+G  + YLPA+ +VG +F ++R +A GL+  G+G GTFL   L+  L     W+  +++  AV     V   L RPL                L       ++ST +Q R EE +
Sbjct:   29 DGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRGLT-AWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKD 250          

HSP 2 Score: 63.5438 bits (153), Expect = 1.640e-9
Identity = 40/130 (30.77%), Postives = 72/130 (55.38%), Query Frame = 3
Query: 2553 INNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCF----PLRFVAKLERDYIEKRY 2930
            + NF L+L+      +P + TY G L  +  L G   +G+ SL  ++  +L+G+  L NA+G ++   G++ ++GPP AGWI D+   KY++ FY  G ++ + GIL       +R + +  R Y++  +
Sbjct:  387 LANFTLVLSIFI---LPLMHTYAG-LAVICALIGFS-SGYFSLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDIT-QKYDFSFYICG-LLYMIGILFLLIQPCIRIIEQSRRKYMDGAH 509          
BLAST of slc16a-18 vs. Ensembl Human
Match: SLC16A9 (solute carrier family 16 member 9 [Source:HGNC Symbol;Acc:HGNC:23520])

HSP 1 Score: 82.4185 bits (202), Expect = 1.645e-15
Identity = 61/187 (32.62%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PDGGW W+IV  SF       G+    G+L  E ++ F E    +  W GSL +G  +   PV S   + F  RPV +  G +    ++LSSF  N+      +G++ G+G  L+Y   + I   +F ++R +A+GL   GS  G F+Y  L   L+E     GC++++ A+    L    L RPL+
Sbjct:    7 PDGGWGWVIVFVSFLTQFLCYGSPLAVGVLYIEWLDAFGEGKGKT-AWVGSLASGVGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQ 192          

HSP 2 Score: 69.707 bits (169), Expect = 1.757e-11
Identity = 42/142 (29.58%), Postives = 74/142 (52.11%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGIL 2873
            LIS +G+    G+L   I       +++ W + L++    LI+ G+  C+IPF  +Y   L  +  + G  + G  S+   +  + +G+ +L +A+G L+ F GL   +GPP+ GW  D     Y+  FYF+G  ++L G +
Sbjct:  345 LISIIGIMTAVGKLLLGIL------ADFKWINTLYLYVATLIIMGLALCAIPFAKSYV-TLALLSGILGF-LTGNWSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWT-QTYDIAFYFSGFCVLLGGFI 477          
BLAST of slc16a-18 vs. Ensembl Human
Match: SLC16A9 (solute carrier family 16 member 9 [Source:HGNC Symbol;Acc:HGNC:23520])

HSP 1 Score: 82.4185 bits (202), Expect = 1.645e-15
Identity = 61/187 (32.62%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PDGGW W+IV  SF       G+    G+L  E ++ F E    +  W GSL +G  +   PV S   + F  RPV +  G +    ++LSSF  N+      +G++ G+G  L+Y   + I   +F ++R +A+GL   GS  G F+Y  L   L+E     GC++++ A+    L    L RPL+
Sbjct:    7 PDGGWGWVIVFVSFLTQFLCYGSPLAVGVLYIEWLDAFGEGKGKT-AWVGSLASGVGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQ 192          

HSP 2 Score: 69.707 bits (169), Expect = 1.757e-11
Identity = 42/142 (29.58%), Postives = 74/142 (52.11%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGIL 2873
            LIS +G+    G+L   I       +++ W + L++    LI+ G+  C+IPF  +Y   L  +  + G  + G  S+   +  + +G+ +L +A+G L+ F GL   +GPP+ GW  D     Y+  FYF+G  ++L G +
Sbjct:  345 LISIIGIMTAVGKLLLGIL------ADFKWINTLYLYVATLIIMGLALCAIPFAKSYV-TLALLSGILGF-LTGNWSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWT-QTYDIAFYFSGFCVLLGGFI 477          
BLAST of slc16a-18 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 124.405 bits (311), Expect = 1.075e-28
Identity = 90/334 (26.95%), Postives = 169/334 (50.60%), Query Frame = 3
Query: 1917 KEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSL--NVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERD 2912
            KE  RP N++++F+ GS++ L     E +          +A +  ST     S+    ++  N S       G G+ E     ++E F+D           G   + P              P R  + E++D++LL + T +I+ IS++  M+G ++P  FL    +S+ +D+ +A  L+   G+ NT GR+F        W ++      L INN  LI++G+   + P L +  G   + + ++G  ++ ++ L SI++ +L+G+  LTN+FG L++ +G+A+++GPP AG + D+    Y+  FYF G +++++G++   + FV K + D
Sbjct:  406 KEFQRPMNRQDIFYGGSIQNLKEFKEEGT----------MAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEE-EMIEPFVDD----------GCCKVLPL-------------PMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAI-VFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDIT-GSYDTAFYFGGLVLLVAGLISATIPFVTKKDAD 697          

HSP 2 Score: 114.005 bits (284), Expect = 1.879e-25
Identity = 80/215 (37.21%), Postives = 135/215 (62.79%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL----HLRMQQLSKIRSTIRQMRREEDE 1193
            PDGG+ W+IV A+F   + +DG    +        E +QE+D ++ ++ GSL+ G Y+ +GP+ SAL N+++ R V +AGG+ISGIA +++    N+  F++ +GV+GG+GF +IYLPAI +VG +F  KR +A G+++ GSG GTFL   +    I  + W+  I ++A + F C+ +  L+RPL +     +R Q++  +R  + ++  +EDE
Sbjct:   70 PDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLT-VFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPLPMVDLNEIRDQEMEPLRQALSKVEDDEDE 283          
BLAST of slc16a-18 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 122.094 bits (305), Expect = 4.136e-28
Identity = 90/334 (26.95%), Postives = 169/334 (50.60%), Query Frame = 3
Query: 1917 KEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSL--NVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERD 2912
            KE  RP N++++F+ GS++ L     E +          +A +  ST     S+    ++  N S       G G+ E     ++E F+D           G   + P              P R  + E++D++LL + T +I+ IS++  M+G ++P  FL    +S+ +D+ +A  L+   G+ NT GR+F        W ++      L INN  LI++G+   + P L +  G   + + ++G  ++ ++ L SI++ +L+G+  LTN+FG L++ +G+A+++GPP AG + D+    Y+  FYF G +++++G++   + FV K + D
Sbjct:  351 KEFQRPMNRQDIFYGGSIQNLKEFKEEGT----------MAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEE-EMIEPFVDD----------GCCKVLPL-------------PMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAI-VFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDIT-GSYDTAFYFGGLVLLVAGLISATIPFVTKKDAD 642          

HSP 2 Score: 112.849 bits (281), Expect = 3.324e-25
Identity = 80/215 (37.21%), Postives = 135/215 (62.79%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL----HLRMQQLSKIRSTIRQMRREEDE 1193
            PDGG+ W+IV A+F   + +DG    +        E +QE+D ++ ++ GSL+ G Y+ +GP+ SAL N+++ R V +AGG+ISGIA +++    N+  F++ +GV+GG+GF +IYLPAI +VG +F  KR +A G+++ GSG GTFL   +    I  + W+  I ++A + F C+ +  L+RPL +     +R Q++  +R  + ++  +EDE
Sbjct:   15 PDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLT-VFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPLPMVDLNEIRDQEMEPLRQALSKVEDDEDE 228          
BLAST of slc16a-18 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 122.094 bits (305), Expect = 4.136e-28
Identity = 90/334 (26.95%), Postives = 169/334 (50.60%), Query Frame = 3
Query: 1917 KEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSL--NVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERD 2912
            KE  RP N++++F+ GS++ L     E +          +A +  ST     S+    ++  N S       G G+ E     ++E F+D           G   + P              P R  + E++D++LL + T +I+ IS++  M+G ++P  FL    +S+ +D+ +A  L+   G+ NT GR+F        W ++      L INN  LI++G+   + P L +  G   + + ++G  ++ ++ L SI++ +L+G+  LTN+FG L++ +G+A+++GPP AG + D+    Y+  FYF G +++++G++   + FV K + D
Sbjct:  351 KEFQRPMNRQDIFYGGSIQNLKEFKEEGT----------MAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEE-EMIEPFVDD----------GCCKVLPL-------------PMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAI-VFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDIT-GSYDTAFYFGGLVLLVAGLISATIPFVTKKDAD 642          

HSP 2 Score: 112.849 bits (281), Expect = 3.324e-25
Identity = 80/215 (37.21%), Postives = 135/215 (62.79%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL----HLRMQQLSKIRSTIRQMRREEDE 1193
            PDGG+ W+IV A+F   + +DG    +        E +QE+D ++ ++ GSL+ G Y+ +GP+ SAL N+++ R V +AGG+ISGIA +++    N+  F++ +GV+GG+GF +IYLPAI +VG +F  KR +A G+++ GSG GTFL   +    I  + W+  I ++A + F C+ +  L+RPL +     +R Q++  +R  + ++  +EDE
Sbjct:   15 PDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLT-VFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPLPMVDLNEIRDQEMEPLRQALSKVEDDEDE 228          
BLAST of slc16a-18 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 122.094 bits (305), Expect = 4.136e-28
Identity = 90/334 (26.95%), Postives = 169/334 (50.60%), Query Frame = 3
Query: 1917 KEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSL--NVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERD 2912
            KE  RP N++++F+ GS++ L     E +          +A +  ST     S+    ++  N S       G G+ E     ++E F+D           G   + P              P R  + E++D++LL + T +I+ IS++  M+G ++P  FL    +S+ +D+ +A  L+   G+ NT GR+F        W ++      L INN  LI++G+   + P L +  G   + + ++G  ++ ++ L SI++ +L+G+  LTN+FG L++ +G+A+++GPP AG + D+    Y+  FYF G +++++G++   + FV K + D
Sbjct:  351 KEFQRPMNRQDIFYGGSIQNLKEFKEEGT----------MAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEE-EMIEPFVDD----------GCCKVLPL-------------PMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAI-VFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDIT-GSYDTAFYFGGLVLLVAGLISATIPFVTKKDAD 642          

HSP 2 Score: 112.849 bits (281), Expect = 3.324e-25
Identity = 80/215 (37.21%), Postives = 135/215 (62.79%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL----HLRMQQLSKIRSTIRQMRREEDE 1193
            PDGG+ W+IV A+F   + +DG    +        E +QE+D ++ ++ GSL+ G Y+ +GP+ SAL N+++ R V +AGG+ISGIA +++    N+  F++ +GV+GG+GF +IYLPAI +VG +F  KR +A G+++ GSG GTFL   +    I  + W+  I ++A + F C+ +  L+RPL +     +R Q++  +R  + ++  +EDE
Sbjct:   15 PDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLT-VFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPLPMVDLNEIRDQEMEPLRQALSKVEDDEDE 228          
BLAST of slc16a-18 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 122.094 bits (305), Expect = 4.595e-28
Identity = 90/334 (26.95%), Postives = 169/334 (50.60%), Query Frame = 3
Query: 1917 KEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSL--NVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERD 2912
            KE  RP N++++F+ GS++ L     E +          +A +  ST     S+    ++  N S       G G+ E     ++E F+D           G   + P              P R  + E++D++LL + T +I+ IS++  M+G ++P  FL    +S+ +D+ +A  L+   G+ NT GR+F        W ++      L INN  LI++G+   + P L +  G   + + ++G  ++ ++ L SI++ +L+G+  LTN+FG L++ +G+A+++GPP AG + D+    Y+  FYF G +++++G++   + FV K + D
Sbjct:  406 KEFQRPMNRQDIFYGGSIQNLKEFKEEGT----------MAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEE-EMIEPFVDD----------GCCKVLPL-------------PMRNALSEMIDLNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFF------GWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAI-VFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDIT-GSYDTAFYFGGLVLLVAGLISATIPFVTKKDAD 697          

HSP 2 Score: 113.62 bits (283), Expect = 2.447e-25
Identity = 80/215 (37.21%), Postives = 135/215 (62.79%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL----HLRMQQLSKIRSTIRQMRREEDE 1193
            PDGG+ W+IV A+F   + +DG    +        E +QE+D ++ ++ GSL+ G Y+ +GP+ SAL N+++ R V +AGG+ISGIA +++    N+  F++ +GV+GG+GF +IYLPAI +VG +F  KR +A G+++ GSG GTFL   +    I  + W+  I ++A + F C+ +  L+RPL +     +R Q++  +R  + ++  +EDE
Sbjct:   70 PDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLT-VFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPLPMVDLNEIRDQEMEPLRQALSKVEDDEDE 283          
BLAST of slc16a-18 vs. Ensembl Fly
Match: CG8468 (gene:FBgn0033913 transcript:FBtr0087534)

HSP 1 Score: 139.043 bits (349), Expect = 2.211e-33
Identity = 82/214 (38.32%), Postives = 123/214 (57.48%), Query Frame = 3
Query: 2283 RAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEK 2924
            R  +  +LD +LL SP F+ +  S   +M+G FVPF FL    K+  MD + A G++S +G+ NT  R+           S++P    LW+NNF L   G+       +I       F L  +G+C+A F +L+S++ VEL+G+ +LTNA+GFL++FQGLA   G P+AG +  +    Y   FYFAG +I+LS  LC+PL +V++ E    EK
Sbjct:  466 RRTLSTMLDTTLLKSPAFMCLAFSGFLTMMGFFVPFTFLVDRAKAAGMDEQAAYGVLSGIGVVNTFARIVCGSL------SSFPAVKPLWLNNFALTAGGIATICSGIVINTATQWTFAL-FFGICIACFSALRSLIAVELIGLEKLTNAYGFLMLFQGLAATFGSPIAGGLYVMT-GSYNAAFYFAGGLILLSAFLCYPLTWVSRWEERRNEK 671          

HSP 2 Score: 113.62 bits (283), Expect = 2.910e-25
Identity = 73/189 (38.62%), Postives = 116/189 (61.38%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQ-ENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PPD GWAW++++ASF C   IDG  F  GL+  ++M  F      ++F+   SLL+G Y+  GP  SA++N+F FRPV + G I + I   LS F  ++    + +GVLGGIGF ++Y+PA+ I+G +F + R +A G+A+ GSG GTF++  L   L++   W+  + +   +   C +F + FRP++
Sbjct:   43 PPDSGWAWVVMVASFLCCTVIDGIVFCSGLIQEQLMAEFGVSKAYVAFV--SSLLSGCYLMAGPFVSAMANRFGFRPVTITGAIFAAICFGLSYFATSVEYLFLIYGVLGGIGFCMVYIPAVVIIGFYFEKWRALATGVAMCGSGVGTFVFAPLTKILLK-SGWRYTLAIQGIIVLSCALFGLAFRPIQ 228          
BLAST of slc16a-18 vs. Ensembl Fly
Match: CG8468 (gene:FBgn0033913 transcript:FBtr0087532)

HSP 1 Score: 139.043 bits (349), Expect = 2.211e-33
Identity = 82/214 (38.32%), Postives = 123/214 (57.48%), Query Frame = 3
Query: 2283 RAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEK 2924
            R  +  +LD +LL SP F+ +  S   +M+G FVPF FL    K+  MD + A G++S +G+ NT  R+           S++P    LW+NNF L   G+       +I       F L  +G+C+A F +L+S++ VEL+G+ +LTNA+GFL++FQGLA   G P+AG +  +    Y   FYFAG +I+LS  LC+PL +V++ E    EK
Sbjct:  466 RRTLSTMLDTTLLKSPAFMCLAFSGFLTMMGFFVPFTFLVDRAKAAGMDEQAAYGVLSGIGVVNTFARIVCGSL------SSFPAVKPLWLNNFALTAGGIATICSGIVINTATQWTFAL-FFGICIACFSALRSLIAVELIGLEKLTNAYGFLMLFQGLAATFGSPIAGGLYVMT-GSYNAAFYFAGGLILLSAFLCYPLTWVSRWEERRNEK 671          

