Nicalin

Overview
NameNicalin
Smed IDSMED30005444
Length (bp)2275
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nicalin (SMED30005444) t-SNE clustered cells

Violin plots show distribution of expression levels for Nicalin (SMED30005444) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nicalin (SMED30005444) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nicalin (SMED30005444) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005444

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30005444h1SMcG0008947 SmedASXL_006355SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30005444h1SMcG0008947 dd_Smed_v4_1389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005444h1SMcG0008947 dd_Smed_v4_1389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005444h1SMcG0008947 dd_Smed_v4_1389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005444h1SMcG0008947 dd_Smed_v4_1389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005444h1SMcG0008947 dd_Smed_v4_1389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005444h1SMcG0008947 dd_Smed_v4_1389_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nicalin vs. Ensembl Human
Match: NCLN (nicalin [Source:HGNC Symbol;Acc:HGNC:26923])

HSP 1 Score: 350.517 bits (898), Expect = 3.792e-111
Identity = 211/553 (38.16%), Postives = 336/553 (60.76%), Query Frame = 2
Query:  239 SVIPYYFVLIVP--LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKISI 1858
            S +P  F++ +P  LL+   P+    AA +FT +R+ QYD+QG   G+R++  N EA+T  +++LSR+C+L+++++ S    + A+ Q+ G+++I+LP   +     +      +E E+L  + A+P+YFA     + +IY   Q    S  S SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ I ++ G+L G G E+ LPT++IVAHYD+ G+AP L+ G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L             ++VHKRINL ED L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P      E+  + +E + + +  LT  PR+ QL+      + + E  + RYL  +V+   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y+ V++FS + + V ++ +
Sbjct:   16 SCLPLGFIVFLPAVLLLVAPPLPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVLMRLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVYFAVEDEALLSIYKQTQAASASQGSASAAEVLLRTATANGFQMVTSGVQS-KAVSDWLIASVEGRLTGLGGED-LPTIVIVAHYDAFGVAPWLSLGADSNGSGVSVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDNLDHTD-----SSLLQDNVAFVLCLDTVG--RGSSLHLHVSKPPREGTLQHAFLRELETVAAHQFPEVRFSMVHKRINLAEDVLAWEHERFAIRRLPAFTLSHLESHRDGQRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMQIQQEQLDSVMDWLTNQPRAAQLVDKDSTFLSTLEHHLSRYL-KDVKQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAVFDLLLAVGIAAYLGMAYVAVQHFSLLYKTVQRLLV 558          
BLAST of Nicalin vs. Ensembl Human
Match: NCLN (nicalin [Source:HGNC Symbol;Acc:HGNC:26923])

HSP 1 Score: 317.005 bits (811), Expect = 3.184e-99
Identity = 183/478 (38.28%), Postives = 286/478 (59.83%), Query Frame = 2
Query:  452 IMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKI 1852
            +++ S    + A+ Q+ G+++I+LP   +     +      +E E+L  + A+P+YFA     + +IY   Q    S  S SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ I ++ G+L G G E+ LPT++IVAHYD+ G+AP L+ G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L             ++VHKRINL ED L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P      E+  + +E + + +  LT  PR+ QL+      + + E  + RYL  +V+   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y+ V++FS + + V ++
Sbjct:   15 LLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVYFAVEDEALLSIYKQTQAASASQGSASAAEVLLRTATANGFQMVTSGVQS-KAVSDWLIASVEGRLTGLGGED-LPTIVIVAHYDAFGVAPWLSLGADSNGSGVSVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDNLDHTD-----SSLLQDNVAFVLCLDTVG--RGSSLHLHVSKPPREGTLQHAFLRELETVAAHQFPEVRFSMVHKRINLAEDVLAWEHERFAIRRLPAFTLSHLESHRDGQRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMQIQQEQLDSVMDWLTNQPRAAQLVDKDSTFLSTLEHHLSRYL-KDVKQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAVFDLLLAVGIAAYLGMAYVAVQHFSLLYKTVQRL 482          
BLAST of Nicalin vs. Ensembl Human
Match: NCLN (nicalin [Source:HGNC Symbol;Acc:HGNC:26923])

HSP 1 Score: 271.166 bits (692), Expect = 1.151e-83
Identity = 146/351 (41.60%), Postives = 217/351 (61.82%), Query Frame = 2
Query:  830 EQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKI 1852
            E LPT++IVAHYD+ G+AP L+ G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L             ++VHKRINL ED L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P      E+  + +E + + +  LT  PR+ QL+      + + E  + RYL  +V+   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y+ V++FS + + V ++
Sbjct:    1 EDLPTIVIVAHYDAFGVAPWLSLGADSNGSGVSVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDNLDHTD-----SSLLQDNVAFVLCLDTVG--RGSSLHLHVSKPPREGTLQHAFLRELETVAAHQFPEVRFSMVHKRINLAEDVLAWEHERFAIRRLPAFTLSHLESHRDGQRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMQIQQEQLDSVMDWLTNQPRAAQLVDKDSTFLSTLEHHLSRYL-KDVKQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAVFDLLLAVGIAAYLGMAYVAVQHFSLLYKTVQRL 343          
BLAST of Nicalin vs. Ensembl Human
Match: NCLN (nicalin [Source:HGNC Symbol;Acc:HGNC:26923])

HSP 1 Score: 216.468 bits (550), Expect = 2.158e-63
Identity = 118/271 (43.54%), Postives = 173/271 (63.84%), Query Frame = 2
Query:  707 LISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP 1501
            L+ +  +NG+Q+ TS  Q+ K + D+ I ++ G+L G G E+ LPT++IVAHYD+ G+AP L+ G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L             ++VHKRINL ED L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P
Sbjct:   63 LLRTATANGFQMVTSGVQS-KAVSDWLIASVEGRLTGLGGED-LPTIVIVAHYDAFGVAPWLSLGADSNGSGVSVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDNLDHTD-----SSLLQDNVAFVLCLDTVG--RGSSLHLHVSKPPREGTLQHAFLRELETVAAHQFPEVRFSMVHKRINLAEDVLAWEHERFAIRRLPAFTLSHLESHRDGQRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPP 324          
BLAST of Nicalin vs. Ensembl Human
Match: NCLN (nicalin [Source:HGNC Symbol;Acc:HGNC:26923])

HSP 1 Score: 182.57 bits (462), Expect = 1.758e-51
Identity = 105/282 (37.23%), Postives = 165/282 (58.51%), Query Frame = 2
Query: 1034 FIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNY--SVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP---IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKI 1852
            + GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L    +        ++VHKRINL ED L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P   +  E  + +E + + +  LT  PR+ QL+      + + E  + RYL  +V+   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y+ V++FS + + V ++
Sbjct:    2 YQGTKRWLEDNLDHTD-----SSLLQDNVAFVLCLDTVG--RGSSLHLHVSKPPREGTLQHAFLRELETVAAHQFPEVRFSMVHKRINLAEDVLAWEHERFAIRRLPAFTLSHLESHRDGQRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMIQQEQLDSVMDWLTNQPRAAQLVDKDSTFLSTLEHHLSRYL-KDVKQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAVFDLLLAVGIAAYLGMAYVAVQHFSLLYKTVQRL 275          
BLAST of Nicalin vs. Ensembl Celegans
Match: nra-2 (Nicalin [Source:UniProtKB/TrEMBL;Acc:A5JYX8])

HSP 1 Score: 156.762 bits (395), Expect = 2.562e-40
Identity = 140/518 (27.03%), Postives = 254/518 (49.03%), Query Frame = 2
Query:  320 QFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLP--LKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIH---EVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGLEDGYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARD---------PEFVLYSDAEV------TIIAHRVKPALFDFLVACVIIAYLGLVY 1804
            +F A+RLHQY+I G   G ++   + EA  S      R+ ++    ++    +    + + G+++I +P  L    D   K  I +LE +LL     + +Y A    +  +I  +V     S K+ +A Q L+ S+  N   + TSS Q+ +    ++  NI G+L+    +   PT+  VAHYD+    P ++ G DSNGSG+V +++L+ + S+ Y +  ++  YN+ F+ +  GKLN+ GT+ W++E     + AD + +  +   DR+ LA+C+E +G  +  G  +H  K P E S   + ++ LN      N  + +V K+I+L      WEHE+F++++MPA+T+S         R SILD   ++  + L  N R + + ++  +  L +  GP        +  +K++ ++L++    +Q +   H  I  F     R +G+      I ++               V  +DA+        ++A RVKPA+F+ ++A  +  YL   Y
Sbjct:   40 EFHAYRLHQYEISGNIYGCKNYRVSYEA-VSLGARTLRRTMVTTWRDLLTTDVDDMWALSTGAVLIFIPDNLDELNDIDRKAFI-DLEAKLLSAKTDLAVYVAPFNDDAVSILHDVN--TRSEKAPTALQHLLQSLSGNTISI-TSSDQSPELPPSYKPLNIVGRLSSG--DRAAPTIAFVAHYDTQSAVPGVSPGADSNGSGIVALLELLAVLSKFYDSPSTRPPYNILFIWTAAGKLNYQGTRHWIDEYQKGFDSADYAKSGLSRKDDRVDLAICIEAIG-RKTGGFFMHAGKTPSENSVAAQLLRRLNSISPKKN--IELVTKKISLTTVS-AWEHEKFNIKRMPAITLSTLPSPSDPARNSILDLPSALDEDELIDNIRLIGEAVLGYILDLPES-GP------SSDSRVKSEATMLSKDAVDKQRV---HHFIRQFAS-RPRPVGDQRATESITSNLASVAAGYGNVFKSAVTITDAKAFGVTQNRLVAERVKPAVFELVIAAGVFTYLSAFY 535          
BLAST of Nicalin vs. Ensembl Celegans
Match: nra-2 (Nicalin [Source:UniProtKB/TrEMBL;Acc:A5JYX8])