HSP 2 Score: 113.62 bits (283), Expect = 2.910e-25
Identity = 73/189 (38.62%), Postives = 116/189 (61.38%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQ-ENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PPD GWAW++++ASF C   IDG  F  GL+  ++M  F      ++F+   SLL+G Y+  GP  SA++N+F FRPV + G I + I   LS F  ++    + +GVLGGIGF ++Y+PA+ I+G +F + R +A G+A+ GSG GTF++  L   L++   W+  + +   +   C +F + FRP++
Sbjct:   43 PPDSGWAWVVMVASFLCCTVIDGIVFCSGLIQEQLMAEFGVSKAYVAFV--SSLLSGCYLMAGPFVSAMANRFGFRPVTITGAIFAAICFGLSYFATSVEYLFLIYGVLGGIGFCMVYIPAVVIIGFYFEKWRALATGVAMCGSGVGTFVFAPLTKILLK-SGWRYTLAIQGIIVLSCALFGLAFRPIQ 228          
BLAST of slc16a-18 vs. Ensembl Fly
Match: CG8468 (gene:FBgn0033913 transcript:FBtr0087533)

HSP 1 Score: 139.043 bits (349), Expect = 2.211e-33
Identity = 82/214 (38.32%), Postives = 123/214 (57.48%), Query Frame = 3
Query: 2283 RAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEK 2924
            R  +  +LD +LL SP F+ +  S   +M+G FVPF FL    K+  MD + A G++S +G+ NT  R+           S++P    LW+NNF L   G+       +I       F L  +G+C+A F +L+S++ VEL+G+ +LTNA+GFL++FQGLA   G P+AG +  +    Y   FYFAG +I+LS  LC+PL +V++ E    EK
Sbjct:  466 RRTLSTMLDTTLLKSPAFMCLAFSGFLTMMGFFVPFTFLVDRAKAAGMDEQAAYGVLSGIGVVNTFARIVCGSL------SSFPAVKPLWLNNFALTAGGIATICSGIVINTATQWTFAL-FFGICIACFSALRSLIAVELIGLEKLTNAYGFLMLFQGLAATFGSPIAGGLYVMT-GSYNAAFYFAGGLILLSAFLCYPLTWVSRWEERRNEK 671          

HSP 2 Score: 113.62 bits (283), Expect = 2.910e-25
Identity = 73/189 (38.62%), Postives = 116/189 (61.38%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQ-ENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PPD GWAW++++ASF C   IDG  F  GL+  ++M  F      ++F+   SLL+G Y+  GP  SA++N+F FRPV + G I + I   LS F  ++    + +GVLGGIGF ++Y+PA+ I+G +F + R +A G+A+ GSG GTF++  L   L++   W+  + +   +   C +F + FRP++
Sbjct:   43 PPDSGWAWVVMVASFLCCTVIDGIVFCSGLIQEQLMAEFGVSKAYVAFV--SSLLSGCYLMAGPFVSAMANRFGFRPVTITGAIFAAICFGLSYFATSVEYLFLIYGVLGGIGFCMVYIPAVVIIGFYFEKWRALATGVAMCGSGVGTFVFAPLTKILLK-SGWRYTLAIQGIIVLSCALFGLAFRPIQ 228          
BLAST of slc16a-18 vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0072593)

HSP 1 Score: 135.191 bits (339), Expect = 6.215e-32
Identity = 79/195 (40.51%), Postives = 120/195 (61.54%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQ 1142
            PPDGG+ W+I  ASF C + +DG  + +G+ + E +  F E    +  W GSLL+G Y+S GP+ SAL+N++  R V +AG II+ IA +LS+F  N+   +  +G +GG GF +IYLPA+  VG++F  KR +A G+A+ GSG GTF +  L   L+E   WK  +++ A +   C +F  + RPL    + +Q
Sbjct:   71 PPDGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGK-GTVAWVGSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFGAMMRPLTYPKKKKQ 264          

HSP 2 Score: 118.242 bits (295), Expect = 1.480e-26
Identity = 82/244 (33.61%), Postives = 133/244 (54.51%), Query Frame = 3
Query: 2283 RAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIE 3014
            ++ +  +LDVSLL  P F+++ +S++  M G++VPF +L    K  D+    A  L+S +G+ NT GR+F        W ++ P  + L +NN  L+++ +     P L   Y A + +   +GL ++G++SL SI++V+LLG+++LTNAFG L++F+G A +IG PLAG I D+  H Y+  FY AG++  +S I  F            +     R    EE  V   +   I+ E  E  E
Sbjct:  555 KSVVNTMLDVSLLKDPVFMLIGVSNIFGMAGLYVPFVYLVDAAKEHDIPKNDAAMLLSIIGITNTVGRVFC------GWVADLPQVNSLLLNNCCLLVSTIAVTLTP-LCYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAALIGTPLAGAIYDMT-HTYDLPFYMAGALFGISTITSF------------LAPCLKRCSPSEETPVHVETLTPIDEEQGEDAE 778          
BLAST of slc16a-18 vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0345005)

HSP 1 Score: 135.191 bits (339), Expect = 6.215e-32
Identity = 79/195 (40.51%), Postives = 120/195 (61.54%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQ 1142
            PPDGG+ W+I  ASF C + +DG  + +G+ + E +  F E    +  W GSLL+G Y+S GP+ SAL+N++  R V +AG II+ IA +LS+F  N+   +  +G +GG GF +IYLPA+  VG++F  KR +A G+A+ GSG GTF +  L   L+E   WK  +++ A +   C +F  + RPL    + +Q
Sbjct:   71 PPDGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGK-GTVAWVGSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFGAMMRPLTYPKKKKQ 264          

HSP 2 Score: 118.242 bits (295), Expect = 1.480e-26
Identity = 82/244 (33.61%), Postives = 133/244 (54.51%), Query Frame = 3
Query: 2283 RAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIE 3014
            ++ +  +LDVSLL  P F+++ +S++  M G++VPF +L    K  D+    A  L+S +G+ NT GR+F        W ++ P  + L +NN  L+++ +     P L   Y A + +   +GL ++G++SL SI++V+LLG+++LTNAFG L++F+G A +IG PLAG I D+  H Y+  FY AG++  +S I  F            +     R    EE  V   +   I+ E  E  E
Sbjct:  555 KSVVNTMLDVSLLKDPVFMLIGVSNIFGMAGLYVPFVYLVDAAKEHDIPKNDAAMLLSIIGITNTVGRVFC------GWVADLPQVNSLLLNNCCLLVSTIAVTLTP-LCYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAALIGTPLAGAIYDMT-HTYDLPFYMAGALFGISTITSF------------LAPCLKRCSPSEETPVHVETLTPIDEEQGEDAE 778          
BLAST of slc16a-18 vs. Ensembl Zebrafish
Match: slc16a9a (solute carrier family 16 member 9a [Source:ZFIN;Acc:ZDB-GENE-040426-1364])

HSP 1 Score: 90.8929 bits (224), Expect = 2.702e-18
Identity = 63/187 (33.69%), Postives = 103/187 (55.08%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL 1124
            DGGW W+IV+ASF       G+  + G+L PE +  FQE   M+  W GS+++G  +   PV SA  + F  RPV +  G++    ++LS+F  N+   I  +G++ G+G  L+Y   + I   +F ++R +A+G+   G+  G F+Y  L   LIE+   +GC+++I A+    +      RPL L
Sbjct:   11 DGGWGWMIVVASFMAQFLSFGSPQSVGVLYPEWLSAFQEGKGMT-AWVGSMVSGVALITSPVCSACVDNFGARPVTIFSGVMVAGGLMLSAFAPNISFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSVGGFIYATLQNELIELFGLEGCLLIIGALALNLMACAGPMRPLNL 196          

HSP 2 Score: 61.2326 bits (147), Expect = 5.037e-9
Identity = 40/144 (27.78%), Postives = 69/144 (47.92%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCF 2879
            L+S V +    G+L   +       ++  W + L++    LI +G     IP   +Y G  +    + G   +G  SL S +  +++G+ RL  A G L+ F G    +GPP+ GW  D     Y+  FY +G+ +++SG+  F
Sbjct:  338 LVSIVAMTTGIGKLILGVL------ADMRWVNSLYLYALTLIGSGTALLLIPVSKSYLGLQILSASV-GF-FSGNWSLTSYITTKIVGIERLGQAHGILMCFGGFGIALGPPVVGWFFDWT-QSYDLAFYLSGTCVLVSGVFLF 472          
BLAST of slc16a-18 vs. Ensembl Zebrafish
Match: slc16a9b (solute carrier family 16 member 9b [Source:ZFIN;Acc:ZDB-GENE-040801-69])

HSP 1 Score: 88.5817 bits (218), Expect = 1.171e-17
Identity = 63/188 (33.51%), Postives = 99/188 (52.66%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL 1124
            PDGGW W IV+ASF       G+  + G+L PE + TFQ++  M+  W GSL++G  +   P+ SA    F  RPV +  G++    ++LS+F  N+   I  +G++ G+G  L+Y   + I   +F ++R +A+G+   G+  G FLY       I +    GC++LI       +    L RPL L
Sbjct:   10 PDGGWGWAIVVASFMGQFLAYGSPQSVGVLYPEWLNTFQDSKGMT-AWVGSLVSGVGLIASPICSACVVNFGARPVTIFSGVMVSGGLMLSAFAPNVQFLIFSYGIVVGLGCGLVYAATVTITCQYFDKRRGLALGIVTTGTSVGGFLYAAAQNEFIALFGLDGCLLLIGCFALNIIACAGLMRPLHL 196          

HSP 2 Score: 67.0106 bits (162), Expect = 7.609e-11
Identity = 43/142 (30.28%), Postives = 75/142 (52.82%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVF--VLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSG 2867
            L+S + +A   G+L   + ++  W ++      +++    L+  GV    IP    Y G  V   VL  +    +G  S+   +  +++G++RLT A+G L+ F G + ++GPP+AGWI D   H Y+  FYF+G  ++L G
Sbjct:  320 LVSIMSIAAGVGKLLLGVMMDVRWMNS------IYLYAVTLLGTGVALLIIPVTKNYAGLQVISAVLGFF----SGNWSVIPYMTTKVVGMDRLTEAYGILMFFGGFSIMLGPPVAGWIYDW-MHSYDLAFYFSGGFVLLGG 450          
BLAST of slc16a-18 vs. Ensembl Zebrafish
Match: slc16a12a (solute carrier family 16 member 12a [Source:ZFIN;Acc:ZDB-GENE-080721-24])

HSP 1 Score: 82.8037 bits (203), Expect = 1.271e-15
Identity = 63/187 (33.69%), Postives = 97/187 (51.87%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PDGGW W+IV   F   +          +   E    F   D  +  W  SLL    M   P+ S + N+   R   + GG++S   +LLSS   ++    +  GVL G+GF+L Y PAIA+VG +F +++ +A G+A+ GSG GTF+    +  LIE  +W+G ++++A +     V   L RPL+
Sbjct:   66 PDGGWGWMIVAGCFLTTVCTRAVTRCVSIFFVEFQLYFSR-DYSATAWIHSLLDCTTMLCAPLGSYIGNRLSSRIAIMIGGLLSSTGLLLSSLATSVEFLYLTLGVLTGVGFALSYTPAIAMVGSYFRQRKALAYGIAMSGSGIGTFILAPAVQLLIEFFSWRGALLILAGLVSHLCVCGALMRPLQ 251          
BLAST of slc16a-18 vs. Ensembl Zebrafish
Match: slc16a12b (solute carrier family 16 member 12b [Source:NCBI gene;Acc:449947])

HSP 1 Score: 77.7962 bits (190), Expect = 3.579e-14
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL 1124
            PPDGGW W+IV   F   +          +   E    F + D     W  SL+    M   P+ S + NQ   R   + GG ++ + ++LSSF  +L       G+L G+GF+L Y PAIA+VG +F E++ +A G+A+ GSG GTF+   ++  LIE  +W+G ++++        V   L RP+ L
Sbjct:   23 PPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFAK-DYSGTAWIHSLVDCTTMLCAPLGSLIGNQLSCRIAVILGGFLASVGLVLSSFATSLEYLYATLGLLTGLGFALCYTPAIAMVGIYFCERKALAYGIAMSGSGIGTFILAPVVQLLIEHYSWRGALLILGGFVLNLCVCGALLRPIIL 210          
BLAST of slc16a-18 vs. Ensembl Zebrafish
Match: BX511087.3 (solute carrier family 16 member 12a [Source:NCBI gene;Acc:557762])

HSP 1 Score: 75.8702 bits (185), Expect = 7.820e-14
Identity = 65/209 (31.10%), Postives = 106/209 (50.72%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREE 1187
            PDGGW W+IV   F   +          +   E  + +   D  +  W  SLL    M   P+ S + N+   R   + GG++S   +LLSS   ++    +  GVL G+GF+L Y PAIA+VG +F +++ +A G+A+ GSG GTF+    +  LIE  +W+G ++++A +         L RPL+  L  +    + S +R+   +E
Sbjct:    6 PDGGWGWMIVAGCFLTTVCTRAVTRCVSIFFVEF-QLYFSRDYSATAWIHSLLDCTTMLCAPLGSYIGNRLSSRIAIMIGGLLSSTGLLLSSLATSVEFLYLTLGVLTGVGFALSYTPAIAMVGSYFRQRKALAYGIAMSGSGIGTFILAPAVQLLIEFFSWRGALLILAGLVSHLCFCGALMRPLQTKLLKESKENVWSVLRKTVLKE 213          
BLAST of slc16a-18 vs. Ensembl Xenopus
Match: atf6b (activating transcription factor 6 beta [Source:Xenbase;Acc:XB-GENE-1013925])

HSP 1 Score: 84.3445 bits (207), Expect = 4.648e-16
Identity = 67/193 (34.72%), Postives = 106/193 (54.92%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPL---ELHLR 1133
            D GWAW++VL+SF   + + G+    G+L  E +E F+++  ++  W  SL  G  + +GP+     N    R  A+ GG ++ +  +LS++  N+      FGV  GIG  ++YLPA+  VGH+F ++R +A GL+  G+G GTFL   L+  L   + W+  +I+  AV     V   L RPL   E HL+
Sbjct:   30 DRGWAWMVVLSSFLVHLLVMGSQMALGILNLEWLEEFKQSRGLT-AWISSLSMGITLIVGPIIGLFINTCGCRKTAMIGGFLTSLGWVLSAYAPNVHFLFFSFGVTAGIGSGMVYLPAVVTVGHYFQKRRALAQGLSTTGTGFGTFLITVLLKYLCRELGWRNAMIIQGAVTLNLCVCGALMRPLDHDEEHLK 221          

HSP 2 Score: 68.1662 bits (165), Expect = 4.832e-11
Identity = 40/111 (36.04%), Postives = 66/111 (59.46%), Query Frame = 3
Query: 2556 NNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLR 2888
            +NF L   GV+   +P L+  Y +L  V  L G   +G+ SL  ++  +L+G+ +L NA+G ++   G++ ++GPP AGWI D+   KY+Y FY  G ++ + GI+C  L 
Sbjct:  391 SNFTL---GVSILILP-LMHVYSSLALVCALIGFS-SGYFSLMPVVTEDLVGIKQLANAYGIIICANGISALLGPPFAGWIYDIT-QKYDYSFYVCG-LLYMVGIICLLLE 494          
BLAST of slc16a-18 vs. Ensembl Xenopus
Match: slc16a12 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:394932])

HSP 1 Score: 82.0333 bits (201), Expect = 4.940e-16
Identity = 63/190 (33.16%), Postives = 101/190 (53.16%), Query Frame = 3
Query:  555 GPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL 1124
             PPDGGW W+IV+  FF  +          +   E    F + D     W  S++    M   P+ S +SN F  +   + GG+++   ++LSSF  +L    +  GVL G+GF+L Y PAIA+VG +F +++ +A G+A+ GSG GTF+   ++  LIE  +W+G ++++        V   L RP+ L
Sbjct:   11 APPDGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQ-DYARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGALMRPITL 199          
BLAST of slc16a-18 vs. Ensembl Xenopus
Match: mad2l1 (mitotic arrest deficient 2 like 1 [Source:Xenbase;Acc:XB-GENE-947153])

HSP 1 Score: 77.411 bits (189), Expect = 5.808e-14
Identity = 67/190 (35.26%), Postives = 106/190 (55.79%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSF---MWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPL 1118
            PPDGGW W++VL +F  M    G  + +   +    +  QE+   S+    W  S+L     + GPV+S L N++  RPV + GG++SG+ +++++F +++L   IF GV+ G GFSL   P++ +VG +F +KRPIA GLA+ GS         L   L +   W+G   ++ A+   C V   LFRP+
Sbjct:   13 PPDGGWGWMVVLGAFISM----GFSYAFSKAITVFFKEIQEHFGASYSEIAWISSILLAAMYAGGPVSSILVNRYGSRPVVIFGGLLSGVGMIIATFSSSILQLYIFIGVIAGFGFSLNLQPSVIVVGKYFLKKRPIANGLAMAGSPVVLSTLAPLNQFLFDKFGWRGSFFILGALLLNCCVAGALFRPI 198          
BLAST of slc16a-18 vs. Ensembl Xenopus
Match: ppp2r3a (protein phosphatase 2 regulatory subunit B'', alpha [Source:Xenbase;Acc:XB-GENE-483068])

HSP 1 Score: 74.7146 bits (182), Expect = 4.852e-13
Identity = 65/204 (31.86%), Postives = 107/204 (52.45%), Query Frame = 3
Query:  537 AETAPMG--PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFM--------WPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPL 1118
            A   P+G  PP+GGW W++V+A+F   ++I    F+Y    P+ +  F + DI +          W  S++     + GP++S L N++  RPV +AGG ++G  ++ +SF N +    +  GV+GG G +    PA+ ++G +F +KRPIA GLA+ GS         L      I  W+G  +++  + F C V   L RP+
Sbjct:    4 AVGGPVGYTPPEGGWGWVVVVAAF---VSIG---FSYAF--PKSITVFFK-DIEAIFGATSSEVSWISSIMLAVMYAGGPISSVLVNKYGSRPVMIAGGCLAGTGLIAASFCNTVAELYLCIGVVGGFGLAFNLNPALTMIGKYFFKKRPIANGLAMAGSPVFLSTLAPLNQYFYSIFGWRGSFLILGGLLFNCCVAGSLMRPI 198          
BLAST of slc16a-18 vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 71.2478 bits (173), Expect = 5.399e-12
Identity = 62/193 (32.12%), Postives = 100/193 (51.81%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYG------LLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPL 1118
            PPDGGW W++V  SF   I+I    F+Y       +   E+ E F  +      W  S++     + GP++S L N++  RPV + GG++  +A++ +SF N+++   I  GV+GG G +    P++ I+G +F +KRPIA GLA+ GS         L   L     W+G  +++  +   C V   L RP+
Sbjct:   12 PPDGGWGWVVVFGSF---ISIG---FSYAFPKAITVFFKEIQEIFNTS-YSEIAWISSIMLAVMYAGGPISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGFGLAFNLQPSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLNQFLFNQFGWRGSFLILGGLLLNCCVAGSLMRPI 197          
BLAST of slc16a-18 vs. Ensembl Mouse
Match: Slc16a4 (solute carrier family 16 (monocarboxylic acid transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385183])

HSP 1 Score: 83.1889 bits (204), Expect = 8.148e-16
Identity = 62/206 (30.10%), Postives = 103/206 (50.00%), Query Frame = 3
Query: 2295 RELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERD 2912
            ++LLD+SL  +P F I   S + S +  F+P + L    K+L +D+  A  L+S  G+  T  +L +    ++ W   Y +      +   LIL GVT    P L T +  L+    L+ +   G+++L   ++V+L   +R+    G+   F G+A + GPP+AGWI D     Y   FYF+G+  ILS +  F +    + +R 
Sbjct:  293 QKLLDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDVMDASYLVSVAGITETVSQLISGWIADQNWIKKYQY------HKSYLILCGVTNLLAP-LATTFPLLMAYTILFAIFAGGYLALILPVLVDLSKNSRVHKFLGYASFFAGIAVLSGPPIAGWIYDYT-QTYTGSFYFSGTCYILSSVSLFFVPLAERWKRK 490          
BLAST of slc16a-18 vs. Ensembl Mouse
Match: Slc16a9 (solute carrier family 16 (monocarboxylic acid transporters), member 9 [Source:MGI Symbol;Acc:MGI:1914109])

HSP 1 Score: 82.0333 bits (201), Expect = 1.555e-15
Identity = 62/187 (33.16%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PDGGW W+IV+ SFF      G+    G+L  E ++ F E    +  W GSL +G  +   PV S   + F  RPV +  G +    ++LSS   N+      +G++ G+G  L+Y   + I   +F  +R +A+GL   GS  G F+Y  L   LIE     GC++++ A+    L    L RPL+
Sbjct:    7 PDGGWGWVIVVVSFFTQFLSYGSPLAVGVLYVEWLDAFGEGKGKT-AWVGSLASGVGLLASPVCSLFVSSFGARPVTIFSGFLVAGGLMLSSLAPNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDSRRGLALGLISTGSSVGLFIYAALQRMLIEFYGLDGCLLIVGALALNILACGSLMRPLQ 192          

HSP 2 Score: 68.9366 bits (167), Expect = 1.938e-11
Identity = 42/142 (29.58%), Postives = 74/142 (52.11%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGIL 2873
            LIS  G+    G+L   I       +++ W + L++    LI+ G+  C+IPF  +Y   L  +  + G  + G  S+   +  + +G+++L +A+G L+ F GL   +GPP+ GW  D     Y+  FYF+G  ++L G +
Sbjct:  343 LISIFGIMTAVGKLLLGIL------ADFKWINTLYLYVATLIITGLALCAIPFAKSYV-TLAILSGILGF-LTGNWSIFPYVTTKTVGIDKLAHAYGILMFFAGLGNSLGPPIVGWFYDWT-QTYDIAFYFSGFCVLLGGFI 475          
BLAST of slc16a-18 vs. Ensembl Mouse
Match: Slc16a14 (solute carrier family 16 (monocarboxylic acid transporters), member 14 [Source:MGI Symbol;Acc:MGI:1919031])

HSP 1 Score: 81.6481 bits (200), Expect = 2.512e-15
Identity = 65/186 (34.95%), Postives = 102/186 (54.84%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            DGGWAW++VL+SFF  I I G+    G+L  E +E F ++  ++  W  SL  G  + +GP      N    R  A+ GG+++ +  +LS++  N+ +  I FGV  G+G  + YLPA+ +VG +F ++R +A GL+  G+G GTFL   L+  L     W+  + +  A+     V   L RPL 
Sbjct:   31 DGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRGLT-AWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVQSLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMFIQGALSLNLCVCGALMRPLS 215          

HSP 2 Score: 60.4622 bits (145), Expect = 9.279e-9
Identity = 37/107 (34.58%), Postives = 62/107 (57.94%), Query Frame = 3
Query: 2553 INNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGIL 2873
            I NF L+L+      +P + TY  +L  +  L G   +G+ SL  ++  +L+G   L NA+G ++   G++ ++GPP AGWI D+   KY++ FY  G ++ + GIL
Sbjct:  389 IANFTLVLSIFL---LPLMHTY-ASLAVICALIGFS-SGYFSLMPVVTEDLVGTEHLANAYGIIICANGISALLGPPFAGWIFDIT-QKYDFSFYICG-LLYMVGIL 488          
BLAST of slc16a-18 vs. Ensembl Mouse
Match: Slc16a12 (solute carrier family 16 (monocarboxylic acid transporters), member 12 [Source:MGI Symbol;Acc:MGI:2147716])

HSP 1 Score: 80.1073 bits (196), Expect = 6.999e-15
Identity = 62/189 (32.80%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL 1124
            PPDGGW W+IV   F   I          +   E  +T+   D     W  S++    M   P+ S +SNQ   +   + GG+++    +L SF  +L    +  GVL G+GF+L Y PAIA+VG +F  ++ +A G+A+ GSG GTF+   ++  LIE  +W+G ++++        V   L RP+ L
Sbjct:   12 PPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEF-QTYFAQDYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITL 199          

HSP 2 Score: 55.8398 bits (133), Expect = 2.329e-7
Identity = 45/177 (25.42%), Postives = 81/177 (45.76%), Query Frame = 3
Query: 2388 FYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYI 2918
            F +L  Y  S+ +    A  L+S +G+ +  G +      ++    NY +   L    F + L G+    +P L T+   LV   C +G     +V+L  ++  E++G   L++A G +     +  ++ PP+AGW+ D     Y   F   G  +I S IL   +R V +++R  +
Sbjct:  271 FVYLVPYALSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDRRCLKNYRYVCYL----FAVALDGLCYLCLPMLQTF-PLLVPFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTT-GSYTAAFLLCGFAMIFSSILLGFVRIVKRMKRTQV 441          
BLAST of slc16a-18 vs. Ensembl Mouse
Match: Slc16a11 (solute carrier family 16 (monocarboxylic acid transporters), member 11 [Source:MGI Symbol;Acc:MGI:2663709])

HSP 1 Score: 74.3294 bits (181), Expect = 2.200e-14
Identity = 64/192 (33.33%), Postives = 104/192 (54.17%), Query Frame = 3
Query:  549 PMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL 1124
            P GPPDGGW W++  A+F       G   + GL +P++ E F E       W  +L      +  PV SALS ++  RPV + GG+++ + ++ S+F  +LL   +  G+L G G++L++ PA+  +  +F  +R +AVGLAL G+G  + L    +  L++   W+G ++L+ AV         L RPL L
Sbjct:    5 PAGPPDGGWGWVVAAAAFAVNGLSYGLLRSLGLALPDLAEHF-ERSAQDTAWVSALALAVQQAASPVGSALSTRWGARPVVMVGGVLTSLGLVFSAFARSLLHLYLGLGLLAGSGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGASSLLLAPALQFLLDTFGWRGALLLLGAVTLHLTPCGALLRPLAL 195          
BLAST of slc16a-18 vs. UniProt/SwissProt
Match: sp|Q5ZJU0|MOT9_CHICK (Monocarboxylate transporter 9 OS=Gallus gallus OX=9031 GN=SLC16A9 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.567e-17
Identity = 65/188 (34.57%), Postives = 99/188 (52.66%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PPDGGW W+IV+ SFF      G+    G+L  E ++ F E    +  W GSL  G  +   PV S   + F  RPVA+  G +    +++SSF  N+    + +G++ G+G  L+Y   + I   +F ++R +A+GL   GS  G F+Y  L   LIE+    GC++++ A+    L    L RPLE
Sbjct:    6 PPDGGWGWVIVIVSFFTQFLCYGSPLAVGVLYLEWLDAFGEGKGKT-AWVGSLANGIGLLASPVCSICVSSFGARPVAIFSGFMVAGGLMMSSFAPNIYFLYLSYGIVVGLGCGLLYNATVTITCQYFDKRRGLALGLISTGSSVGLFIYAALQRELIELYGLDGCLLIVGALSLNILACGSLMRPLE 192          

HSP 2 Score: 56.9954 bits (136), Expect = 7.766e-7
Identity = 38/133 (28.57%), Postives = 70/133 (52.63%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAG 2846
            L+S +G+    G+L   I       +++ W + L++    L++ G    +IPF  +Y+  L  +  + G  + G  S+   +  + +G+ +LT+A+G L+ F GL   +GPP+ GW  D    +Y+  FYF+G
Sbjct:  343 LVSIIGIMTAIGKLILGIL------ADFKWVNTLYLYVLTLLMMGAALLAIPFARSYF-TLAVLSGILGF-LTGNWSIFPYVTTKTVGIEKLTHAYGILMFFAGLGNSLGPPIVGWFYDWT-QEYDTAFYFSG 466          
BLAST of slc16a-18 vs. UniProt/SwissProt
Match: sp|Q7RTX9|MOT14_HUMAN (Monocarboxylate transporter 14 OS=Homo sapiens OX=9606 GN=SLC16A14 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.249e-15
Identity = 73/223 (32.74%), Postives = 113/223 (50.67%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE-------------LHLRMQQLSKIRSTIRQMRREEDE 1193
            DGGWAW++VL+SFF  I I G+    G+L  E +E F ++  ++  W  SL  G  + +GP      N    R  A+ GG+++ +  +LS++  N+    I FGV  G+G  + YLPA+ +VG +F ++R +A GL+  G+G GTFL   L+  L     W+  +++  AV     V   L RPL                L       ++ST +Q R EE +
Sbjct:   29 DGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRGLT-AWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKD 250          

HSP 2 Score: 63.5438 bits (153), Expect = 7.874e-9
Identity = 40/130 (30.77%), Postives = 72/130 (55.38%), Query Frame = 3
Query: 2553 INNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCF----PLRFVAKLERDYIEKRY 2930
            + NF L+L+      +P + TY G L  +  L G   +G+ SL  ++  +L+G+  L NA+G ++   G++ ++GPP AGWI D+   KY++ FY  G ++ + GIL       +R + +  R Y++  +
Sbjct:  387 LANFTLVLSIFI---LPLMHTYAG-LAVICALIGFS-SGYFSLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDIT-QKYDFSFYICG-LLYMIGILFLLIQPCIRIIEQSRRKYMDGAH 509          
BLAST of slc16a-18 vs. UniProt/SwissProt
Match: sp|Q5R5M4|MOT9_PONAB (Monocarboxylate transporter 9 OS=Pongo abelii OX=9601 GN=SLC16A9 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.338e-15
Identity = 62/187 (33.16%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PDGGW W+IV  SFF      G+    G+L  E ++ F E    +  W GSL +G  +   PV S   + F  RPV +  G +    ++LSSF  N+      +G++ G+G  L+Y   + I   +F ++R +A+GL   GS  G F+Y  L   L+E     GC++++ A+    L    L RPL+
Sbjct:    7 PDGGWGWVIVFVSFFTQFLCYGSPLAVGVLYIEWLDAFGEGKGKT-AWVGSLASGVGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLLYTATVTITCLYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQ 192          