HSP 1 Score: 156.377 bits (394), Expect = 4.191e-40
Identity = 139/522 (26.63%), Postives = 255/522 (48.85%), Query Frame = 2
Query:  320 QFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLP--LKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASST------INTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNY-SVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGLEDGYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARD---------PEFVLYSDAEV------TIIAHRVKPALFDFLVACVIIAYLGLVY 1804
            +F A+RLHQY+I G   G ++   + EA  S      R+ ++    ++    +    + + G+++I +P  L    D   K  I +LE +LL     + +Y A    +  +I  +V     S K+ +A Q L+ S+  N   + TSS Q+ +    ++  NI G+L+    +   PT+  VAHYD+    P ++ G DSNGSG+V +++L+ + S+ Y +  ++  YN+ F+ +  GKLN+ GT+ W++E  +  D +  + +       + DR+ LA+C+E +G  +  G  +H  K P E S   + ++ L Y S      ++ +V K+I+L      WEHE+F++++MPA+T+S         R SILD   ++  + L  N R + + ++  +  L +  GP        +  +K++ ++L++    +Q +   H  I  F     R +G+      I ++               V  +DA+        ++A RVKPA+F+ ++A  +  YL   Y
Sbjct:   40 EFHAYRLHQYEISGNIYGCKNYRVSYEA-VSLGARTLRRTMVTTWRDLLTTDVDDMWALSTGAVLIFIPDNLDELNDIDRKAFI-DLEAKLLSAKTDLAVYVAPFNDDAVSILHDVN--TRSEKAPTALQHLLQSLSGNTISI-TSSDQSPELPPSYKPLNIVGRLSSG--DRAAPTIAFVAHYDTQSAVPGVSPGADSNGSGIVALLELLAVLSKFYDSPSTRPPYNILFIWTAAGKLNYQGTRHWIDEYQKGFDSADYAKSGLSRKGFSDDRVDLAICIEAIG-RKTGGFFMHAGKTPSENSVAAQLLRRLKYFSSISPKKNIELVTKKISLTTVS-AWEHEKFNIKRMPAITLSTLPSPSDPARNSILDLPSALDEDELIDNIRLIGEAVLGYILDLPES-GP------SSDSRVKSEATMLSKDAVDKQRV---HHFIRQFAS-RPRPVGDQRATESITSNLASVAAGYGNVFKSAVTITDAKAFGVTQNRLVAERVKPAVFELVIAAGVFTYLSAFY 541          
BLAST of Nicalin vs. Ensembl Fly
Match: CG4972 (gene:FBgn0032217 transcript:FBtr0079988)

HSP 1 Score: 209.149 bits (531), Expect = 1.405e-58
Identity = 173/574 (30.14%), Postives = 287/574 (50.00%), Query Frame = 2
Query:  203 MTVFEDLTECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLKS-TWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESS--KSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIE----------EQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKL-NFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCL----ERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNSSLNV--VHKRINLNEDELQWEHERFSLRKMPALTVSAERD-RFTNRKSIL--DDSISVELLARNTRAVADTLMRLLYGLEDGYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            M   + LTE  R  +P+  +++  LL+  SP+ P     +F    + +YD+ G   GSR ++ +LEA++ +S   SR C+L ++ ++S       + Q  G +I++LP      D   KE I+ LE+ +L    A+PIYFA    ++E I  ++      S  ++ +A   L+ ++ +N Y +           ++ +I  I G+L  N +           ++LP +LI A+  + G+        D+      +++ LM +FS+L+       KY L FLLS  G L NF G+KKWLE    V D +          +   +CL    E L    ++ + +HVSKPPK+ +S   + K L  S    ++ L V  VHK+INL + +L WEHERFS+++ P+ T+S+ +  R   R +I   D+S  VE     TR +A+ L   +Y + D    I E    ++E      ++L  F     L    + +  +FE+ +     NNV++   + DARDPEF+ Y++ EV +  +RVKPA+FD  +  VI AYL  V+L ++ F      V K++
Sbjct:    2 MNEADSLTEIFRGGLPHCLLIVFSLLLTCSPVMP----SEFEVISMSKYDLNGQHYGSRVASISLEARSLYSWNTSRHCVLTRLTDLSIHDFD-KLRQGAGGLILMLPANILNLDPETKELITILEQSMLTHTAAVPIYFAPYNKDLEKIIDDITYTTTDSPGQNQTALAQLVVTVSANRYHINVGGGSIAAN-KNSKIPIIHGELIPNQLALKPTESVADGQKLPVILITANLKTFGIYNDYPVNADA-----AVLLVLMELFSKLHYTSSMAPKYRLRFLLSDAGVLLNFQGSKKWLE----VDDNA-------LQNVEFVLCLDTISESLSYTTENALYMHVSKPPKDKTSISNFFKLLKSSAEKYSNGLAVEGVHKKINLADTKLAWEHERFSIKRYPSFTLSSVKSPRSPIRTTIFKNDESRLVEHTLNTTRIIAEALASFMYKV-DPTSSIFEGQLAIKEE-----NILPYFGVKSILHN--NDVKDAFEKYL-----NNVKIIYDKPDARDPEFMFYNENEVKLNVYRVKPAIFDLFLTFVIGAYLLAVFLAIQYFPRFYDEVSKLT 540          
BLAST of Nicalin vs. Ensembl Zebrafish
Match: ncln (nicalin [Source:NCBI gene;Acc:336844])

HSP 1 Score: 371.703 bits (953), Expect = 1.759e-119
Identity = 224/574 (39.02%), Postives = 350/574 (60.98%), Query Frame = 2
Query:  209 VFEDLTECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNSSLN--VVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD-DSISVEL----------------LARNTRAVADTLMRLLYGLED----GYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            +FE+  E L +++   F L + L + +      +AA +F+ +R+ QYD+QG   GSR++  N EA+T  +++LSR+C+++++ + S    + A+ Q+ G+++I+LP   ST    + +    LE ELL  +  +P+YFA    E+ +IY+  Q    S  S+SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ IT++ G+L G+G E+ LPT+++VAHYDS G+AP L++G DSNGSGV ++++L R+FSRLY+ +R+ A YNL F LSGGGK N+ GTK+WLE+  +  D S     +  D +   +CL+ LG    D + +HVSKPPKEGS  +  +K L   V   +  L   +VHK+INL +D L WEHERF +R++PA T+S  E  R   R SI+D  S+S  L                L+RNT+ +A+TL R++Y L +    G   I  E  V E+ + + +  LT  PR+ QLL     +I + E  + RYL  +V+   +RAD RDPEFV Y   + T+ A+RVKPA+FD L+A  I +YLG++YL ++NF  +   + +++
Sbjct:    1 MFEEAGEVLENMLKVSFPLSLVLFLVLVCPLRAEAAHEFSVYRMQQYDLQGQTYGSRNAILNTEARTVEAEVLSRRCVMMRLADFSYEKYQKALRQSAGAVVIILPHNMSTLPQDIVQQFMELEPELLATETIVPVYFALEDEELLSIYTQTQISSSSQGSSSAAEVLLHTATANGFQMVTSGAQS-KAVSDWAITSLEGRLTGSGGED-LPTIVLVAHYDSFGVAPWLSYGADSNGSGVAILLELARLFSRLYSYKRTHAGYNLLFFLSGGGKFNYQGTKRWLEDNLDHTDAS-----LLQDNVAFVLCLDTLG--NSDNLHLHVSKPPKEGSPQYTLLKELETVVAHQHPDLKFAMVHKKINLADDTLAWEHERFGIRRLPAFTLSHLESHRSPARHSIMDMRSVSPSLEGAGEATTGPHVDLGKLSRNTKVIAETLARVIYNLTEKGVTGDLEIFTEQMVQEDQLASLVDWLTAQPRAAQLLDKDSSIINTLEHQLSRYL-KDVKRHLVRADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLAVCIASYLGVLYLAIQNFGLLYGFLRRVT 564          
BLAST of Nicalin vs. Ensembl Zebrafish
Match: ncln (nicalin [Source:NCBI gene;Acc:336844])