HSP 2 Score: 71.2478 bits (173), Expect = 3.221e-11
Identity = 43/142 (30.28%), Postives = 74/142 (52.11%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGIL 2873
            LIS +G+    G+L   I       +++ W + L++    LI+ G+  C+IPF  +Y   L  +  + G  + G  S+   +  + +G+ +L +A+G L+ F GL   +GPP+ GW  D     YE  FYF+G  ++L G +
Sbjct:  345 LISIIGIMTAVGKLLLGIL------ADFKWINTLYLYVATLIIMGLALCAIPFAKSYV-TLALLSGILGF-LTGNWSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWT-QTYEIAFYFSGFCVLLGGFI 477          
BLAST of slc16a-18 vs. UniProt/SwissProt
Match: sp|Q8R0M8|MOT5_MOUSE (Monocarboxylate transporter 5 OS=Mus musculus OX=10090 GN=Slc16a4 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.700e-15
Identity = 62/206 (30.10%), Postives = 103/206 (50.00%), Query Frame = 3
Query: 2295 RELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERD 2912
            ++LLD+SL  +P F I   S + S +  F+P + L    K+L +D+  A  L+S  G+  T  +L +    ++ W   Y +      +   LIL GVT    P L T +  L+    L+ +   G+++L   ++V+L   +R+    G+   F G+A + GPP+AGWI D     Y   FYF+G+  ILS +  F +    + +R 
Sbjct:  293 QKLLDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDVMDASYLVSVAGITETVSQLISGWIADQNWIKKYQY------HKSYLILCGVTNLLAP-LATTFPLLMAYTILFAIFAGGYLALILPVLVDLSKNSRVHKFLGYASFFAGIAVLSGPPIAGWIYDYT-QTYTGSFYFSGTCYILSSVSLFFVPLAERWKRK 490          
BLAST of slc16a-18 vs. UniProt/SwissProt
Match: sp|Q7RTY1|MOT9_HUMAN (Monocarboxylate transporter 9 OS=Homo sapiens OX=9606 GN=SLC16A9 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.902e-15
Identity = 61/187 (32.62%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PDGGW W+IV  SF       G+    G+L  E ++ F E    +  W GSL +G  +   PV S   + F  RPV +  G +    ++LSSF  N+      +G++ G+G  L+Y   + I   +F ++R +A+GL   GS  G F+Y  L   L+E     GC++++ A+    L    L RPL+
Sbjct:    7 PDGGWGWVIVFVSFLTQFLCYGSPLAVGVLYIEWLDAFGEGKGKT-AWVGSLASGVGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQ 192          

HSP 2 Score: 69.707 bits (169), Expect = 8.436e-11
Identity = 42/142 (29.58%), Postives = 74/142 (52.11%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGIL 2873
            LIS +G+    G+L   I       +++ W + L++    LI+ G+  C+IPF  +Y   L  +  + G  + G  S+   +  + +G+ +L +A+G L+ F GL   +GPP+ GW  D     Y+  FYF+G  ++L G +
Sbjct:  345 LISIIGIMTAVGKLLLGIL------ADFKWINTLYLYVATLIIMGLALCAIPFAKSYV-TLALLSGILGF-LTGNWSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWT-QTYDIAFYFSGFCVLLGGFI 477          
BLAST of slc16a-18 vs. TrEMBL
Match: A0A0H3YK72 (Slc16a-18 OS=Schmidtea mediterranea OX=79327 GN=slc16a-18 PE=2 SV=1)

HSP 1 Score: 1908.65 bits (4943), Expect = 0.000e+0
Identity = 1061/1061 (100.00%), Postives = 1061/1061 (100.00%), Query Frame = 3
Query:   42 MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESYAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWXXXXXXXXXXXXXXXXXLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHXXXXXXXXXXXXXXXXXXXXXXXRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQXXXXXXXXXXXXXXXXXXXXLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ 3224
            MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESYAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ
Sbjct:    1 MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESYAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ 1061          
BLAST of slc16a-18 vs. TrEMBL
Match: A0A5K3EX04 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 2.475e-74
Identity = 211/605 (34.88%), Postives = 291/605 (48.10%), Query Frame = 3
Query:  219 NKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEM--HQKCQPNDSSVYNNAWXXXXXXXXXXXXXXXXXLTNNNGPYFTDPSPYKQMIDPYQEGDIQ--AMAAETAPM---------GPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVP----------------------------------------------EMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTI---RQMRREEDEHXXXXXXXXXXXXXXXXXXXX-------------------XXXRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKM-------------------------------NKHGPNGVVSIVDS-------KNGGINGSSNMTN-NQLKNSLSQLVQEYINSQMSLQVWN 1673
             +D   + V   L + E E+ Q EANEETT+SEDLR FLQEM  H   Q       +         +  ++    +   +  G          Q +     G  Q  A+AA+   M           PDGGW W++V +SF CMI +DG    YGLLV                                               EM E        + M PG LL G Y+ +GP+ASALSNQFDFRPVA+AGG++S I ++ ++F  N+       G++GGIGF LIYLPAIA VGHWF  +RP AVGLAL GSG GT + GQ++P L+   TW G +I++AA C QCL  IVLFRPL+LHLR++   ++R      R+ +R  D     +  +    +   +   K                    +     +   +R VIYRGSIMQ+IIEEK+RQRTVS+GSLDGMVITRDNELI    + +     PIL+  +I RI+E+V++++E ++                               N   P   V   D+       K+ G+   + ++  N ++ SL QLVQ+Y+ SQ S+ V N
Sbjct:   54 GEDSPQQTVYGPLSKEETEQLQLEANEETTKSEDLRLFLQEMRQHVSQQTQLQQQQHQQHHHHSQQIGSATQMCGSAYDHLKGSSAVSHQLQHQTLTRGVGGAQQSGALAAQKRSMLADQDYIMDTAPDGGWGWIVVFSSFVCMILVDGISLCYGLLVAPTCPGNSLQALEKAHPKPLTATSLGILWPSKAREIPVRAGSCVGISEMGEALGTQSRSALMIPGGLLVGIYLLLGPLASALSNQFDFRPVAMAGGVVSTIGLVAAAFSTNVQVLHGTLGIIGGIGFGLIYLPAIATVGHWFKRRRPFAVGLALCGSGVGTVIGGQVLPLLVNWFTWSGTLIVLAAFCLQCLTLIVLFRPLDLHLRIKHYQRVRRQAAWDRERQRNADTRVHEQRVRRRALKIDVESTTKAHAAAIAAAARAQASQARAAKKALKAQKAQQRRVIYRGSIMQRIIEEKRRQRTVSVGSLDGMVITRDNELI---AAPLVADRPPILTAASITRISEAVMRKMEARLAGWHDGGTIASGGGGGAGVITDTPTPVRCDSNTSQPPLEVLNADTRTSSPSRKSSGLTSHAALSRLNLVRESLPQLVQDYVQSQASIAVQN 655          
BLAST of slc16a-18 vs. TrEMBL
Match: A0A564XXD5 (Uncharacterized protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS895 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.246e-70
Identity = 180/469 (38.38%), Postives = 247/469 (52.67%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLL-----------------------------------------------------VPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHXXXXXXXXXXXXXXXXXXXXXXXRNNNRMKNK----------------------------RIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHG--PNGVVSIVD---------------SKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWN 1673
            PDGGW W++V ASF CMI ++G C +Y LL                                                     V EM E  +    ++ M PG +L G Y+ +GP+ASALSNQFDFRPVA+AGG+I+ I +  S+F  N+    I  G +GGIGF LIYLPAIA VGHWF  +RP  VGLAL GSG G+ + GQ+ P LI   TW G ++++AA C QCLV IVLFRPL+LHLR++   K+R   RQ  +E++           +  ++R +      RN + M+ K                            R VIYRGSIMQ+IIEEK+RQRTVS+GSLDGMVITRDNELI    + +     P+L+  +I RI+++V++++E +++      +G  S                  S+ G   GS  +  N ++ SL QLVQ+Y+ SQ S+ + N
Sbjct:   58 PDGGWGWIVVFASFVCMILVEGICLSYSLLVAPICPGNSLRAVAPSTRSAHQSASGVATATSLGIVWSTKARLVPIRPGSCVGVSEMGELLKTQSRLALMAPGGMLMGLYILLGPLASALSNQFDFRPVAMAGGVIATIGLFASAFSTNIAILCITLGGIGGIGFGLIYLPAIATVGHWFKHRRPFVVGLALCGSGVGSIITGQVFPLLISEFTWSGALVILAAFCAQCLVLIVLFRPLDLHLRIKYSQKLR---RQAAKEKERQ------LAAKHRQQRSEKRHRMDRNESAMRAKTQNQAIMRAQATQARAAKKALKAQKAQQRRVIYRGSIMQRIIEEKRRQRTVSIGSLDGMVITRDNELI---AAPLVAERPPLLTAASITRISDAVMRKMEARLSAAACPSDGSASAGGETPIRCDSNVSQPSLSRKGSHAGSGLLRLNLVRESLPQLVQDYVQSQASIALQN 514          

HSP 2 Score: 158.688 bits (400), Expect = 2.549e-35
Identity = 129/404 (31.93%), Postives = 198/404 (49.01%), Query Frame = 3
Query: 1875 LEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVY--GNAYLDPXXXXXXXXXXXXDGPFRAFM------RELLDVSL------------------LTSP-----------------TFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSM-----------------IILSGILCFPLRFVAKLE 2906
            L+   +A +Q  LRKE+ RP  +K+LFFTGS +QL +  T  S+IP  +   +   W   TKR Q++ ++    +    +   +  G N + +I    GF  +  S  +G V   GNA  + N   V +    + G   A +       E++ ++L                   +SP                 TFI +++S+V +M G+ VP+  +P  +   +  L  AG +ISY+G ANT GR  AT+YIEKAWSS+Y W DCL +N   L+LAG+    +P     Y  +V +   +GL  A  VSLKSILVVE  G+++LTNAFG +L+ QGL+++IG  + G I D+   +  +   +AG                    +L+ I   PLR ++K E
Sbjct:  621 LDGEVRAEVQHRLRKELMRPQYKKDLFFTGSAQQLDH--TPVSAIPLGD---AGNLW---TKRDQSNWDIGPVSHNPTTAHNVIFTGPNPTTSI---RGFNPETDSTTTGTVIIPGNAVTNINSAGVPSSTKVSHGKGEASIMDFEEGEEMMSLTLPQEDRNEEDSSSRKRCGCFSSPIMAFLEELLSPGLLLSPTFIFLLLSNVFTMWGLLVPYLMIPDIVAENNWTLHEAGSIISYIGFANTIGRCIATLYIEKAWSSHYKWLDCLRVNVASLLLAGIACAVLPLAACSYNCIVAMASFFGLFSAIVVSLKSILVVEFFGLDKLTNAFGHMLVVQGLSSIIGAIVGGHIFDVVAARAPHFLPWAGDQAPFVYAAEAAFFFAAGSFLLAAIFAAPLRALSKKE 1013          
BLAST of slc16a-18 vs. TrEMBL
Match: A0A068Y313 (Monocarboxylate transporter OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000358600 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 3.786e-70
Identity = 213/609 (34.98%), Postives = 301/609 (49.43%), Query Frame = 3
Query:  195 DDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQP---------------NDSSVYNNAWXXXXXXXXXXXXXXXXXLT--NNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVP---------------------------------------------------EMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHXXXXXXXXXXXXXXXXXXXXXXXRNNNRM-----------------------KNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNK------------HGPNGVVSIVDS---------KNGGINGSSNMTN----NQLKNSLSQLVQEYINSQMSLQVWN 1673
            D + +       + + +   L + E E+ QREANEETT+SEDLR FLQEM Q  Q                + S ++ ++          +S  S       +N  P  T     + +  P Q+  I +          PDGGW W++V +SF CMI ++G C +YGLLV                                                    EM E       M+ M PG LL G Y+ +GP+ASALSNQFDFRPVA+AGG+I+ + +L ++F  N+       G +GGIGF LIYLPAIA VGHWF  +RP AVGLAL GSG G+ + GQ++P L++  +W G +I++AA C QCLV IVLFRPL+LH R++     R   RQ  RE++        ++    ++  KAE  E     ++                       + +R VIYRGSIMQ+IIEEK+RQRTVS+GSLDGMVITRDNELI    + +     P+L+  +I RI+E+V++++E ++               G +      DS         K+  +  +S+ T     N ++ SL QL+Q Y+ SQ S+ V N
Sbjct:   31 DSVAHRIAEDGSQGKIIFGPLSKEESEQIQREANEETTKSEDLRLFLQEMRQHMQQQQQQQQQQQQQYQVGSTSQMFGSSGVSHHQLQHQTSTRSHVLQQAFSNTTPANTQ---KRSVAGPEQDNVIDSS---------PDGGWGWIVVFSSFVCMILVEGICLSYGLLVAPICPGNSLQAVEITTSFLSRSRLLTATSLGIVWSSKARTIPLRPGTCVGFSEMGEALGTQSRMALMAPGGLLVGIYLLLGPLASALSNQFDFRPVAMAGGVIATVGLLTAAFSTNVAMLDATLGCIGGIGFGLIYLPAIATVGHWFKRRRPFAVGLALCGSGVGSIVGGQVLPLLLQWFSWSGTLIVLAAFCMQCLVLIVLFRPLDLHFRIKYYQNQR---RQTAREKERRDAHVSTEQQRRRRRPVKAEASEAAARAKVQAMARAQAAQARAAKKALKAQKAQQQRRVIYRGSIMQRIIEEKRRQRTVSIGSLDGMVITRDNELI---AAPLVADRPPLLTAASITRISEAVMRKMEARLAACQEGDGDGGDANSGGDATPVRCDSNVSQPSLSRKSSTLANTSHATGLSRLNLVRESLPQLIQSYVQSQASIAVQN 621          

HSP 2 Score: 165.622 bits (418), Expect = 1.850e-37
Identity = 100/235 (42.55%), Postives = 135/235 (57.45%), Query Frame = 3
Query: 2277 PFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHK-----------------YEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRY 2930
            P   F+ ELL   LL SPTFI +++S+V +M G+ +P++ LP  +   +     AG LISY+G ANT GR  AT+YIEKAWSS+Y WADCL +N   L LAGV     P +   Y  L+   CL+GL  A  VSLKSILVVEL G+++LTNAFG +L+ QG+A++ G  + G + D    K                  E  FYFAG   +L+ +    LR++A   R+ I   Y
Sbjct:  942 PILTFLEELLAPGLLLSPTFICLLLSNVFTMWGLIIPYFMLPDMVAENNWTPYEAGSLISYIGFANTIGRCIATLYIEKAWSSHYKWADCLRVNVASLFLAGVACGMAPLVGRSYNLLICFGCLFGLFSAVVVSLKSILVVELFGLDKLTNAFGHMLVLQGVASIAGTIIGGHLFDTLASKAPDFTPLLNSNTPLVYAAETCFYFAGGSFLLAALFASSLRYLAN--REVISATY 1174          
BLAST of slc16a-18 vs. TrEMBL
Match: A0A068WV90 (Monocarboxylate transporter OS=Echinococcus granulosus OX=6210 GN=EgrG_000358600 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 4.215e-70
Identity = 207/602 (34.39%), Postives = 297/602 (49.34%), Query Frame = 3
Query:  195 DDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEM--HQKCQPNDSSVYNNAWXXXXXXXXXXXXXXXXXLTNNNGPY-------FTDPSPY----KQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVP---------------------------------------------------EMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHXXXXXXXXXXX--------------------XXXXXXXXXXXXRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMN---------------------KHGPNGVVSIVDSKNGGINGSSNMTN----NQLKNSLSQLVQEYINSQMSLQVWN 1673
            D + +       + + +   L + E E+ QREANEETT+SEDLR FLQEM  H + Q               S +  SS  S  +L +            F++ +P     + +  P Q+  I +          PDGGW W++V +SF CMI ++G C +YGLLV                                                    EM E       M+ M PG LL G Y+ +GP+ASALSNQFDFRPVA+AGG+I+ + +L ++F  N+       G +GGIGF LIYLPAIA VGHWF  +RP AVGLAL GSG G+ + GQ++P L++  +W G +I++AA C QCLV IVLFRPL+LH R++     R    + +   D H   E ++                         +  +    ++     + + +R VIYRGSIMQ+IIEEK+RQRTVS+GSLDGMVITRDNELI    + +     P+L+  +I RI+E+V++++E ++                      +   N     +  K+  +  +S+ T     N ++ SL QL+Q Y+ SQ S+ V N
Sbjct:   31 DSVAHRIGEDGSQGKTIFGPLSKEESEQLQREANEETTKSEDLRLFLQEMRQHMQQQQQQQQQQQQYQVGSTSQMFGSSGVSHHQLQHQTSTRSHVLQQAFSNATPANTQKRSVAGPEQDNVIDSS---------PDGGWGWIVVFSSFVCMILVEGICLSYGLLVAPICPGNSLQAVEITTPFLSRSRLLTATSLGIVWSSKARTIPLRPGTCVGVSEMGEALGTQSRMALMAPGGLLVGIYLLLGPLASALSNQFDFRPVAMAGGVIATVGLLTAAFSTNVAMLNATLGCIGGIGFGLIYLPAIATVGHWFKRRRPFAVGLALCGSGVGSIVGGQVLPLLLQWFSWSGTLIVLAAFCMQCLVLIVLFRPLDLHFRIKYYQNQRRQTAREKERRDAHVSTEQQRRRRRAVKAEASEAAARAKAQAMARAQAAQARAAKKALKAQKTQQQRRVIYRGSIMQRIIEEKRRQRTVSIGSLDGMVITRDNELI---AAPLVADRPPLLTAASITRISEAVMRKMEARLAACQESDGDGGDGNSGGGETPVRCDSNVSQPSLSRKSSTLANTSHATGLSRLNLVRESLPQLIQSYVQSQASIAVQN 620          

HSP 2 Score: 162.925 bits (411), Expect = 1.135e-36
Identity = 99/235 (42.13%), Postives = 134/235 (57.02%), Query Frame = 3
Query: 2277 PFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHK-----------------YEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRY 2930
            P   F+ ELL   LL SPTFI +++S+V +M G+ +P++ LP  +   +     AG LIS +G ANT GR  AT+YIEKAWSS+Y WADCL +N   L LAGV     P +   Y  L+   CL+GL  A  VSLKSILVVEL G+++LTNAFG +L+ QG+A++ G  + G + D    K                  E  FYFAG   +L+ +    LR++A   R+ I   Y
Sbjct:  941 PILTFLEELLAPGLLLSPTFICLLLSNVFTMWGLVIPYFMLPDMVAENNWTPHEAGSLISCIGFANTIGRCIATLYIEKAWSSHYKWADCLRVNVASLFLAGVACGMAPLVGRSYNLLICFGCLFGLFSAVVVSLKSILVVELFGLDKLTNAFGHMLVLQGVASIAGTIIGGHLFDTLASKAPDFTPLLNSNTPLVYAAETCFYFAGGSFLLAALFASSLRYLAN--REVISATY 1173          
BLAST of slc16a-18 vs. Ensembl Cavefish
Match: slc16a12a (uncharacterized LOC103025054 [Source:NCBI gene;Acc:103025054])

HSP 1 Score: 90.1225 bits (222), Expect = 8.526e-18
Identity = 65/193 (33.68%), Postives = 103/193 (53.37%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQ 1139
            PDGGW W+IV   F   I          +   E    F  +D     W  SL+    M   P+ S + N+F  R   + GG++S + ++LSSF ++L    +  G+L G+GF+L Y PA+A+VG +F E++ +A G+A+ GSG GTF+   ++  LIE+ +W+G ++++        V   L RPL  H + Q
Sbjct:   14 PDGGWGWMIVAGCFITTICTRAVTRCVSIFFLEFQMHFS-SDYSRTAWIHSLVDCTTMLCAPLGSYIGNRFSCRVAVMVGGLLSSLGLILSSFASSLEYLYLSLGILTGLGFALCYTPAVAMVGSYFSERKALAYGIAMSGSGIGTFVLAPVVQLLIELYSWRGALLILGGFASHLCVCGALMRPLNRHRQNQ 205          

HSP 2 Score: 60.077 bits (144), Expect = 1.406e-8
Identity = 45/178 (25.28%), Postives = 79/178 (44.38%), Query Frame = 3
Query: 2382 VPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLI--LAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLER 2909
            VPF +L  Y  S+ +  + A  L+S++G+    G       I   W S+        I +++L   L G++   +P L  +   L F L  YG     +V+L  ++  + +G   L++A G +     +  +I PP+AGW+ D +   Y   F   G  II S ++    +   +  R
Sbjct:  737 VPFVYLVPYSLSIGVSHQQAALLMSFLGVMGIVGN------ITFGWISDRRCLRAYRIVSYLLAVGLEGLSCLFVPLLWNFSLLLPFSL-FYGYFDGAYVALLPVVTSDTVGPTYLSSALGVVCFLHAIPYLISPPIAGWLVD-QTGSYTAAFLLCGFSIICSALILTTFKLSHRCSR 906          
BLAST of slc16a-18 vs. Ensembl Cavefish
Match: slc16a9b (solute carrier family 16 member 9 [Source:NCBI gene;Acc:103031440])

HSP 1 Score: 85.5001 bits (210), Expect = 9.674e-17
Identity = 63/209 (30.14%), Postives = 110/209 (52.63%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL-HLRMQQLSKIRSTIRQMRREE 1187
            DGGW W IV+ASF   +   G+  + G+L PE +  FQE+  M+  W GSL++G  +   P+ SA    F  RPV +  G++    ++LS+F  ++   +  +G++ G+G  L+Y   + I   +F ++R +A+G+   G+  G FLY       +E+   +GC++LI +     +    L RPL L    ++Q + +   + +  RE 
Sbjct:   11 DGGWGWTIVVASFMAQLLAYGSPQSVGVLYPEWLSAFQESKGMT-AWVGSLVSGVGLIASPICSACVVNFGARPVTIFSGVMISGGLMLSAFAPSVHFLMFSYGIVVGLGCGLLYAATVTITCQYFDKRRGLALGIVTTGTSVGGFLYATAQNEFLELFGLEGCLLLIGSFALNIIACGGLMRPLHLPAYYLKQRAALVEKVEEKLRER 218          

HSP 2 Score: 61.2326 bits (147), Expect = 3.809e-9
Identity = 43/153 (28.10%), Postives = 78/153 (50.98%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVF--VLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGS-------MIILSGILCF 2879
            L+S + +A   G+L   +       ++  W + +++  F L+ +G     IP   +Y G  V   VL  +    +G  S+   +  +++G+ RLT A+G L+ F G   ++GPP+ GW  D     Y+  FYF+G+       +++LSG+LC+
Sbjct:  323 LVSIIAMAAGVGKLLLGVV------TDIHWMNSVYLYAFTLVGSGAALLVIPLTKSYVGLQVISAVLGFF----SGNWSVTPYMTTKVVGMERLTEAYGILMFFGGFGIMLGPPVVGWFYDW-MQSYDLAFYFSGTCVLLGGVLLLLSGMLCW 464          
BLAST of slc16a-18 vs. Ensembl Cavefish
Match: slc16a9a (monocarboxylate transporter 9-like [Source:NCBI gene;Acc:103027375])

HSP 1 Score: 85.1149 bits (209), Expect = 1.158e-16
Identity = 61/187 (32.62%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL 1124
            DGGW+W+IVLASF   +   G+  + G+L PE +  F E    +  W GSL++G  +   P+ SA  + F  RPV +  G++    ++LS+F  N+   I  +G++ G+G  L+Y   + I   +F ++R +A+G+   G+  G FLY  +   LIE+    GC++++ A+    +      RPL L
Sbjct:    6 DGGWSWVIVLASFMAQLLAFGSPQSVGVLYPEWLNAFHEGKGTT-AWVGSLVSGVALIASPLCSACVDNFGARPVTIFSGVMVAGGLMLSAFAPNVSFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSAGGFLYATVQNELIELFGLDGCLLIVGALALNLMACAGPMRPLNL 191          

HSP 2 Score: 65.4698 bits (158), Expect = 1.773e-10
Identity = 44/144 (30.56%), Postives = 69/144 (47.92%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCF 2879
            L+S V LA   G+L     ++  W S       L +    ++  GV    +P   +Y G  V    L G   +G  SL S +   ++G+ RL+ A G L+ F G   ++GPP+ GW  D     Y+  FYF+G  ++L G++ F
Sbjct:  318 LVSIVALATGVGKLILGALVDMRWVSG------LLLYALTVVGTGVALLLVPGWKSYLGLQVLSAAL-GF-FSGNWSLTSYITTRIVGIERLSQAHGVLMCFGGFGIMLGPPVVGWFYDWT-QSYDLAFYFSGCCVVLGGLILF 452          
BLAST of slc16a-18 vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 78.1814 bits (191), Expect = 1.835e-14
Identity = 64/189 (33.86%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL 1124
            PPDGGW W+IV   F   +          +   E    F   D     W  SL+    M   P+ S + N    R   + GG ++ I ++LSSF  +L    +  GVL G+GF+L Y PAIA+VG +F E++ +A G+A+ GSG GTF+   ++  LIE  +W+G ++++  +     V   L RP+ L
Sbjct:   13 PPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHF-ARDYSGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVLTGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITL 200          
BLAST of slc16a-18 vs. Ensembl Cavefish
Match: slc16a12a (uncharacterized LOC103025054 [Source:NCBI gene;Acc:103025054])

HSP 1 Score: 77.411 bits (189), Expect = 2.543e-14
Identity = 64/189 (33.86%), Postives = 101/189 (53.44%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELH 1127
            PDGGW W+IV   F   I          +   E    F  +D     W  SL+    M   P+ S + N+F  R   + GG++S + ++LSSF ++L    +  G+L G+GF+L Y PA+A+VG +F E++ +A G+A+ GSG GTF+   ++  LIE+ +W+G ++++        V   L RPL  H
Sbjct:   12 PDGGWGWMIVAGCFITTICTRAVTRCVSIFFLEFQMHF-SSDYSRTAWIHSLVDCTTMLCAPLGSYIGNRFSCRVAVMVGGLLSSLGLILSSFASSLEYLYLSLGILTGLGFALCYTPAVAMVGSYFSERKALAYGIAMSGSGIGTFVLAPVVQLLIELYSWRGALLILGGFASHLCVCGALMRPLNRH 199          
BLAST of slc16a-18 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 89.3521 bits (220), Expect = 1.348e-18
Identity = 66/190 (34.74%), Postives = 100/190 (52.63%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELH 1127
            PPDGGW W++VLA F   +          +   E    FQ+ D  +  W  S++    M   P+ S LS+ F  R   +AGG+ S    +++SF  ++    +F GV  G GFSL Y P+I +V  +F  +R +A GLA+ GSG GTFL   L+  L+++ +W+G ++L+ A      V   L RP+ L 
Sbjct:    5 PPDGGWGWMVVLACFIVNVCTRAVTRCISIFFMEFQSHFQK-DYATTAWINSMVDCLTMLCAPIGSLLSSHFGCRATVMAGGLFSSAGFIMASFATSIEMLYVFLGVFAGFGFSLCYSPSIVMVTKYFRRRRALATGLAMSGSGVGTFLLAPLVQYLLDVFSWRGALLLLGAFVSNLCVCGALLRPIHLQ 193          

HSP 2 Score: 56.225 bits (134), Expect = 3.176e-8
Identity = 50/189 (26.46%), Postives = 88/189 (46.56%), Query Frame = 3
Query: 2385 PFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLI---LAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGIL-----CFPLRFVAKLERDYIEKR 2927
            PF +L  Y +S  +   +A  L+S +G+ + AG       I   W ++ P         F ++   L GV +  +P + ++   +V+ + LYG     +V+L S++  +L+G   +++A G +     +  +I PP+AGW+ D+    Y   F  +G  +ILS +L     CF         R Y  KR
Sbjct:  341 PFVYLVPYAQSHGVPPGMAALLLSVLGIVDIAGN------ISYGWLTDRPSVR-KHRGLFYMVAVGLEGVWSLLLPLMASFPLLMVYAV-LYGYFDGAYVTLISVVTADLVGPVHVSSAVGLVFFMHAVPYLIAPPVAGWLVDIT-GTYTAAFLVSGMAMILSALLFGVVSCF---------RSYCAKR 511          
BLAST of slc16a-18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001631.1 (pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 gene:ENSPMAG00000001470.1 transcript:ENSPMAT00000001631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 8.181e-18
Identity = 66/189 (34.92%), Postives = 106/189 (56.08%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELH 1127
            PDGGW WLIVLA+F  +  + G   + G+   E  E FQE+   +  W  S+    +    P+AS LSNQF  R V + GGI + I  L +SF + LL   +  G+L G G+++++ P+I+ +  +F ++R +A+G+A  G G  +F +  L   L+E  TW+G ++++A +     V   L RP+ L 
Sbjct:    8 PDGGWGWLIVLAAFVQVSLVFGVVRSVGVFFIEFTEYFQESS-TAISWITSIALCVHQFASPIASTLSNQFGSRSVVIVGGISACIGFLCASFAHCLLHLYLSLGLLTGFGWAMVFSPSISTLSKYFDKRRSLALGIAFSGVGMSSFAFSPLFQMLVETYTWRGALMILAGLELNLCVCGALLRPIRLR 195          

HSP 2 Score: 57.3806 bits (137), Expect = 1.330e-8
Identity = 44/169 (26.04%), Postives = 84/169 (49.70%), Query Frame = 3
Query: 2379 FVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPL 2885
            F+P+  L  +++ L         +IS V +A+   RLF+       W ++      + +  F  +  G+    IPF  TY   +V +  +YG        +   L+ +++G+ R+T+A GFL++ + + +++GPP++G++ D     Y   F  +G +IIL G L  P+
Sbjct:  246 FIPYVHLLAHLQMLGFSSLSGAFVISAVAVADIVARLFS------GWLADLRRIPMVHLFFFWTLTTGIIIVIIPFGQTYTDMIV-IGIVYGFASGAMAPIGVSLLSKIVGIARITSAIGFLMLLESVGSLLGPPISGFLKDYT-GDYTMSFIASGLVIIL-GCLVLPM 405          
BLAST of slc16a-18 vs. Ensembl Sea Lamprey
Match: zgc:165507 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 77.0258 bits (188), Expect = 8.136e-15
Identity = 66/195 (33.85%), Postives = 106/195 (54.36%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFM--------WPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPL 1118
            PPDGGW W +V+ +F   I+I    F+Y    P+ +  F + DI            W  S++     + GP++S L N++  RP+ +AGGI++G  ++ +SF N +       GV+GG+G +    PA+ I+G +F++KRPIA G+++ GS  G      L   LI    W+G  +++AA+ F C V   L RP+
Sbjct:   13 PPDGGWGWAVVVGAF---ISIG---FSYAF--PKAITVFFK-DIQEIFHTTYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPIVIAGGILAGTGMIAASFCNTIFQLYFCIGVIGGLGLAFNLQPALTIIGKYFYKKRPIANGISMAGSPVGLSTIAPLNQVLINNFGWRGSFLILAALLFNCCVAGSLMRPV 198          