HSP 1 Score: 368.237 bits (944), Expect = 4.831e-118
Identity = 224/575 (38.96%), Postives = 350/575 (60.87%), Query Frame = 2
Query:  209 VFEDLTECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNSSLN--VVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD-DSISVEL----------------LARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            +FE+  E L +++   F L + L + +      +AA +F+ +R+ QYD+QG   GSR++  N EA+T  +++LSR+C+++++ + S    + A+ Q+ G+++I+LP   ST    + +    LE ELL  +  +P+YFA    E+ +IY+  Q    S  S+SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ IT++ G+L G+G E+ LPT+++VAHYDS G+AP L++G DSNGSGV ++++L R+FSRLY+ +R+ A YNL F LSGGGK N+ GTK+WLE+  +  D S     +  D +   +CL+ LG    D + +HVSKPPKEGS  +  +K L   V   +  L   +VHK+INL +D L WEHERF +R++PA T+S  E  R   R SI+D  S+S  L                L+RNT+ +A+TL R++Y L E G         E+  V E+ + + +  LT  PR+ QLL     +I + E  + RYL  +V+   +RAD RDPEFV Y   + T+ A+RVKPA+FD L+A  I +YLG++YL ++NF  +   + +++
Sbjct:    1 MFEEAGEVLENMLKVSFPLSLVLFLVLVCPLRAEAAHEFSVYRMQQYDLQGQTYGSRNAILNTEARTVEAEVLSRRCVMMRLADFSYEKYQKALRQSAGAVVIILPHNMSTLPQDIVQQFMELEPELLATETIVPVYFALEDEELLSIYTQTQISSSSQGSSSAAEVLLHTATANGFQMVTSGAQS-KAVSDWAITSLEGRLTGSGGED-LPTIVLVAHYDSFGVAPWLSYGADSNGSGVAILLELARLFSRLYSYKRTHAGYNLLFFLSGGGKFNYQGTKRWLEDNLDHTDAS-----LLQDNVAFVLCLDTLG--NSDNLHLHVSKPPKEGSPQYTLLKELETVVAHQHPDLKFAMVHKKINLADDTLAWEHERFGIRRLPAFTLSHLESHRSPARHSIMDMRSVSPSLEGAGEATTGPHVDLGKLSRNTKVIAETLARVIYNLTEKGVTGDLEIFTEQMQVQEDQLASLVDWLTAQPRAAQLLDKDSSIINTLEHQLSRYL-KDVKRHLVRADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLAVCIASYLGVLYLAIQNFGLLYGFLRRVT 565          
BLAST of Nicalin vs. Ensembl Zebrafish
Match: zgc:109965 (zgc:109965 [Source:ZFIN;Acc:ZDB-GENE-050913-21])

HSP 1 Score: 291.197 bits (744), Expect = 1.914e-88
Identity = 181/525 (34.48%), Postives = 292/525 (55.62%), Query Frame = 2
Query:  302 PVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLP--LKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNY--SVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILDDSISVEL--LARNTRAVADTLMRLLYGLEDGYGPIIEEHW-----VMEEAIKADLSLLTRFPRSQQLLG--PKHPLIL-SFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSI 1831
            P  ++ +F A+R+  Y++   K G R +    EA+++    L+R+C+++K+++ S      A  QN  +++ILLP  L S  + T++  +   E ++L ++  +P+Y      ++  +Y  V Q + S  ++   + L S I S  +Q+  S+    KP+ D  I  + G L G G  E  PT++I AH+D+ G+AP LA+G DSNGSGV ++++L+R+F RL +  RSQA Y+L F L+GGGK NF+GTK WLEE     +   A S++  D +   +CL+ LG    D I +HVS+PPK G+  + +I+ L    S          VHK+INL E  + WEHER+ ++++P  T+S  E  +   R SILD    V++  L RNT  VA++L R +Y L D       + +     + +  + A +++LT  PR+ QLL   P+H L++ S E+  + YL   V       D RDPE   +   +  ++ +RVKPA FD  +   I  YLG+VY  ++NF ++
Sbjct:   64 PAASSYEFNAYRMQHYNLHQHKHGCRGAIVVAEARSAADTSLTRRCVIMKLLDFSTERFLEAKKQNAAAVLILLPQNLSSVQEETVQGFMV-AEAQILQEETILPVYVVPEDEQLLCMYEEVNQAVASKSASVLVRVLRSMITSTAFQILVSNNSPIKPITDTSIITLEGVLPGAG--EDPPTIVITAHFDTFGLAPWLAYGADSNGSGVAILLELVRLFHRLNSNPRSQAPYHLLFSLTGGGKYNFLGTKHWLEE-----NMDHAESSLLHDNVEFVICLDSLGTG--DEIFLHVSRPPKPGTPQYSFIQQLEQIISARFPWVRFGTVHKKINLQETNVAWEHERYGMKRIPGFTLSHIENPKSELRGSILDTIAQVDMRKLKRNTVIVAESLARFMYNLSDKGSAKDMQVFKGSLDIQDSRLSALMTMLTSVPRAVQLLDREPEHTLLINSLEQEFKHYL-KQVHKHTFHQDRRDPEITFFDQMKQPMMMYRVKPAAFDLFLGGCIAGYLGIVYYGIQNFGNV 577          
BLAST of Nicalin vs. Ensembl Xenopus
Match: ncln (nicalin [Source:NCBI gene;Acc:595051])

HSP 1 Score: 389.037 bits (998), Expect = 9.936e-126
Identity = 220/561 (39.22%), Postives = 349/561 (62.21%), Query Frame = 2
Query:  209 VFEDLTECLRSVIPYYFVLIVP-LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNY--SVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGLEDGYGP-----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            VF+++   L++  P  F++ +P +L+ +SP+   +AA +FT +R+  YD+QG   G+R+S  N EA+T  + +LSR+C+L+++ + S    + A+ Q+ G+++I+LP   +     + +   ++E E+L  +  +P+YFA    E+ +IY        S  ++SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ +T++ G+L G G E+ LPT+ IVAHYDS G+AP L++G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ LG    D + +HVSKPP+EG+  H +++ L    S        ++VHK+INL ED L WEHERF++R++PA TVS  E  R  +R SILD    +  ++LARNTR +A+ L R++Y L +   P       ++  V +E + A +  LT  PR+ QL+     L+ + E  M RYL  +V+   ++AD RDPEFV Y   + T+ A+RVKPA+FD L+A  I AYLGL Y  V+NF  + ++V ++S
Sbjct:   37 VFDNM---LKASFPLTFIVFLPAVLLLVSPLQ-AEAAHEFTVYRMQHYDLQGQSYGTRNSVLNTEARTVQADVLSRRCVLMRLADFSFEQYQKALRQSAGAVVIILPPNMAALPQDIVQQFMDIEPEMLSMETQVPVYFAVEDEELLSIYEQTLAASASQGTSSAAEVLLHTATANGFQMVTSGAQS-KAVSDWLVTSVEGRLTGLGAED-LPTIAIVAHYDSFGVAPWLSYGADSNGSGVTILLELARLFSRLYTYKRTHAGYNLLFFASGGGKFNYQGTKRWLEDHLDHTD-----SSLLQDNVAFVLCLDTLG--NGDTLHLHVSKPPREGTLQHAFLRELEMIISSQFPEVKFSMVHKKINLAEDTLAWEHERFAIRRLPAFTVSHLESHRSGHRNSILDLRWKVDTQVLARNTRIIAEALTRVIYNLTEKAAPSDLQIFTQQMQVQKEQLDAVMQWLTGQPRAAQLVDKDSSLLSTLEYYMSRYL-KDVKFYHVKADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLALCIAAYLGLSYFAVQNFGLLYKLVQRVS 583          
BLAST of Nicalin vs. Ensembl Xenopus
Match: ncln (nicalin [Source:NCBI gene;Acc:595051])

HSP 1 Score: 387.497 bits (994), Expect = 2.590e-125
Identity = 221/571 (38.70%), Postives = 350/571 (61.30%), Query Frame = 2
Query:  209 VFEDLTECLRSVIPYYFVLIVP-LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALN--YSVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILDDS------------ISVELLARNTRAVADTLMRLLYGLEDGYGP-----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            VF+++   L++  P  F++ +P +L+ +SP+   +AA +FT +R+  YD+QG   G+R+S  N EA+T  + +LSR+C+L+++ + S    + A+ Q+ G+++I+LP   +     + +   ++E E+L  +  +P+YFA    E+ +IY        S  ++SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ +T++ G+L G G E+ LPT+ IVAHYDS G+AP L++G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ LG    D + +HVSKPP+EG+  H +++ L     V       ++VHK+INL ED L WEHERF++R++PA TVS  E  R  +R SILD S            +  ++LARNTR +A+ L R++Y L +   P       ++  V +E + A +  LT  PR+ QL+     L+ + E  M RYL  +V+   ++AD RDPEFV Y   + T+ A+RVKPA+FD L+A  I AYLGL Y  V+NF  + ++V ++S
Sbjct:    8 VFDNM---LKASFPLTFIVFLPAVLLLVSPLQ-AEAAHEFTVYRMQHYDLQGQSYGTRNSVLNTEARTVQADVLSRRCVLMRLADFSFEQYQKALRQSAGAVVIILPPNMAALPQDIVQQFMDIEPEMLSMETQVPVYFAVEDEELLSIYEQTLAASASQGTSSAAEVLLHTATANGFQMVTSGAQS-KAVSDWLVTSVEGRLTGLGAED-LPTIAIVAHYDSFGVAPWLSYGADSNGSGVTILLELARLFSRLYTYKRTHAGYNLLFFASGGGKFNYQGTKRWLEDHLDHTD-----SSLLQDNVAFVLCLDTLG--NGDTLHLHVSKPPREGTLQHAFLRELEMVMVVQFPEVKFSMVHKKINLAEDTLAWEHERFAIRRLPAFTVSHLESHRSGHRNSILDLSNLVSDCSLCRWKVDTQVLARNTRIIAEALTRVIYNLTEKAAPSDLQIFTQQMQVQKEQLDAVMQWLTGQPRAAQLVDKDSSLLSTLEYYMSRYL-KDVKFYHVKADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLALCIAAYLGLSYFAVQNFGLLYKLVQRVS 564          
BLAST of Nicalin vs. Ensembl Xenopus
Match: ncln (nicalin [Source:NCBI gene;Acc:595051])

HSP 1 Score: 348.206 bits (892), Expect = 1.352e-110
Identity = 200/523 (38.24%), Postives = 322/523 (61.57%), Query Frame = 2
Query:  209 VFEDLTECLRSVIPYYFVLIVP-LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNY--SVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGLEDGYGP-----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRV 1741
            VF+++   L++  P  F++ +P +L+ +SP+   +AA +FT +R+  YD+QG   G+R+S  N EA+T  + +LSR+C+L+++ + S    + A+ Q+ G+++I+LP   +     + +   ++E E+L  +  +P+YFA    E+ +IY        S  ++SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ +T++ G+L G G E+ LPT+ IVAHYDS G+AP L++G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ LG    D + +HVSKPP+EG+  H +++ L    S        ++VHK+INL ED L WEHERF++R++PA TVS  E  R  +R SILD    +  ++LARNTR +A+ L R++Y L +   P       ++  V +E + A +  LT  PR+ QL+     L+ + E  M RYL  +V+   ++AD RDPEFV Y   + T+ A+R+
Sbjct:    8 VFDNM---LKASFPLTFIVFLPAVLLLVSPLQ-AEAAHEFTVYRMQHYDLQGQSYGTRNSVLNTEARTVQADVLSRRCVLMRLADFSFEQYQKALRQSAGAVVIILPPNMAALPQDIVQQFMDIEPEMLSMETQVPVYFAVEDEELLSIYEQTLAASASQGTSSAAEVLLHTATANGFQMVTSGAQS-KAVSDWLVTSVEGRLTGLGAED-LPTIAIVAHYDSFGVAPWLSYGADSNGSGVTILLELARLFSRLYTYKRTHAGYNLLFFASGGGKFNYQGTKRWLEDHLDHTD-----SSLLQDNVAFVLCLDTLG--NGDTLHLHVSKPPREGTLQHAFLRELEMIISSQFPEVKFSMVHKKINLAEDTLAWEHERFAIRRLPAFTVSHLESHRSGHRNSILDLRWKVDTQVLARNTRIIAEALTRVIYNLTEKAAPSDLQIFTQQMQVQKEQLDAVMQWLTGQPRAAQLVDKDSSLLSTLEYYMSRYL-KDVKFYHVKADKRDPEFVFYDQLKQTMNAYRI 516          
BLAST of Nicalin vs. Ensembl Xenopus
Match: ncln (nicalin [Source:NCBI gene;Acc:595051])

HSP 1 Score: 330.487 bits (846), Expect = 6.028e-104
Identity = 203/562 (36.12%), Postives = 325/562 (57.83%), Query Frame = 2
Query:  209 VFEDLTECLRSVIPYYFVLIVP-LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNY--SVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILDDSIS----VELLARNTRAVADTLMRLLYGLEDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            VF+++   L++  P  F++ +P +L+ +SP+   +AA +FT +R+  YD+QG   G+R+S  N EA+T  + +LSR+C+L+++ + S    + A+ Q+ G+++I+LP   +     + +   ++E E+L  +  +P+YFA    E+ +IY        S  ++SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ +TN           ++L +                    DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ LG    D + +HVSKPP+EG+  H +++ L    S        ++VHK+INL ED L WEHERF++R++PA TVS  E  R  +R SILD   +      +LARNTR +A+ L R++Y L +   P    I  +  V +E + A +  LT  PR+ QL+     L+ + E  M RYL  +V+   ++AD RDPEFV Y   + T+ A+RVKPA+FD L+A  I AYLGL Y  V+NF  + ++V ++S
Sbjct:    8 VFDNM---LKASFPLTFIVFLPAVLLLVSPLQ-AEAAHEFTVYRMQHYDLQGQSYGTRNSVLNTEARTVQADVLSRRCVLMRLADFSFEQYQKALRQSAGAVVIILPPNMAALPQDIVQQFMDIEPEMLSMETQVPVYFAVEDEELLSIYEQTLAASASQGTSSAAEVLLHTATANGFQMVTSGAQS-KAVSDWLVTN-----------DRLHS--------------------DSNGSGVTILLELARLFSRLYTYKRTHAGYNLLFFASGGGKFNYQGTKRWLEDHLDHTD-----SSLLQDNVAFVLCLDTLG--NGDTLHLHVSKPPREGTLQHAFLRELEMIISSQFPEVKFSMVHKKINLAEDTLAWEHERFAIRRLPAFTVSHLESHRSGHRNSILDLRWAEFRFWLVLARNTRIIAEALTRVIYNLTEKAAPSDLQIFTQQMVQKEQLDAVMQWLTGQPRAAQLVDKDSSLLSTLEYYMSRYL-KDVKFYHVKADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLALCIAAYLGLSYFAVQNFGLLYKLVQRVS 525          
BLAST of Nicalin vs. Ensembl Xenopus
Match: ncln (nicalin [Source:NCBI gene;Acc:595051])

HSP 1 Score: 290.812 bits (743), Expect = 8.925e-90
Identity = 171/468 (36.54%), Postives = 266/468 (56.84%), Query Frame = 2
Query:  485 AISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALN--YSVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGLEDGYGP-----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            A+ Q+ G+++I+LP   +     + +   ++E E+L  +  +P+YFA    E+ +IY        S  ++SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ +TN           ++L +                    DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ LG    D + +HVSKPP+EG+  H +++ L     V       ++VHK+INL ED L WEHERF++R++PA TVS  E  R  +R SILD    +  ++LARNTR +A+ L R++Y L +   P       ++  V +E + A +  LT  PR+ QL+     L+ + E  M RYL  +V+   ++AD RDPEFV Y   + T+ A+RVKPA+FD L+A  I AYLGL Y  V+NF  + ++V ++S
Sbjct:   27 ALRQSAGAVVIILPPNMAALPQDIVQQFMDIEPEMLSMETQVPVYFAVEDEELLSIYEQTLAASASQGTSSAAEVLLHTATANGFQMVTSGAQS-KAVSDWLVTN-----------DRLHS--------------------DSNGSGVTILLELARLFSRLYTYKRTHAGYNLLFFASGGGKFNYQGTKRWLEDHLDHTD-----SSLLQDNVAFVLCLDTLG--NGDTLHLHVSKPPREGTLQHAFLRELEMVMVVQFPEVKFSMVHKKINLAEDTLAWEHERFAIRRLPAFTVSHLESHRSGHRNSILDLRWKVDTQVLARNTRIIAEALTRVIYNLTEKAAPSDLQIFTQQMQVQKEQLDAVMQWLTGQPRAAQLVDKDSSLLSTLEYYMSRYL-KDVKFYHVKADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLALCIAAYLGLSYFAVQNFGLLYKLVQRVS 454          
BLAST of Nicalin vs. Ensembl Mouse
Match: Ncln (nicalin [Source:MGI Symbol;Acc:MGI:1926081])