HSP 2 Score: 58.5362 bits (140), Expect = 5.528e-9
Identity = 49/202 (24.26%), Postives = 92/202 (45.54%), Query Frame = 3
Query: 2280 FRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPW--ADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCF 2879
            F +   +LLD++L     F+I +  +V    G F P  FL  Y K + ++   A  L+S +   +   R            +N+P       +  +F +   G      PF   Y G LV     +G+      ++    +++L+G  R ++A G + I +    ++GPP+ GW+ D+    Y+Y +Y  G++++++GI  F
Sbjct:  238 FSSRFMQLLDLTLFKHRGFLIYLSGNVIMFFGFFAPVVFLAPYAKHMGIENYSAAFLLSVMAFVDMVAR------PTTGLLANHPRIRPKIQYFFSFAVFFNGFCHVMCPFASDYTG-LVIYAAFFGMAFGMVSAMLFETLMDLVGAQRFSSAVGLVTIVECCPVLLGPPIGGWLVDVT-GDYKYMYYVCGAIVMVAGIYLF 431          
BLAST of slc16a-18 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 75.8702 bits (185), Expect = 1.446e-14
Identity = 64/192 (33.33%), Postives = 102/192 (53.12%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQEN---DIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPR-LIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PPDGGW W++V + F    T+          +P     FQ++   D  +  W  S++    M   P+ S LS +F  R   + GG++S    +++SF   +    +F G++ G+GF+L Y P+IAIV  +F   R +A GLA+ G+G GTF+   ++ + LIE+  W+G ++L+ A   Q  V   L RPL 
Sbjct:   12 PPDGGWGWVVVCSCF----TVTACTRAITRCIPIFFVEFQQHFSKDTSTTAWINSIMDCTTMLFAPIGSLLSTRFGCRATVMFGGLVSSSGFIIASFSPTIEFLYLFLGLMAGLGFALCYSPSIAIVSRYFQRHRLLATGLAMSGNGVGTFVLAPVVQQLLIEVYAWRGALLLLGAFVAQLCVCGALLRPLA 199          
BLAST of slc16a-18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009306.1 (pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 gene:ENSPMAG00000008418.1 transcript:ENSPMAT00000009306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 3.299e-14
Identity = 68/204 (33.33%), Postives = 108/204 (52.94%), Query Frame = 3
Query:  528 AMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYG------LLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            A A +  P  PPDGGW W +V+ +F   I+I    F+Y       +   E+ E FQ        W  S++     + GPV+S L N++  RPV +AGG+++G  ++L+SF  ++L      GV+GG G ++   PA+ I+G +F++KRPIA GLA+ GS         L   L+    W+G  +++  +   C V   L RP++
Sbjct:    5 ATAGQACP--PPDGGWGWAVVVGAF---ISIG---FSYAFPKAITVFFSEIQEIFQ-TTYSEIAWISSIMLAIMYAGGPVSSILVNRYGSRPVVVAGGVLAGTGMVLASFCTSILQLYFCIGVIGGFGLAMNLQPALTIIGKYFYKKRPIANGLAMAGSPVMLSTLAPLNQLLLNNFGWRGSFMILGGLLLNCCVAGALMRPVK 199          
BLAST of slc16a-18 vs. Ensembl Yeast
Match: ESBP6 (Protein with similarity to monocarboxylate permeases; appears not to be involved in transport of monocarboxylates such as lactate, pyruvate or acetate across the plasma membrane [Source:SGD;Acc:S000005069])

HSP 1 Score: 55.8398 bits (133), Expect = 3.642e-8
Identity = 55/197 (27.92%), Postives = 94/197 (47.72%), Query Frame = 3
Query:  558 PPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGS------LLAGFYMSMG----PVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLI-EIVTWKGCIILIAAVC-FQCLVFIVLFR 1112
            PPDGG+ W++    F  M +  G   ++G+     +  +  +D     +PG+      L+AG  + +G    P+  AL      R   L G  +   A LL+SF   L    +  G + G   SLI++PA  ++  WF +KR +A+G++L G+G G  +YG    +++ +    + C+ +I   C    LV I L +
Sbjct:  206 PPDGGYGWVVTFCVFLTMFSTWGCNASFGV----DLAYYLNHDT----YPGASKYDYALIAGLTVFLGQLLSPLVMALMRIIGLRTTMLFGDAVMLAAYLLASFTTKLWQLYVTQGFMVGCSISLIFVPATTVLPGWFLKKRAVAMGVSLLGTGAGGVVYGLATNKMLSDFGNTRWCLRIIGISCSISVLVAIALLK 394          
BLAST of slc16a-18 vs. Ensembl Nematostella
Match: EDO35238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM28])

HSP 1 Score: 72.7886 bits (177), Expect = 2.617e-13
Identity = 55/186 (29.57%), Postives = 102/186 (54.84%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPL 1118
            PDGGW WL+ LA+F     + GT  N+G++  E+++ F+     +  W GS+  G    +GP+ + L  +   R   + G II+    LL S   N+    + +G++ G+G S+ Y P++ I+G +F+++  +A GL   GSG G+   G ++ ++IE V  +  + + AA+    ++   ++RP+
Sbjct:   19 PDGGWGWLVCLAAFITQFIVLGTMNNFGVIYVELLQEFKVGKAEA-AWVGSITYGMMFLLGPLGTTLCKKIGCRLTTVVGCIIAAGGCLLGSVAPNIYIMDLTYGLMFGVGASMCYFPSVIILGTYFNKRLSLANGLTSAGSGVGSLAMGPILQKVIEAVGMRNTMRISAAMISSIVLVSAIYRPI 203          

HSP 2 Score: 56.6102 bits (135), Expect = 4.073e-8
Identity = 55/200 (27.50%), Postives = 98/200 (49.00%), Query Frame = 3
Query: 2298 ELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRL-FATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFV 2894
            + LD SL  +  +++   S    M+G FVPF  L        +D+ +A  LI  + + +T GRL F  I       +++P  + L++  F  ++ G++    P   TY G L F    +G     +V L  +L  +++G N +    G L   + +   +GPP+AG+I D+    YE  FY AG++ +++  + F + F+
Sbjct:  228 KFLDFSLFKNKAYLLWAASLSLWMLGYFVPFVHLISLATIQGIDIYMATLLIGIMSVGSTIGRLIFGKI-------ADHPKVNRLYLYQFSFLMIGISNTICPAFSTYAG-LAFYAAFFGFFEGCYVLLAPVLTGDIVGRNNMATGVGVLFAIKSVPLTLGPPIAGFIYDMS-KSYELAFYVAGAVPVIAACMMFGIPFL 418          
BLAST of slc16a-18 vs. Ensembl Nematostella
Match: EDO49501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB3])

HSP 1 Score: 73.1738 bits (178), Expect = 2.982e-13
Identity = 68/235 (28.94%), Postives = 116/235 (49.36%), Query Frame = 3
Query:  471 TDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFM-------------------WPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPL 1118
            +D S   Q   PY     Q  A E+      D GWAW+I  A+FF +  + GT + +G+L   ++  F+ +   + +                   W GS+       +  ++S L+ +F  R + + GGII+ + +L+SSF  ++ +    +G+L GIG SL YLPA+ +V  +F +KR +A G+A  G   G  +   L   L+E + W+ C+  ++A     +V  +LF+PL
Sbjct:   21 SDRSSLSQQ-SPYSNSSTQIKARESPVKSVKDRGWAWVICAAAFFDIFIVLGTLYTFGVLYVPLLAQFKASKAETGLDGRRSLLKSKLDLFRRLEAWVGSIGQFSIYFVCYLSSLLAERFGCRKITIVGGIITSLGLLISSFCTSIKSMYFTYGILVGIGSSLSYLPALVMVAFYFEKKRSLATGIAAAGGNIGALILAPLQQTLVEHIGWRNCMRCLSAFSSLIIVCGLLFKPL 254          
BLAST of slc16a-18 vs. Ensembl Nematostella
Match: EDO46666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD0])

HSP 1 Score: 67.3958 bits (163), Expect = 1.920e-11
Identity = 55/172 (31.98%), Postives = 95/172 (55.23%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAV 1076
            P+GG  W++  A+FF M T+ G   +YG++   +++     +  S  W GS+        GPVAS L +++  R VA  GGI+S + + L+SF+ N     + +G+L G+G  L + P+I ++G +F ++ P+A G+A  GSG G  L    I  L+    W+  + ++A +
Sbjct:   20 PEGGRGWVVCAAAFFAMFTVFGIHISYGVIYANLVDEHGFGEAES-AWIGSVAGSLNFLCGPVASFLCDRYGCRSVAFIGGILSVLGLFLTSFVQNPGKMYVTYGLLWGVGSGLSFTPSIIVLGQYFRKRFPLANGIASSGSGIGGLLAAPFIQFLLSNFGWQNSMRILACI 190          

HSP 2 Score: 49.2914 bits (116), Expect = 7.932e-6
Identity = 40/168 (23.81%), Postives = 75/168 (44.64%), Query Frame = 3
Query: 2538 ADCLWINNFVLILAGVTACSI-----PFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLER------DYIEKRYGRIVIDEENSVGTSSCVDINAENSEQ 3008
            ++C  +N  +L+   + A  +     P    Y G L + + +YG+    FV    ++  +++G  RL+ A G +     L    GPP+AGW+    F  Y   F+ AG + I + +L F + ++A  ++      D +    G +  D E   GT   + ++   S +
Sbjct:  288 SECACVNRRLLLQTAMFAMGLGTSLCPLATGYAGVLSYAI-VYGMFDGCFVGQVPVVTADVVGHARLSQAVGNMFGAIALPMSFGPPIAGWLYH-GFGSYNGAFHMAGGIAIFTSLLLFLIPYMAAKQKAFDVTDDVMHDIMGPLSHDAER-YGTDGLIAMSCARSSK 452          
BLAST of slc16a-18 vs. Ensembl Nematostella
Match: EDO46207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQQ5])

HSP 1 Score: 67.0106 bits (162), Expect = 2.221e-11
Identity = 55/195 (28.21%), Postives = 99/195 (50.77%), Query Frame = 3
Query: 2298 ELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGR-LFATIYIEKAWSSNYPWADCLWINNFVLILAGVTA--CSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGIL 2873
            E  D S+L +  FI+ + ++  +  G F+P +FL  Y + L +       LISY+G+A+  GR LF  +       S+      L I    ++L+G+ +  CS+    T YG L+  +   G+    ++ L SI+ +E++G ++++ A+G L   Q    ++GPP AG + D     ++  FY A   +I  G++
Sbjct:  253 EFFDCSVLRNKAFILWIFTTSIAGFGYFIPHFFLVRYSEDLGIPPSTGSWLISYLGIASAVGRILFGKL-------SDICCIRNLHIYKACMLLSGLASALCSVA---TTYGGLITYVVALGILDGSYIGLMSIVTLEIVGFSKISPAWGILFFCQSFTYLLGPPAAGLLYD-TVKSFKPVFYLASGPMIFGGVI 436          

HSP 2 Score: 54.299 bits (129), Expect = 2.066e-7
Identity = 60/218 (27.52%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  516 GDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIA--AVCFQCLVFIVLFRPLELHLRMQQLSKIRST 1163
            G +  M  ET      D GWAW++   SF  M  + G   ++G+L+  ++  F E+   +  W GS+   F     PV S ++ ++  R V + GG+   + + L+S+  N++   I +G+L G G SL    A+ I   +F +   +A G+   G   GT +    +  L+E + W+  + ++A   V   C  F+  +RP E   R +  S  R+T
Sbjct:   31 GSMSLMYIETDNSRSKDRGWAWMVCAGSFLIMFIVYGIHTSFGVLLNALLNHFHESKAKT-AWVGSIGLNFLFLGSPVTSRVAERYGIRTVTILGGVFISLGLFLTSYAPNIVVIYITYGLLFGSGTSLCGTMALIISVDYFDKHLSLATGIVAAGCSIGTLVLAPTLQFLVEKLGWRYAVRILAMSGVFIACAGFV--YRPHE--RRRETFSNDRAT 243          
BLAST of slc16a-18 vs. Ensembl Nematostella
Match: EDO39975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F8])

HSP 1 Score: 65.0846 bits (157), Expect = 7.441e-11
Identity = 56/195 (28.72%), Postives = 94/195 (48.21%), Query Frame = 3
Query: 2295 RELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCF 2879
            R   D ++L +  F++  +S    M+G FVPF  LP Y     + +  +  L+  + + +T GRLF      K    ++P  + L+I     ++ G+ A ++  L T Y   V  + ++G+    FV L  +L  +++G++++    G    F  +    GPPLAG I DL    Y+  FY AG+   LS  L F
Sbjct:  213 RPFFDFAVLKNKAFLVWSVSLGIFMMGYFVPFVHLPAYALECGIPISKSSTLVGMMSIGSTFGRLF----FGKV--CDHPKVNRLYIFQMAFLIIGI-AHTLSTLTTSYVGFVLYMIVFGIFDGCFVVLLGVLCADIVGLDKVAEGMGVQFFFMAITCTAGPPLAGVIYDLS-SSYQIAFYAAGACATLSCCLLF 399          

HSP 2 Score: 58.5362 bits (140), Expect = 7.655e-9
Identity = 66/204 (32.35%), Postives = 101/204 (49.51%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQEND------IMSFM---WPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFR-----PLELHL 1130
            P+GGW WL+ LA F    TI G   N G+L   ++  F+ N       I  F+   W  S+  G      P+ SAL  +   R VA+ GG++  +  LLSSF+ +L    + FGVL GIG S+ YLP +  + +WF  +  +  G+   GSG GT   G L+   +  + W     ++A V   C +  +L+R     P+E+ +
Sbjct:    1 PEGGWGWLVCLAGFIAQFTILGIQNNTGILYTTLLTEFKGNKGDTVNPISRFLHAAWVLSIGLGMMFLFCPITSALCERVGCRVVAVVGGLLGVLGFLLSSFVKDLYILYVTFGVLWGIGSSMCYLPTLRALPYWFRRRISLTNGIVTAGSGFGTIAMGPLMQLTVTYLGWAHTTRILAGVLLLCAISALLYRVPPKSPIEMKM 204          
BLAST of slc16a-18 vs. Ensembl Medaka
Match: slc16a12a (monocarboxylate transporter 12-B-like [Source:NCBI gene;Acc:101175502])

HSP 1 Score: 85.1149 bits (209), Expect = 9.503e-17
Identity = 71/198 (35.86%), Postives = 105/198 (53.03%), Query Frame = 3
Query:  534 AAETAPMGP--PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
              + AP GP  P+GGW W++V   F   I I        +   E    F E D  +  W  SL+    M   P+ S L N+   R   + GG++S   ++LSSF +++    I  GV+ G+GF+L + PAIAIVG +F E++ +A G+AL GSG GTFL    +  LIE  +W+G ++++  +     V   L RPLE
Sbjct:    8 GGKRAPEGPNAPEGGWGWMVVAGCFLATICIRAVTRCVSMFFVEFQMHF-EKDYSTTAWIHSLIDSTTMLCAPLGSFLGNRLSCRVTVMLGGLLSSAGLVLSSFASSVEFLYISLGVITGLGFALSFTPAIAIVGKYFVERKALAYGIALSGSGIGTFLLAPAVQLLIEHYSWRGALLILGGIVSNLCVCGALMRPLE 204          
BLAST of slc16a-18 vs. Ensembl Medaka
Match: slc16a9a (solute carrier family 16 member 9 [Source:NCBI gene;Acc:101165170])

HSP 1 Score: 82.0333 bits (201), Expect = 1.238e-15
Identity = 64/213 (30.05%), Postives = 107/213 (50.23%), Query Frame = 3
Query:  564 DGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLEL--HLRMQQLSKIRSTIRQMRREEDEH 1196
            DGGW W IV ASF   +   G+  + G+L PE +  FQE   ++  W GSL+AG  +   P+ SA  + F  RPV    G++    ++LS+F  N+   +  +G++ G+G  L+Y   + I   +F ++R +A+G+   G+  G F+Y      LI      GC+++I A+    +      RPL +  +   Q+ +  R T  Q+  +   H
Sbjct:    9 DGGWGWAIVAASFMAQLLAYGSPQSVGVLYPEWLHAFQEGKGVT-AWVGSLVAGVGLIASPICSACVDNFGARPVTFFSGVMVAGGLMLSAFAPNVPFLMFSYGIVVGLGCGLVYSATLTITCQYFDKRRGLALGIVTTGTSIGAFIYATAQNELIVFFGLDGCLLIIGAIALNLMACAGFMRPLNMPGYYLKQKAALERHTEEQLFVKLPLH 220          