HSP 1 Score: 354.369 bits (908), Expect = 8.605e-113
Identity = 213/550 (38.73%), Postives = 334/550 (60.73%), Query Frame = 2
Query:  239 SVIPYYFVLIVP--LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYG---PIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKI 1852
            S +P  F++ +P  LL+   P+    AA +FT +R+ QYD+QG   G+R++  N EA+T  + +LSR+C+L+++++ S    + A+ Q+ G+++I+LP   +     +      +E E+L  +  +P+YFA     + +IY   Q    S  S SAA+ L+ +  +NG+Q+ TS  Q+Q  + D+ IT++ G+L G G E+ LPT++IVAHYD+ G+AP L+ G DSNGSG+ ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L         + S ++VHK+INL +D L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G     P+  E  V EE I + +  LT  PR+ QLL      + + E  + RYL  +VR   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y  V++F  + + V ++
Sbjct:   16 SCLPLGFIVFLPAVLLLVAPPLPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTVDADVLSRRCVLMRLLDFSYEHYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETVVPVYFAVEDEALLSIYEQTQAASASQGSASAAEVLLHTATANGFQMVTSGAQSQA-VSDWLITSVEGRLTGLGGED-LPTIVIVAHYDAFGVAPWLSLGADSNGSGISVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDSLDHTD-----SSLLQDNVAFVLCLDTVG--RGSHLRLHVSKPPREGTLQHAFLRELETVAAHQFPDVSFSMVHKKINLADDVLAWEHERFAIRRLPAFTLSHLESHRAGPRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMVQEEQIDSVMDWLTNQPRAAQLLDKDGTFLSTLEHFLSRYL-KDVRQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLALCIGAYLGMAYTAVQHFHVLYKTVQRL 555          
BLAST of Nicalin vs. Ensembl Mouse
Match: Ncln (nicalin [Source:MGI Symbol;Acc:MGI:1926081])

HSP 1 Score: 352.829 bits (904), Expect = 3.492e-112
Identity = 213/551 (38.66%), Postives = 334/551 (60.62%), Query Frame = 2
Query:  239 SVIPYYFVLIVP--LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKI 1852
            S +P  F++ +P  LL+   P+    AA +FT +R+ QYD+QG   G+R++  N EA+T  + +LSR+C+L+++++ S    + A+ Q+ G+++I+LP   +     +      +E E+L  +  +P+YFA     + +IY   Q    S  S SAA+ L+ +  +NG+Q+ TS  Q+Q  + D+ IT++ G+L G G E+ LPT++IVAHYD+ G+AP L+ G DSNGSG+ ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L         + S ++VHK+INL +D L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P      E+  V EE I + +  LT  PR+ QLL      + + E  + RYL  +VR   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y  V++F  + + V ++
Sbjct:   16 SCLPLGFIVFLPAVLLLVAPPLPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTVDADVLSRRCVLMRLLDFSYEHYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETVVPVYFAVEDEALLSIYEQTQAASASQGSASAAEVLLHTATANGFQMVTSGAQSQA-VSDWLITSVEGRLTGLGGED-LPTIVIVAHYDAFGVAPWLSLGADSNGSGISVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDSLDHTD-----SSLLQDNVAFVLCLDTVG--RGSHLRLHVSKPPREGTLQHAFLRELETVAAHQFPDVSFSMVHKKINLADDVLAWEHERFAIRRLPAFTLSHLESHRAGPRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMQVQEEQIDSVMDWLTNQPRAAQLLDKDGTFLSTLEHFLSRYL-KDVRQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLALCIGAYLGMAYTAVQHFHVLYKTVQRL 556          
BLAST of Nicalin vs. Ensembl Mouse
Match: Ncln (nicalin [Source:MGI Symbol;Acc:MGI:1926081])

HSP 1 Score: 60.4622 bits (145), Expect = 2.847e-11
Identity = 29/61 (47.54%), Postives = 42/61 (68.85%), Query Frame = 2
Query: 1667 IRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLK 1849
            ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y  V+   ++ R++LK
Sbjct:    3 VKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLALCIGAYLGMAYTAVQ---TVQRLLLK 60          
BLAST of Nicalin vs. UniProt/SwissProt
Match: sp|Q6NZ07|NCLN_DANRE (Nicalin-1 OS=Danio rerio OX=7955 GN=ncl1 PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 3.647e-117
Identity = 224/575 (38.96%), Postives = 350/575 (60.87%), Query Frame = 2
Query:  209 VFEDLTECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNSSLN--VVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD-DSISVEL----------------LARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            +FE+  E L +++   F L + L + +      +AA +F+ +R+ QYD+QG   GSR++  N EA+T  +++LSR+C+++++ + S    + A+ Q+ G+++I+LP   ST    + +    LE ELL  +  +P+YFA    E+ +IY+  Q    S  S+SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ IT++ G+L G+G E+ LPT+++VAHYDS G+AP L++G DSNGSGV ++++L R+FSRLY+ +R+ A YNL F LSGGGK N+ GTK+WLE+  +  D S     +  D +   +CL+ LG    D + +HVSKPPKEGS  +  +K L   V   +  L   +VHK+INL +D L WEHERF +R++PA T+S  E  R   R SI+D  S+S  L                L+RNT+ +A+TL R++Y L E G         E+  V E+ + + +  LT  PR+ QLL     +I + E  + RYL  +V+   +RAD RDPEFV Y   + T+ A+RVKPA+FD L+A  I +YLG++YL ++NF  +   + +++
Sbjct:    1 MFEEAGEVLENMLKVSFPLSLVLFLVLVCPLRAEAAHEFSVYRMQQYDLQGQTYGSRNAILNTEARTVEAEVLSRRCVMMRLADFSYEKYQKALRQSAGAVVIILPHNMSTLPQDIVQQFMELEPELLATETIVPVYFALEDEELLSIYTQTQISSSSQGSSSAAEVLLHTATANGFQMVTSGAQS-KAVSDWAITSLEGRLTGSGGED-LPTIVLVAHYDSFGVAPWLSYGADSNGSGVAILLELARLFSRLYSYKRTHAGYNLLFFLSGGGKFNYQGTKRWLEDNLDHTDAS-----LLQDNVAFVLCLDTLG--NSDNLHLHVSKPPKEGSPQYTLLKELETVVAHQHPDLKFAMVHKKINLADDTLAWEHERFGIRRLPAFTLSHLESHRSPARHSIMDMRSVSPSLEGAGEATTGPHVDLGKLSRNTKVIAETLARVIYNLTEKGVTGDLEIFTEQMQVQEDQLASLVDWLTAQPRAAQLLDKDSSIINTLEHQLSRYL-KDVKRHLVRADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLAVCIASYLGVLYLAIQNFGLLYGFLRRVT 565          
BLAST of Nicalin vs. UniProt/SwissProt
Match: sp|Q8VCM8|NCLN_MOUSE (Nicalin OS=Mus musculus OX=10090 GN=Ncln PE=1 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 2.443e-111
Identity = 213/551 (38.66%), Postives = 334/551 (60.62%), Query Frame = 2
Query:  239 SVIPYYFVLIVP--LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKI 1852
            S +P  F++ +P  LL+   P+    AA +FT +R+ QYD+QG   G+R++  N EA+T  + +LSR+C+L+++++ S    + A+ Q+ G+++I+LP   +     +      +E E+L  +  +P+YFA     + +IY   Q    S  S SAA+ L+ +  +NG+Q+ TS  Q+Q  + D+ IT++ G+L G G E+ LPT++IVAHYD+ G+AP L+ G DSNGSG+ ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L         + S ++VHK+INL +D L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P      E+  V EE I + +  LT  PR+ QLL      + + E  + RYL  +VR   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y  V++F  + + V ++
Sbjct:   16 SCLPLGFIVFLPAVLLLVAPPLPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTVDADVLSRRCVLMRLLDFSYEHYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETVVPVYFAVEDEALLSIYEQTQAASASQGSASAAEVLLHTATANGFQMVTSGAQSQA-VSDWLITSVEGRLTGLGGED-LPTIVIVAHYDAFGVAPWLSLGADSNGSGISVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDSLDHTD-----SSLLQDNVAFVLCLDTVG--RGSHLRLHVSKPPREGTLQHAFLRELETVAAHQFPDVSFSMVHKKINLADDVLAWEHERFAIRRLPAFTLSHLESHRAGPRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMQVQEEQIDSVMDWLTNQPRAAQLLDKDGTFLSTLEHFLSRYL-KDVRQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLALCIGAYLGMAYTAVQHFHVLYKTVQRL 556          
BLAST of Nicalin vs. UniProt/SwissProt
Match: sp|Q5XIA1|NCLN_RAT (Nicalin OS=Rattus norvegicus OX=10116 GN=Ncln PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 9.030e-111
Identity = 212/551 (38.48%), Postives = 334/551 (60.62%), Query Frame = 2
Query:  239 SVIPYYFVLIVP--LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKI 1852
            S +P  F++ +P  LL+   P+    AA +FT +R+ QYD+QG   G+R++  N EA+T  + +LSR+C+L+++++ S    + A+ Q+ G+++I+LP   +     +      +E E+L  +  +P+YFA     + +IY   Q    S  S SAA+ L+ +  +NG+Q+ TS  Q+Q  + D+ IT++ G+L G G E+ LPT++IVAHYD+ G+AP L+ G DSNGSG+ ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L         + S ++VHK+INL +D L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P      E+  V +E I + +  LT  PR+ QLL      + + E  + RYL  +VR   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y  V++F  + + V ++
Sbjct:   16 SCLPLGFIVFLPAVLLLVAPPLPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTVDADVLSRRCVLMRLLDFSYEHYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETVVPVYFAVEDEALLSIYEQTQAASASQGSASAAEVLLHTATANGFQMVTSGAQSQA-VSDWLITSVEGRLTGLGGED-LPTIVIVAHYDAFGVAPWLSLGADSNGSGISVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDSLDHTD-----SSLLQDNVAFVLCLDTVG--RGSHLRLHVSKPPREGTLQHVFLRELEMVAAHQFPDVSFSMVHKKINLADDVLAWEHERFAIRRLPAFTLSHLENHRAGPRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMQVQQEQIDSVMDWLTNQPRAAQLLDKDGTFLSTLEHFLSRYL-KDVRQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLALCIGAYLGMAYTAVQHFHVLYKTVQRL 556          
BLAST of Nicalin vs. UniProt/SwissProt
Match: sp|Q969V3|NCLN_HUMAN (Nicalin OS=Homo sapiens OX=9606 GN=NCLN PE=1 SV=2)