HSP 2 Score: 64.3142 bits (155), Expect = 5.395e-10
Identity = 40/140 (28.57%), Postives = 66/140 (47.14%), Query Frame = 3
Query: 2448 LISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVS----LKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMI 2855
            L+S   +A   G+L   I +      +  W +C+++  F +   G+    IP   TY G  +         V GF S    L S +   ++G+++L+ A G L+ F G   ++GPP+ GW  D     Y+  FYF+GS +
Sbjct:  334 LVSIGAIATGVGKLVLGILV------DIKWINCVYLYAFTMFAGGIALLLIPITKTYVGLQILS------AVMGFFSGNWSLTSYITTHIVGLDKLSQAHGILMFFGGFGIMLGPPVVGWFFDCT-QSYDLAFYFSGSCV 460          
BLAST of slc16a-18 vs. Ensembl Medaka
Match: SLC16A6 (solute carrier family 16 member 6 [Source:NCBI gene;Acc:101154956])

HSP 1 Score: 76.2554 bits (186), Expect = 8.713e-14
Identity = 53/189 (28.04%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELH 1127
            PDGGW W++  A F    +  G     G+ + ++ME F E++     W  S+ A       P+A+ LSN+F FRPV + GG ++ +  + S+F +++    I  GV+ G G+ L +LP + I+  +F  +R +   +A  G     F +  +  RL E + W+ C++++  +    +   +L RP+ + 
Sbjct:   19 PDGGWGWVVAAAFFLVEASTYGVVKTLGIFLQDLMEEFGESN-SRVSWVISICAFIMTFTAPLATMLSNRFGFRPVVMMGGFLTCLGTISSAFTSSIKDMYITIGVISGFGYCLSFLPTVTILAQYFCRRRSLVTAVASSGESFAVFAFAPVFSRLKEDIGWRYCLVIMGVIQASIISCGLLLRPIVIE 206          
BLAST of slc16a-18 vs. Ensembl Medaka
Match: zgc:165507 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:101155977])

HSP 1 Score: 74.7146 bits (182), Expect = 2.156e-13
Identity = 65/202 (32.18%), Postives = 103/202 (50.99%), Query Frame = 3
Query:  534 AAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMET-FQENDIM------SFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPL 1118
            A  +  + PPDGGW W +VLASF   I+I    F+Y    P+ +   F+E  I+         W  S++     + GP++S L N +  RP+ + GG +  + ++ +SF  N+L   +  GV+GG+G +    PA+ ++G +F +KRPIA GLA+ GS         L   L     W+G  +++  +   C V   L RPL
Sbjct:    5 ATGSPAVAPPDGGWGWAVVLASF---ISIG---FSYAF--PKAITVFFKEIQIIFDASYSQIAWISSIMLAVMYAAGPISSILVNTYGCRPIVMMGGCLCAVGMISASFCTNVLQLYMCIGVIGGLGLAFNLQPALTMIGRYFFKKRPIANGLAMAGSPVFLSTLAPLNQYLFNRFGWRGSFLILGGLLLNCCVAGSLMRPL 198          

HSP 2 Score: 58.151 bits (139), Expect = 3.711e-8
Identity = 59/242 (24.38%), Postives = 108/242 (44.63%), Query Frame = 3
Query: 2298 ELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFV----AKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQI 3011
            + LD++L     F+I +  +V   +G F P  FL  Y K + +D   A  L+S +   +   R    +     W          +  +F ++  GV     P + +Y G +V+ +  +G       S+    +++L+G  R ++A G   I +    +IGPPLAG + D+    Y+Y ++  G+++IL+ I  F   F+     + ER + E  Y R   D+ +        D  A+ S ++
Sbjct:  230 KYLDLTLFKHRGFLIYLSGNVIMFLGFFAPIVFLTAYAKDMGVDEYSAAFLLSILAFVDMFARPSMGLLANSRWVR----PRIQYFFSFAVLYNGVCHILCPLVESYTGLVVYSV-FFGFAFGMVSSVLFETLMDLVGAQRFSSAVGLTTIVECCPVLIGPPLAGKLVDVT-KNYKYMYFCCGAIVILASIWLFIGNFINYRLLERERKHAE-MYKRTETDDPDRAQEEKEADHEAQASVEL 464          
BLAST of slc16a-18 vs. Ensembl Medaka
Match: si:dkey-246g23.4 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101159501])

HSP 1 Score: 74.3294 bits (181), Expect = 3.735e-13
Identity = 59/187 (31.55%), Postives = 101/187 (54.01%), Query Frame = 3
Query:  561 PDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 1121
            PDGG+AW I+++ FF      G   ++G+   E+ + F      +  W  S+         P+ASALS+++  R V +AGG+I  +  +L SF NNL+   +  G L G G++L + P + ++G +F ++RP+A  LA  G    TF+   +   LI   +W+G ++++ A+     V  +L RPL+
Sbjct:   20 PDGGYAWFILVSCFFVFGLTFGVVKSFGVFYVEIQQYFGTTAAGT-SWITSIAVATIHVAAPLASALSSRYSHRSVVIAGGLICSVGAILGSFGNNLVQLYLTVGFLNGFGYALTWTPTVTMLGMYFDKRRPVANALASAGECILTFILTPMFQLLINSFSWRGALLIMGALQLNLCVCGLLLRPLK 205          

HSP 2 Score: 60.8474 bits (146), Expect = 5.816e-9
Identity = 54/215 (25.12%), Postives = 103/215 (47.91%), Query Frame = 3
Query: 2280 FRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEK 2924
             R  +++ +D +L+T+P F+I  +  V + +G F P  FL  Y +S  ++   A  L+S   + +  GR      +   W +N    + +      ++L G      P   T+Y  + F    +GL     V++   ++ E++GV RL +A GF ++ +    ++GPP+AG+  D K   Y  GF  +G  ++ S +    L  +  +++D  +K
Sbjct:  281 LRTRVQQYVDYTLITNPRFMIYSMFGVFAALGFFAPSLFLVPYARSKGIEEYQAAALMSISAVLDLIGR------VVFGWVANLRLVETVQQLTATVVLLGAVLLLCPLASTFYELVAFSAA-HGLVYGATVAIHITVLPEVVGVQRLGSALGFFMLIRSSGGLLGPPIAGFFID-KMDSYGTGFLMSGVALLTSALFLLVLNLM--MQKDQRKK 485          
BLAST of slc16a-18 vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 1902.87 bits (4928), Expect = 0.000e+0
Identity = 1058/1061 (99.72%), Postives = 1060/1061 (99.91%), Query Frame = 3
Query:   42 MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESYAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWXXXXXXXXXXXXXXXXXLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHXXXXXXXXXXXXXXXXXXXXXXXRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQXXXXXXXXXXXXXXXXXXXXLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ 3224
            MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNES AKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREED+HKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAG+MIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ
Sbjct:    1 MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESCAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGAMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ 1061          
BLAST of slc16a-18 vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 1859.34 bits (4815), Expect = 0.000e+0
Identity = 1042/1061 (98.21%), Postives = 1044/1061 (98.40%), Query Frame = 3
Query:   42 MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESYAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWXXXXXXXXXXXXXXXXXLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHXXXXXXXXXXXXXXXXXXXXXXXRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQXXXXXXXXXXXXXXXXXXXXLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ 3224
            MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNES AKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREED+HKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTE                IDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAG+MIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ
Sbjct:    1 MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESCAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTE----------------IDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGAMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ 1045          
BLAST of slc16a-18 vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 1850.87 bits (4793), Expect = 0.000e+0
Identity = 1029/1061 (96.98%), Postives = 1032/1061 (97.27%), Query Frame = 3
Query:   42 MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESYAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWXXXXXXXXXXXXXXXXXLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHXXXXXXXXXXXXXXXXXXXXXXXRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQXXXXXXXXXXXXXXXXXXXXLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPXXXXXXXXXXXXDGPFRAFMRELLDVSLLTSPTFXXXXXXXXXXXXXXFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ 3224
            MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNES AKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREED+HKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQ T +                          KSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAG+MIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ
Sbjct:    1 MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESCAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDDHKRLEHEKEIEAEKKRKKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGVVSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINNTNANVPTSPQTLNNIQSTST--------------------------KSETSSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVNESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAFMRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGAMIILSGILCFPLRFVAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLPANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLDKPDLFEVKKVQ 1035          
BLAST of slc16a-18 vs. Planmine SMEST
Match: SMESG000077590.1 (SMESG000077590.1)

HSP 1 Score: 235.343 bits (599), Expect = 2.366e-64
Identity = 207/663 (31.22%), Postives = 330/663 (49.77%), Query Frame = 3
Query:  156 YAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWXXXXXXXXXXXXXXXXXLTNNNGPYFTDPSPYKQMIDPYQEGDI--QAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSK------IRST--IRQMRREEDEHXXXXXXXXXXXXXXXXXXXXXXXRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMD------------------AINRITESVVKRLENK---MNKHGPNGVVSIVDSKNGGINGSSNMTNNQ--LKNSLSQLVQEYINSQ---------------MSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQXXXXXXXXXXXXXXXXXXXXLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTET 2000
            YAK     +I+GV  L ++ +N     ++  TE+  N+ +    E N+ TT SEDLR   +E+ +    N S + + A                   ++  G      S Y Q I+ YQ   I  +    +   +   D  W W++V  S  CM+ +DG CF YGL    +   F  + I   + PGSLL+G Y+   P+A+ L+N F +R VA+ G I + I++  SSF  + + F++ FGV  GIGF L+YLPAIAIV HWF++KR +A+G+AL GSG G+ +   L+P LIE V W G ++L++A+C Q LV I LFRP ELH R++Q+ K      I++   I++ +R + E K++   K+ +             R    +K K IVI RGSI  +I+EEK RQRTVS GSLDGM+IT+ N+L+  ++  ++    P +SM                    I+R+ E+ +K++ +    +++   + V   +  K+   + S   +NN+  +++    LV+EY+  Q               +S +V +T LIN     V  +  +++    +   +  + L   +PN                 S + S    + L    K  + A + KE+ RP N+K+L+FTGS+ Q  NN   T
Sbjct:    4 YAKTD---SISGVFMLTDSMKNTMEINDNFKTEI--NDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRA------------EVKRGSCSSKEGSI----SIYDQ-IEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLLSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQK------------RREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQSNKPQTL---TPNTD-------------ANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPT 616          
BLAST of slc16a-18 vs. Planmine SMEST
Match: SMESG000077590.1 (SMESG000077590.1)

HSP 1 Score: 236.113 bits (601), Expect = 4.319e-64
Identity = 207/663 (31.22%), Postives = 330/663 (49.77%), Query Frame = 3
Query:  156 YAKKSEILNINGVDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQEMHQKCQPNDSSVYNNAWXXXXXXXXXXXXXXXXXLTNNNGPYFTDPSPYKQMIDPYQEGDI--QAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVXXXXXXXXXXXXXXXXFMNNXXXXXXXXXXXXXXXXXXXYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLELHLRMQQLSK------IRST--IRQMRREEDEHXXXXXXXXXXXXXXXXXXXXXXXRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVITRDNELIKVAKSSIDLYEKPILSMD------------------AINRITESVVKRLENK---MNKHGPNGVVSIVDSKNGGINGSSNMTNNQ--LKNSLSQLVQEYINSQ---------------MSLQVWNTQLINNTNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQXXXXXXXXXXXXXXXXXXXXLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNMTET 2000
            YAK     +I+GV  L ++ +N     ++  TE+  N+ +    E N+ TT SEDLR   +E+ +    N S + + A                   ++  G      S Y Q I+ YQ   I  +    +   +   D  W W++V  S  CM+ +DG CF YGL    +   F  + I   + PGSLL+G Y+   P+A+ L+N F +R VA+ G I + I++  SSF  + + F++ FGV  GIGF L+YLPAIAIV HWF++KR +A+G+AL GSG G+ +   L+P LIE V W G ++L++A+C Q LV I LFRP ELH R++Q+ K      I++   I++ +R + E K++   K+ +             R    +K K IVI RGSI  +I+EEK RQRTVS GSLDGM+IT+ N+L+  ++  ++    P +SM                    I+R+ E+ +K++ +    +++   + V   +  K+   + S   +NN+  +++    LV+EY+  Q               +S +V +T LIN     V  +  +++    +   +  + L   +PN                 S + S    + L    K  + A + KE+ RP N+K+L+FTGS+ Q  NN   T
Sbjct:    4 YAKTD---SISGVFMLTDSMKNTMEINDNFKTEI--NDCQMGDIEQNQLTTNSEDLRNLSKEVREFVLNNPSQMKSRA------------EVKRGSCSSKEGSI----SIYDQ-IEEYQRIAINKEVTRKQEQHISSVDDCWGWIVVFGSLICMVFVDGICFTYGLHCEYVKSYFLLSHISLTILPGSLLSGIYLITSPLANPLANYFGYRFVAMVGSICTTISLFASSFCRSYILFVLCFGVFSGIGFGLMYLPAIAIVAHWFNQKRAVAIGIALCGSGIGSCILSFLLPSLIEWVQWNGSLVLLSALCCQSLVAIALFRPYELHQRIKQMRKDYKRWCIQNAEYIKEQKRLQKEKKQIIALKKEQK------------RREKLVKKKPIVIKRGSIFTRIMEEKSRQRTVSTGSLDGMMITQMNQLVTASQVDMNGLLLPQMSMINDQTESMTSLATALLPSYVIDRVIETTLKKIRSSNRNISRKKGSSVCGTLSKKSSANSISEMFSNNENPIEDIPISLVKEYVARQKNIGRDENSDSNHLAISFKVGSTTLINEVTDCVKCNELSVSQSSFSSQSNKPQTL---TPNTD-------------ANSDQISFKVSLELPHDIKKFVHAEILKELDRPINRKDLYFTGSLSQFLNNRNPT 616          