HSP 1 Score: 350.517 bits (898), Expect = 1.821e-110
Identity = 211/553 (38.16%), Postives = 336/553 (60.76%), Query Frame = 2
Query:  239 SVIPYYFVLIVP--LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKISI 1858
            S +P  F++ +P  LL+   P+    AA +FT +R+ QYD+QG   G+R++  N EA+T  +++LSR+C+L+++++ S    + A+ Q+ G+++I+LP   +     +      +E E+L  + A+P+YFA     + +IY   Q    S  S SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ I ++ G+L G G E+ LPT++IVAHYD+ G+AP L+ G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G  R   + +HVSKPP+EG+  H +++ L             ++VHKRINL ED L WEHERF++R++PA T+S  E  R   R SI+D    +  + L RNTR +A+ L R++Y L E G  P      E+  + +E + + +  LT  PR+ QL+      + + E  + RYL  +V+   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y+ V++FS + + V ++ +
Sbjct:   16 SCLPLGFIVFLPAVLLLVAPPLPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVLMRLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVYFAVEDEALLSIYKQTQAASASQGSASAAEVLLRTATANGFQMVTSGVQS-KAVSDWLIASVEGRLTGLGGED-LPTIVIVAHYDAFGVAPWLSLGADSNGSGVSVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDNLDHTD-----SSLLQDNVAFVLCLDTVG--RGSSLHLHVSKPPREGTLQHAFLRELETVAAHQFPEVRFSMVHKRINLAEDVLAWEHERFAIRRLPAFTLSHLESHRDGQRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMQIQQEQLDSVMDWLTNQPRAAQLVDKDSTFLSTLEHHLSRYL-KDVKQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAVFDLLLAVGIAAYLGMAYVAVQHFSLLYKTVQRLLV 558          
BLAST of Nicalin vs. UniProt/SwissProt
Match: sp|Q5ZJH2|NCLN_CHICK (Nicalin OS=Gallus gallus OX=9031 GN=NCLN PE=2 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 3.064e-104
Identity = 209/575 (36.35%), Postives = 335/575 (58.26%), Query Frame = 2
Query:  209 VFEDLTECLRSVI-----PYYFVLIVP-LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILDDSISVELLARNTRAVADTLMRLLYGLEDGYGPIIEEHWVMEEAIKADL---------------SLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKISI 1858
            + E+  E L SV+     P  F+L VP +L+ + P    +AA + T +R+ QY++ G   G+RS+  N EA+T  + +LSR+C+++++++ S    + A+ Q+ G+++I+LP   S+    + +    +E E+L  +  +P+YFA    E+ +IY   +    S  S SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ I ++ G+L G G E+ LPTV+IVAHYDS G+AP L+ G DSNGSGV ++++L R+FSRLY  +R+ A YNL F  SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ LG  R + + +HVSKPPKEG+  H +++ L   V         ++VHK+INL ED L WEHERF++R++PA T+S  E  R + R SI+D    V     +T+A+         G ++G+   ++ +        ADL                L  +  ++ QL+      + + E  M RYL  +V+   ++AD RDPEFV Y   +  + A+RVKPA+FD L+A  I AYLG+ Y+ V+NF  + R++ ++S+
Sbjct:    1 MLEEAGEVLESVLKASCLPLSFLLFVPAVLLLLGPPPAAEAAHESTVYRMQQYELGGQPYGTRSAVLNTEARTVEADVLSRRCVMMRLVDFSYEQYQKALRQSAGAVVIILPRSISSVPQDVVKQFMEIEPEMLAMETIVPVYFAVEDDELLSIYEQTRAASASQGSASAAEVLLHTATANGFQMVTSGAQS-KAIHDWLIPSVEGRLTGLGGED-LPTVVIVAHYDSFGVAPWLSHGADSNGSGVSVLLELARLFSRLYTYRRTHAGYNLLFFASGGGKFNYQGTKRWLEDNLDHTD-----SSLLQDNVAFVLCLDTLG--RGNSLHLHVSKPPKEGTLQHAFLRELEMVVASQFPEVKFSMVHKKINLAEDILAWEHERFAIRRLPAFTISHLESHRDSLRNSIMDRRSQV-----DTKALTQEYQDHCGGFDEGH---LQPNREGSTCRSADLHGSDADPGGAARISDGLAEQSAQAAQLIDKDSTFLSTLEYYMGRYL-KDVKQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLAVCIAAYLGVAYVAVQNFGLLYRMIQRLSL 557          
BLAST of Nicalin vs. TrEMBL
Match: K1R1W9 (Nicalin-1 OS=Crassostrea gigas OX=29159 GN=CGI_10018119 PE=4 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.166e-131
Identity = 228/559 (40.79%), Postives = 347/559 (62.08%), Query Frame = 2
Query:  233 LRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNS-----SLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGLED---------GYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
             ++  P+ F+  +P+LI +SP+ PV AA +F A R+ QYD+ G   G RSS  N+EA+   +K+++R+C++ ++ EVS +  +  I +N G++++LLP   ++     K+H+  LE++LL ++  IP+YFA  T E+ +IY  + +     ++++A +AL+S   +NG+Q+  +  Q  K L DFQITNI G L+G GIEEQLPTV +VAHYDS G+APSL+ G D+NGSGV+ +++L R+FS+LY   R+ AK+NL FLLSGGGK N+ GTK+W+E+     +  S  S + +D +   +CL+  G+ + D + +HVSKPPKE S GH +++ L     +L S        +VHK+INL +D L WEHERFS++++PA T+S     +  +R +ILD  +S+ V  L+RN   VA+ L R +Y +           G G       V ++ ++A L  LT  PR+ QLL   H L  + E  M RYL  +V+ T  +AD RDPEF  Y  A  T+ A+ VKPA+FD  +A  I+ YL +VYL V+NF  +   + K+S
Sbjct:    2 FKNSFPFSFLFFIPILIILSPVSPVSAAHEFAALRMQQYDLHGVSYGCRSSPVNMEARPVDAKMITRRCIVARLQEVSISKYRDLIQENAGALLVLLPSDLTSISKEDKQHLQILERDLLAEETTIPVYFALETEELSSIYEEIHRGNAGDQASTAIEALMSGATANGFQMVVAGSQA-KSLADFQITNIQGHLSGYGIEEQLPTVAVVAHYDSFGIAPSLSTGADANGSGVIALLELARLFSKLYTNSRTHAKFNLVFLLSGGGKFNYQGTKRWIED-----NLDSQDSNLLSD-VAYVLCLD--GIGKSDEMYLHVSKPPKEDSPGHHFLQNLQ---NVLKSFYPGVKFEMVHKKINLADDFLAWEHERFSIKRLPAFTLSHFNSHKDPDRSTILDQRESVDVGKLSRNIEIVAEALARYVYNVSSHGNLQLFSGGLG-------VQQDLVEAWLGQLTSQPRATQLLPKDHSLHSNLEEAMSRYL-KDVKRTTFKADKRDPEFQFYDGATYTMSAYNVKPAIFDLFLAVAIVGYLAVVYLAVQNFHFLYSAMQKLS 540          
BLAST of Nicalin vs. TrEMBL
Match: A0A0L8H611 (Nicalin OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021519mg PE=3 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 2.891e-129
Identity = 229/562 (40.75%), Postives = 361/562 (64.23%), Query Frame = 2
Query:  227 ECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLP-LKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT---LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL--EDGYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKISITHDKNKEKH 1885
            E  R+  P  F+  VPLLI +SP+ P +AA +F  +R+HQYD+ G   G RSS  N+EA++  +K+L+R+C+++++ E++  S +  +SQNVG++++LLP   +      KE +  LE+ELL+++  +P++FA+ +  + NIY +V+ L    ++ SA +AL+S+  +NG+Q+  S  Q  K L DFQITNI G+LAG GIEEQLP+V+IVAHYDSMG+AP L+ G DSNGSGVV +++L R+FS+LY   R+ AKYNL FLL+GGGK N+ GTK+W+E+  E  D +  +       +   +CL+ +G    + +++HVSKPP+E S+G  ++K L   +T     +    ++HK+INL ED L WEHERFS++++PA ++S  +  + T R ++LD    +   +L+RN + +A+ L R +Y L  +  +    +   V E+ I A L  LT  PR+  L+   H +I + E  + RYL  +VR++ ++AD RDPEF+ Y  A  ++ A+ VKPA+FD  +A  I AYL +VYL V+NF  + +  L++S+   +  + H
Sbjct:   10 EMFRNNFPMTFICFVPLLILMSPVIPARAAHEFAVYRMHQYDLHGTAYGCRSSFVNMEARSVDAKMLTRRCIIVRLRELTVVSYRKLVSQNVGAVLVLLPDYFTNITVEEKERLYGLERELLLEETNVPVFFAYESEALTNIYIDVKHLSTGDQAPSALEALLSAASANGFQMVVSGAQA-KALPDFQITNIQGRLAGYGIEEQLPSVIIVAHYDSMGIAPGLSEGADSNGSGVVTLLELARLFSKLYTNSRTHAKYNLVFLLTGGGKFNYQGTKRWIEDSLESTDNNQLTD------VAYVLCLDTIG--NGNTLNLHVSKPPREDSAGGIFLKNLE-EITKKFFPDVQFKMIHKKINLAEDTLAWEHERFSIKRLPAFSLSRLDTHKTTERATVLDVRSRVDTSVLSRNIQIIAEALARHIYNLTNQGQFRLFTDGLEVQEDLITAWLDCLTSQPRATPLIPKDHSIITNLEETLSRYL-KDVRVSGMKADKRDPEFLFYDGAVYSMNAYNVKPAIFDLFLAVGIGAYLAVVYLIVQNF-HLLKGFLQMSVQMSEKLKSH 559          
BLAST of Nicalin vs. TrEMBL
Match: A0A401NQ32 (Nicalin OS=Scyliorhinus torazame OX=75743 GN=scyTo_0000096 PE=3 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 3.444e-126
Identity = 223/565 (39.47%), Postives = 349/565 (61.77%), Query Frame = 2
Query:  209 VFEDLTECL----RSVIPYYFVLIVP-LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNS-SLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGLEDGYGP-----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKISI 1858
            +FE+ +E      +   P  F++ +P +LI +SP+ P++AA +FT +R+ QYD+QG   G+R++  N EA+T  + +LSR+C+++++ E S    + AI Q+ G+++I+LP   ST    + +    +E ELL  +  +P+YFA    E+ +I+        S  + SAA+ L+ +  +NG+Q+ TS  Q+ KP+ D+ IT++ GKL G G E+ LPT++IVAHYDS G+AP LA+G DSNGSGV  +++L R+FS+LY  +R+ A YN+ F +SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ LG    DG+ +HVSKPPKE +  H ++K L    +       ++VHK+INL ED L WEHERF +R++PA TVS  E  + + R S++D    I+++ L+RNT+ +A+ L R++Y L +   P       E+  + E+ + + L  LT  PR+ QL+     LI + E  M RYL  +V+   ++AD RDPEF+ Y     T+ A+RVKPA+FD L+A  I AYLG+ Y   +NF  I   V +I++
Sbjct:    1 MFEEASEVFDNMFKGSFPLTFIVFIPAVLILVSPL-PIEAAHEFTVYRMQQYDLQGQAYGTRNAMLNTEARTIEADVLSRRCVIMRLAEFSFEKFQEAIRQSAGAVVIILPQNMSTMPQDVIQQFMEIEPELLATETIVPVYFALEDHELLSIHEQTNSASVSQGTASAAEVLLHTATANGFQMVTSGAQS-KPISDWSITSLEGKLTGLGGED-LPTIVIVAHYDSFGVAPWLAYGADSNGSGVAALLELARLFSKLYTYKRTHAGYNILFFVSGGGKFNYQGTKRWLEDHLDHTD-----SSLLQDNVAFVLCLDTLGSG--DGLYLHVSKPPKEATPQHTFLKELETVTSRFPEVKFSMVHKKINLAEDMLAWEHERFGIRRLPAFTVSRLESHKNSLRTSVMDMRSQINIQQLSRNTKVIAEALARVIYNLTEKGAPEDLQIFTEQMQLQEDQLSSVLDWLTAQPRAAQLIDKDSILISTMEYYMNRYL-KDVKRHHVKADKRDPEFLFYDQLRQTMNAYRVKPAIFDLLLALCIAAYLGVTYFVAQNFGFIYNTVRRITL 554          
BLAST of Nicalin vs. TrEMBL
Match: A0A210QKS9 (Nicalin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14699 PE=3 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 5.576e-126
Identity = 220/519 (42.39%), Postives = 336/519 (64.74%), Query Frame = 2
Query:  290 SPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLL--NSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVS-AERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL--EDGYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENF 1822
            SP+ PV AA +F A+R+ QYDI G   G +S+  N+EA+   +K+++R+C+++++ E+S +  +  I +N G+++ILLP   ++ +   K+++  LE+E+L ++ +IP+YF+  T ++  I+S++Q      ++T+A  AL+ +  +NG+Q+  +  Q+ K L DFQITN+ G L+G GIEEQLP ++IVAHYDS G+APSLA G DSNGSGV+ +++L R+F++L+   R+ AKYNL FLLSGGGK N+ GTK+W+E+     +  S  S + TD +   +CL+ LG +  D + +HVSKPPKEG+ GH ++K L   +      +S  +VHK+INL +D L WEHERFS++++PA TVS  E  R + + +ILD  D++ +  L++N R VA++L R LY L  +       E   V E  + A L  LT  PR+ QLL     L+ + E  M RYL  +VR T ++AD RDPEF+ Y  A   + A+ VKPA+FD  +A  I+ YL +VY  V NF
Sbjct:   32 SPVSPVNAAHEFAAYRMQQYDIHGQHYGCKSALVNMEARPIDAKMITRRCIIVRLQEISISRYRNLIQENAGALMILLPQNLTSINEQEKKNLEVLEREILSEETSIPVYFSPETDDLLQIHSDLQSGSSGDQATTAVDALLGAATANGFQIVVNGAQS-KSLPDFQITNLQGHLSGFGIEEQLPAIVIVAHYDSFGVAPSLAQGADSNGSGVIALLELSRLFAKLFTNSRTHAKYNLIFLLSGGGKFNYQGTKRWIED-----NIDSPDSNLLTD-VSYVLCLDSLGDS--DQLFLHVSKPPKEGTPGHTFLKNLEEVIKTFFPATSFKMVHKKINLADDMLSWEHERFSVKRLPAFTVSHVESHRSSEKTTILDTRDTVDIHKLSQNIRVVAESLARHLYNLTSQPNLRLFTEALDVQESLVSAWLDQLTAQPRAMQLLAKDSSLLNTLEETMNRYL-KDVRRTTMKADKRDPEFMFYDGATYQMSAYNVKPAIFDLFLALGIVGYLAVVYFAVLNF 540          
BLAST of Nicalin vs. TrEMBL
Match: A0A3B3ZSQ8 (Nicalin OS=Periophthalmus magnuspinnatus OX=409849 PE=3 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 3.324e-125
Identity = 225/565 (39.82%), Postives = 353/565 (62.48%), Query Frame = 2
Query:  209 VFEDLTECL----RSVIPYYFVLIVP-LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGLEDGYGP-----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            +FE+ +E      +S  P  F++ +P +LI +SP+ P +AA +FT +R+ QYD+QG   G+R++  N EA+T  +++LSR+C+++++ + S    + A+ Q+ G+++I+LP   S     + +    LE E+L  +  IP+YFA    E+ +IY+       S  S SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ IT++ G+LAG G E+ LPT+++VAHYDS G+AP L++G DSNGSGV ++++L R+FS+LY  +R+ A YNL F LSGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ LG    D + +HVSKPPKEG+S ++ +K L   V+        ++VHK+INL +D L WEHERF +R++PA T+S     R   R SI+D    + V+ L RNT+ VA+ L R++Y L +   P       E+  V EE + A +  LT  PR+ QL+     ++ + E  + RYL  +V+   ++AD RDPEFV Y   + T+ A+RVKPA+FD L+A  I AYLG++YL ++NF  +  +V KI+
Sbjct:    1 MFEEASEVFDNMFKSSFPLTFIVFIPAVLILVSPL-PAEAAHEFTVYRMQQYDLQGQPYGTRNAILNTEARTVEAEVLSRRCVIMRLADFSYEKYQKALRQSAGAVVIILPKNMSALPQDIVQQFMELEPEMLATETIIPVYFAMEDDELLSIYTQTLTSSTSQGSLSAAEVLLHTATANGFQMVTSGAQS-KAVSDWAITSLEGRLAGVGGED-LPTIVVVAHYDSFGVAPWLSYGADSNGSGVSVLLELARLFSKLYTYKRTHAGYNLLFFLSGGGKFNYQGTKRWLEDNLDHTD-----SSLLQDNVAFVLCLDTLG--NGDSLHLHVSKPPKEGTSQYQLLKELEMVVSSQYPEVKFSMVHKKINLADDMLAWEHERFGIRRLPAFTLSHLPSHRLAQRSSIMDVRPHVDVKKLGRNTKIVAEALARVIYNLTEKGAPGDLQIFTEQMQVQEEQLSAVVEWLTAQPRAAQLVDKDSSVVSTLEYHLTRYL-KDVKKHYVKADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLAVCIAAYLGVMYLAIQNFGVLYSVVRKIT 554          
BLAST of Nicalin vs. Ensembl Cavefish
Match: ncln (nicalin [Source:NCBI gene;Acc:103037483])

HSP 1 Score: 376.326 bits (965), Expect = 3.185e-121
Identity = 232/582 (39.86%), Postives = 349/582 (59.97%), Query Frame = 2
Query:  209 VFEDLTECL----RSVIPYYFVLIVPL---LIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD-----------------DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            +FE+ +E      +S  P     IV L   LI +SP+ P  AA +FT +R+ QYD+QG   GSR++  N EA+T  +++LSR+C+++++ + S    + A+ Q+ G+++I+LP   ST    + +    LE ELL  +  +P+YFA    E+ +IYS  Q    S  S+SAA+ L+ S  +NG+Q+ TS  Q+ K + D+ IT++ G+L G G E+ LPT+++VAHYDS G+AP L++G DSNGSGV M+++L R+FSRLY+ +R+ A YNL F LSGGGK N+ GTK+WLE+     +     S++  D +   +CL+ LG    D + +HVSKPPKEGS  H  +K L             ++VHK+INL +D L WEHERF +R++PA T+S  E  R   R SI+D                   + ++ L+RNT+ +A+ L R++Y L E G         E+  V EE + + +  LT  PR+ QL+     ++ + E  + RYL  +V+   +RAD RDPEFV Y   + T+ A+RVKPA+FD L+A  I AYLGLVYL V+NF  +  I+ +++
Sbjct:    1 MFEEASEVFDNMFKSSFPLTLTFIVFLPAVLILVSPL-PADAAHEFTVYRMQQYDLQGQNYGSRNAILNTEARTMEAEVLSRRCVMMRLADFSYEKYQKALRQSAGAVVIILPKNMSTMPQDIVQQFMELEPELLATETIVPVYFALEDDELLSIYSQTQASSSSQGSSSAAEVLLHSATANGFQMVTSGAQS-KAVSDWAITSLEGRLGGVGGED-LPTIVVVAHYDSFGVAPWLSYGADSNGSGVAMLLELARLFSRLYSHKRTHAGYNLLFFLSGGGKFNYQGTKRWLED-----NLDHTESSLLQDNVAFVLCLDTLG--NGDNLYLHVSKPPKEGSPQHTLLKELQTVAADQYPEVKFSMVHKKINLADDTLAWEHERFGIRRLPAFTLSHLESHRSATRNSIMDMRSVSSSLDGAGEATAGPHVDLKKLSRNTKLIAEALARVIYNLTEKGTNGDLEIFTEQMQVQEEQLASLVDWLTTQPRAAQLVDKDSAVVSTLEYYLGRYL-KDVKRHFVRADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLALCIAAYLGLVYLAVQNFGFLYGILRRVT 571          
BLAST of Nicalin vs. Ensembl Cavefish
Match: ncln (nicalin [Source:NCBI gene;Acc:103037483])