HSP 2 Score: 115.546 bits (288), Expect = 9.413e-26
Identity = 61/139 (43.88%), Postives = 87/139 (62.59%), Query Frame = 3
Query: 2460 VGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLC-LYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICD---LKFHKYEYGFYFAGSMIILS 2864
            +G +N  GRL AT+YIEK W+  Y  A+   +  F L  + V+   +P+    + +LV +L  +YG C+A  VS++S+LVVEL GV  LT  F FLLIFQGLAT+IGP LAG +CD   +  +  E  F F+G + ++S
Sbjct:  723 LGCSNIVGRLVATLYIEKGWALKYQQANGANLTVFFLGFSSVSILLMPYFRLIHVSLVIILAFVYGFCIAMIVSIRSMLVVELFGVESLTKTFTFLLIFQGLATIIGPVLAGILCDYFPVLLNSAEPAFLFSGILFLIS 861          
The following BLAST results are available for this feature:
BLAST of slc16a-18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A141.057e-1632.74solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A141.111e-1632.74solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A142.601e-1632.74solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A91.645e-1532.62solute carrier family 16 member 9 [Source:HGNC Sym... [more]
SLC16A91.645e-1532.62solute carrier family 16 member 9 [Source:HGNC Sym... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mct-41.075e-2826.95MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-44.136e-2826.95MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-44.136e-2826.95MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-44.136e-2826.95MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-44.595e-2826.95MonoCarboxylate Transporter family [Source:UniPro... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84682.211e-3338.32gene:FBgn0033913 transcript:FBtr0087534[more]
CG84682.211e-3338.32gene:FBgn0033913 transcript:FBtr0087532[more]
CG84682.211e-3338.32gene:FBgn0033913 transcript:FBtr0087533[more]
CG139076.215e-3240.51gene:FBgn0035173 transcript:FBtr0072593[more]
CG139076.215e-3240.51gene:FBgn0035173 transcript:FBtr0345005[more]
back to top
BLAST of slc16a-18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a9a2.702e-1833.69solute carrier family 16 member 9a [Source:ZFIN;Ac... [more]
slc16a9b1.171e-1733.51solute carrier family 16 member 9b [Source:ZFIN;Ac... [more]
slc16a12a1.271e-1533.69solute carrier family 16 member 12a [Source:ZFIN;A... [more]
slc16a12b3.579e-1433.33solute carrier family 16 member 12b [Source:NCBI g... [more]
BX511087.37.820e-1431.10solute carrier family 16 member 12a [Source:NCBI g... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atf6b4.648e-1634.72activating transcription factor 6 beta [Source:Xen... [more]
slc16a124.940e-1633.16solute carrier family 16 member 12 [Source:NCBI ge... [more]
mad2l15.808e-1435.26mitotic arrest deficient 2 like 1 [Source:Xenbase;... [more]
ppp2r3a4.852e-1331.86protein phosphatase 2 regulatory subunit B'', alph... [more]
slc16a75.399e-1232.12solute carrier family 16 member 7 [Source:NCBI gen... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc16a48.148e-1630.10solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a91.555e-1533.16solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a142.512e-1534.95solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a126.999e-1532.80solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a112.200e-1433.33solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of slc16a-18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZJU0|MOT9_CHICK2.567e-1734.57Monocarboxylate transporter 9 OS=Gallus gallus OX=... [more]
sp|Q7RTX9|MOT14_HUMAN1.249e-1532.74Monocarboxylate transporter 14 OS=Homo sapiens OX=... [more]
sp|Q5R5M4|MOT9_PONAB2.338e-1533.16Monocarboxylate transporter 9 OS=Pongo abelii OX=9... [more]
sp|Q8R0M8|MOT5_MOUSE5.700e-1530.10Monocarboxylate transporter 5 OS=Mus musculus OX=1... [more]
sp|Q7RTY1|MOT9_HUMAN7.902e-1532.62Monocarboxylate transporter 9 OS=Homo sapiens OX=9... [more]
back to top
BLAST of slc16a-18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK720.000e+0100.00Slc16a-18 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A5K3EX042.475e-7434.88Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564XXD51.246e-7038.38Uncharacterized protein (Fragment) OS=Hymenolepis ... [more]
A0A068Y3133.786e-7034.98Monocarboxylate transporter OS=Echinococcus multil... [more]
A0A068WV904.215e-7034.39Monocarboxylate transporter OS=Echinococcus granul... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12a8.526e-1833.68uncharacterized LOC103025054 [Source:NCBI gene;Acc... [more]
slc16a9b9.674e-1730.14solute carrier family 16 member 9 [Source:NCBI gen... [more]
slc16a9a1.158e-1632.62monocarboxylate transporter 9-like [Source:NCBI ge... [more]
slc16a12b1.835e-1433.86solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a12a2.543e-1433.86uncharacterized LOC103025054 [Source:NCBI gene;Acc... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A121.348e-1834.74solute carrier family 16 member 12 [Source:HGNC Sy... [more]
ENSPMAT00000001631.18.181e-1834.92pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 g... [more]
zgc:1655078.136e-1533.85solute carrier family 16 member 7 [Source:HGNC Sym... [more]
SLC16A121.446e-1433.33solute carrier family 16 member 12 [Source:HGNC Sy... [more]
ENSPMAT00000009306.13.299e-1433.33pep scaffold:Pmarinus_7.0:GL482464:27972:31767:-1 ... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ESBP63.642e-827.92Protein with similarity to monocarboxylate permeas... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352382.617e-1329.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495012.982e-1328.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466661.920e-1131.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462072.221e-1128.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399757.441e-1128.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc16a-18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12a9.503e-1735.86monocarboxylate transporter 12-B-like [Source:NCBI... [more]
slc16a9a1.238e-1530.05solute carrier family 16 member 9 [Source:NCBI gen... [more]
SLC16A68.713e-1428.04solute carrier family 16 member 6 [Source:NCBI gen... [more]
zgc:1655072.156e-1332.18solute carrier family 16 member 7 [Source:NCBI gen... [more]
si:dkey-246g23.43.735e-1331.55monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of slc16a-18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003109.10.000e+099.72SMESG000003109.1[more]
SMESG000003109.10.000e+098.21SMESG000003109.1[more]
SMESG000003109.10.000e+096.98SMESG000003109.1[more]
SMESG000077590.12.366e-6431.22SMESG000077590.1[more]
SMESG000077590.14.319e-6431.22SMESG000077590.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005453
GenBankAKN21513.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005453 ID=SMED30005453|Name=slc16a-18|organism=Schmidtea mediterranea sexual|type=transcript|length=3507bp
AATCTATATAAATCTTATATGTTGTAGATGAATACATTGTAATGGCTACA
GAAGTTTCAACTACTTTACACTATACAAACTATCCAAAATATGATTCGTC
TCACATTTTCGACGTCACAGCTTATCCAACGCACAATGAAGAATCAAATG
AATCTTATGCGAAAAAATCTGAAATTCTAAATATTAACGGAGTGGATGAT
TTAATTAATACTTATCAAAATAAAGATCCTGAAGCTGAAGACGTTTTGAC
TGAGCTTGACCAAAATGAAATCGAACGCAGACAGCGAGAAGCAAATGAAG
AAACAACTAGAAGTGAAGACTTAAGACAATTTCTTCAGGAAATGCACCAA
AAATGCCAACCAAATGATTCATCAGTTTACAATAATGCTTGGCCTCCTGG
AAAAAGTGCTGTCGTGCCATCTAGTCCTGGATCAGTAGCCAAATTAACAA
ACAATAACGGCCCATATTTTACTGATCCATCTCCCTATAAACAGATGATT
GATCCTTATCAAGAAGGAGATATTCAAGCTATGGCAGCTGAAACAGCACC
AATGGGTCCACCAGATGGAGGATGGGCATGGTTAATTGTGCTGGCGTCAT
TTTTCTGTATGATAACTATCGATGGAACGTGTTTCAATTATGGATTGCTA
GTACCTGAAATGATGGAAACTTTCCAGGAAAATGATATTATGTCATTCAT
GTGGCCAGGGAGTTTGTTGGCCGGATTCTATATGTCTATGGGTCCTGTAG
CTAGTGCTTTGAGTAATCAGTTTGATTTTCGACCGGTAGCTCTGGCAGGT
GGAATTATATCTGGAATAGCAATATTACTAAGTTCTTTCATGAACAATTT
ATTGGCATTTATAATATTTTTTGGTGTTTTGGGCGGAATTGGATTTAGCC
TTATTTATCTTCCTGCTATTGCTATTGTCGGACATTGGTTTCATGAAAAG
CGGCCCATAGCTGTTGGTTTGGCTCTTTATGGAAGTGGTTGTGGAACATT
TTTATATGGACAATTAATTCCCAGATTAATTGAAATTGTTACTTGGAAAG
GCTGTATAATTTTGATAGCAGCTGTTTGCTTTCAATGTTTAGTTTTCATA
GTTTTATTTCGGCCACTTGAATTGCATTTAAGAATGCAACAGTTATCAAA
AATCCGGTCAACAATTCGCCAGATGCGTCGAGAAGAAGATGAACACAAAC
GACTGGAACATGAAAAGGAGATTGAAGCAGAAAAAAAACGCAAGAAAGCT
GAGAAAGAAGAATTAAGAAACAATAATCGAATGAAAAACAAGCGCATTGT
TATTTATCGGGGATCAATTATGCAGAAAATAATTGAAGAAAAGAAACGAC
AGAGAACAGTTTCTATGGGCAGTCTAGATGGAATGGTTATTACTCGAGAT
AATGAACTAATAAAAGTAGCAAAAAGTTCAATAGATCTGTATGAAAAGCC
GATACTTAGCATGGATGCCATTAACAGGATCACTGAATCTGTTGTTAAAA
GATTGGAAAATAAAATGAATAAACACGGTCCAAATGGTGTTGTCAGTATT
GTCGACTCTAAGAATGGAGGAATTAATGGCAGTTCTAATATGACTAACAA
TCAATTGAAGAACAGTTTATCCCAACTAGTACAGGAATATATCAATTCAC
AGATGTCCTTGCAAGTATGGAATACTCAATTAATAAACAATACAAATGCT
AATGTACCAACTAGTCCACAAACATTAAATAATATTCAAGGCACTTTAAG
TCCATCCGGAAAAGAATTTCTGGTGTTTCCATCACCAAACCATCAAAGTT
CTACAAATATATCGGAGAGTACAAGCACTAAAAGTGAAACTTCATCGAAA
ACCTCACTTAATCATGGAATGGCTTTAGAAGAAGGAGCAAAAGCAGTGAT
ACAGGCCAGTTTAAGAAAAGAAATGACGCGTCCATTTAATCAAAAGGAAT
TGTTTTTCACAGGATCCATGAGGCAATTGTCCAACAATATGACTGAGACG
AGTTCGATTCCTGATAGTAACCGTCGGTTCAGTTTAGCAACATGGATCGA
CAGCACAAAACGCAGTCAAACTAGCCTCAATGTAATAAATGCTTGCAATA
CCAGTCTCAACAGTCAACCAAGCGTCGGAATTGGTGTAAATGAAAGTGCA
AATATTTCTATTCTAGAAGGATTTATTGATCAAAATCAGTCTCCTGTAAG
TGGGGATGTATATGGAAATGCTTATCTGGATCCGAATCAGAATACTGTTA
ATAATCAAAATGTTAATACTGATGGGCCGTTTCGAGCTTTTATGCGAGAA
TTACTCGATGTCAGCTTATTAACAAGTCCGACATTTATTATAATGGTCAT
TTCCAGCGTAGCTTCTATGATTGGAATTTTTGTGCCATTCTATTTCTTAC
CGGGTTACATAAAATCACTGGACATGGATTTAAAAATAGCGGGTGGATTG
ATCTCATACGTAGGACTTGCTAATACGGCTGGACGCTTATTTGCTACCAT
CTATATCGAGAAAGCTTGGTCTTCGAACTATCCTTGGGCAGATTGTTTGT
GGATTAATAATTTCGTTCTCATTTTAGCCGGTGTCACAGCTTGTTCAATA
CCGTTTCTCATAACATATTATGGTGCATTGGTTTTTGTGCTGTGTTTATA
TGGATTATGTGTTGCCGGATTCGTTTCGTTAAAAAGTATTCTTGTGGTAG
AATTATTAGGAGTCAATAGATTGACTAATGCATTTGGGTTCTTATTAATT
TTTCAAGGTTTAGCTACAGTCATTGGTCCTCCATTGGCAGGATGGATTTG
TGACTTGAAATTTCATAAATATGAATATGGTTTCTATTTTGCTGGCTCAA
TGATTATTTTGTCAGGAATTTTGTGTTTTCCATTGAGATTTGTAGCGAAA
TTGGAACGTGATTATATTGAGAAACGTTACGGTCGAATAGTTATAGACGA
GGAAAACAGTGTAGGAACGTCTAGTTGTGTTGATATTAATGCTGAAAATA
GTGAACAGATCGAAATGACAAATAACAATTCAGGTTTACCAGCCAATAAA
TCAGATGATTATGGTGACAAAACCATAAATCTTTCTGAAAATACAAAAAT
AGATGTTTATGAACTGAATGACGAAGTCAGCAATCTAGCGCCCGTAGTTG
AAGAAGAGGAAGAAGACTTTCATTCAGATAATCAACTAGACAAACCAGAT
CTATTTGAAGTGAAAAAGGTTCAATGAGTCAATATACTTGAATAATTCAA
TAATTCAATGTCTGTAATAATTGATAAACCAGTCATTCTCAAAACAAAAG
AGGCCTGCACTTTTTCATTGTTGTAAAAAAGTCATACAAATCTAAGAAAA
TATTTTCTTAAACACTCAGCACGCTTTATCTCTGATTTGGTCATTAGAAT
AGACTGTTCCAATCTCAGATTTGTACCAATCTTTAATTGTTTTCTGTTAC
ACATGTTGAGCTCTTAAGTCTTTCATTTTTCTATATCAATCTTACTATTT
ATCATCA
back to top

protein sequence of SMED30005453-orf-1

>SMED30005453-orf-1 ID=SMED30005453-orf-1|Name=SMED30005453-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1062bp
MATEVSTTLHYTNYPKYDSSHIFDVTAYPTHNEESNESYAKKSEILNING
VDDLINTYQNKDPEAEDVLTELDQNEIERRQREANEETTRSEDLRQFLQE
MHQKCQPNDSSVYNNAWPPGKSAVVPSSPGSVAKLTNNNGPYFTDPSPYK
QMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNY
GLLVPEMMETFQENDIMSFMWPGSLLAGFYMSMGPVASALSNQFDFRPVA
LAGGIISGIAILLSSFMNNLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWF
HEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCL
VFIVLFRPLELHLRMQQLSKIRSTIRQMRREEDEHKRLEHEKEIEAEKKR
KKAEKEELRNNNRMKNKRIVIYRGSIMQKIIEEKKRQRTVSMGSLDGMVI
TRDNELIKVAKSSIDLYEKPILSMDAINRITESVVKRLENKMNKHGPNGV
VSIVDSKNGGINGSSNMTNNQLKNSLSQLVQEYINSQMSLQVWNTQLINN
TNANVPTSPQTLNNIQGTLSPSGKEFLVFPSPNHQSSTNISESTSTKSET
SSKTSLNHGMALEEGAKAVIQASLRKEMTRPFNQKELFFTGSMRQLSNNM
TETSSIPDSNRRFSLATWIDSTKRSQTSLNVINACNTSLNSQPSVGIGVN
ESANISILEGFIDQNQSPVSGDVYGNAYLDPNQNTVNNQNVNTDGPFRAF
MRELLDVSLLTSPTFIIMVISSVASMIGIFVPFYFLPGYIKSLDMDLKIA
GGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTA
CSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGF
LLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGSMIILSGILCFPLRF
VAKLERDYIEKRYGRIVIDEENSVGTSSCVDINAENSEQIEMTNNNSGLP
ANKSDDYGDKTINLSENTKIDVYELNDEVSNLAPVVEEEEEDFHSDNQLD
KPDLFEVKKVQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016603glutaminyl-peptide cyclotransferase activity
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR037457M28_QC
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 377..424
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 762..960
e-value: 1.7E-16
score: 62.1
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 183..437
e-value: 3.0E-18
score: 67.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1043..1067
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 589..613
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1051..1067
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 386..415
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 174..956
NoneNo IPR availablePANTHERPTHR11360:SF168GH22266Pcoord: 174..956
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 185..363
e-value: 1.13791E-50
score: 181.212
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 765..955
e-value: 4.70307E-45
score: 164.648
NoneNo IPR availableTMHMMTMhelixcoord: 311..333
NoneNo IPR availableTMHMMTMhelixcoord: 279..301
NoneNo IPR availableTMHMMTMhelixcoord: 223..245
NoneNo IPR availableTMHMMTMhelixcoord: 842..864
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 936..958
NoneNo IPR availableTMHMMTMhelixcoord: 904..926
NoneNo IPR availableTMHMMTMhelixcoord: 255..272
NoneNo IPR availableTMHMMTMhelixcoord: 770..792
NoneNo IPR availableTMHMMTMhelixcoord: 340..362
NoneNo IPR availableTMHMMTMhelixcoord: 869..891
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 194..418
e-value: 5.3E-21
score: 74.9
coord: 849..955
e-value: 4.2E-9
score: 35.8
IPR037457M28 Zn-Peptidase Glutaminyl CyclaseCDDcd03880M28_QC_likecoord: 533..585
e-value: 1.45418E-4
score: 42.9964
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 179..956