HSP 1 Score: 376.326 bits (965), Expect = 3.185e-121
Identity = 232/582 (39.86%), Postives = 349/582 (59.97%), Query Frame = 2
Query:  209 VFEDLTECL----RSVIPYYFVLIVPL---LIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD-----------------DSISVELLARNTRAVADTLMRLLYGL-EDGYGP----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            +FE+ +E      +S  P     IV L   LI +SP+ P  AA +FT +R+ QYD+QG   GSR++  N EA+T  +++LSR+C+++++ + S    + A+ Q+ G+++I+LP   ST    + +    LE ELL  +  +P+YFA    E+ +IYS  Q    S  S+SAA+ L+ S  +NG+Q+ TS  Q+ K + D+ IT++ G+L G G E+ LPT+++VAHYDS G+AP L++G DSNGSGV M+++L R+FSRLY+ +R+ A YNL F LSGGGK N+ GTK+WLE+     +     S++  D +   +CL+ LG    D + +HVSKPPKEGS  H  +K L             ++VHK+INL +D L WEHERF +R++PA T+S  E  R   R SI+D                   + ++ L+RNT+ +A+ L R++Y L E G         E+  V EE + + +  LT  PR+ QL+     ++ + E  + RYL  +V+   +RAD RDPEFV Y   + T+ A+RVKPA+FD L+A  I AYLGLVYL V+NF  +  I+ +++
Sbjct:    1 MFEEASEVFDNMFKSSFPLTLTFIVFLPAVLILVSPL-PADAAHEFTVYRMQQYDLQGQNYGSRNAILNTEARTMEAEVLSRRCVMMRLADFSYEKYQKALRQSAGAVVIILPKNMSTMPQDIVQQFMELEPELLATETIVPVYFALEDDELLSIYSQTQASSSSQGSSSAAEVLLHSATANGFQMVTSGAQS-KAVSDWAITSLEGRLGGVGGED-LPTIVVVAHYDSFGVAPWLSYGADSNGSGVAMLLELARLFSRLYSHKRTHAGYNLLFFLSGGGKFNYQGTKRWLED-----NLDHTESSLLQDNVAFVLCLDTLG--NGDNLYLHVSKPPKEGSPQHTLLKELQTVAADQYPEVKFSMVHKKINLADDTLAWEHERFGIRRLPAFTLSHLESHRSATRNSIMDMRSVSSSLDGAGEATAGPHVDLKKLSRNTKLIAEALARVIYNLTEKGTNGDLEIFTEQMQVQEEQLASLVDWLTTQPRAAQLVDKDSAVVSTLEYYLGRYL-KDVKRHFVRADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLALCIAAYLGLVYLAVQNFGFLYGILRRVT 571          
BLAST of Nicalin vs. Ensembl Cavefish
Match: zgc:109965 (nicalin-1-like [Source:NCBI gene;Acc:103024115])

HSP 1 Score: 287.73 bits (735), Expect = 1.342e-87
Identity = 185/530 (34.91%), Postives = 289/530 (54.53%), Query Frame = 2
Query:  302 PVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLP------LKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSAERD-RFTNRKSILDDSISVEL--LARNTRAVADTLMRLLYGLEDGYGPIIEEHW-----VMEEAIKADLSLLTRFPRSQQLLGPKHP----LILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSI 1831
            P  ++ +FTA+R+ QY++   K G R +    EA+ +   +L+R+C+++K+ + +      A  QN  +I+ILLP       +      M+     L+KE LM     PIY      ++  +YS V+    +  ++   + L S + +  +Q+  S+    KP+ +  I  + G L G G  E  PT+ I AHYDS G+AP LA+G DSNGSGV ++++L R+F RLY+  R++A Y+L F L+GGGK NF+GTK+WLEE     +   A S++  D +   +CL+ LG    D + +HVS+PPK G+  + +I+ L   ++          VHK+INL E  + WEHER+ +R +P  TVS   D R   R SILD    V++  + RN   +A++L R +Y L D   P   + +     V++  + A +++LT  PR+ QL+  K P    LI S E+  RRYL    R T  R D +DP+   +   +  +I +RVKPA FD  +   I  YLG+VY  ++NF  +
Sbjct:   30 PAASSYEFTAYRMQQYNLHQDKRGCRGAIVVAEARAADDSILTRRCVIMKLPDFTVERYLEARRQNAAAILILLPHNISGVPEEVIQGFMESESEALKKETLM-----PIYVVPEDEQLLCMYSEVKLAAATKSASILVRVLRSMVTATAFQILVSNNAPIKPITNNSIITLEGVLPGVG--EDPPTIAITAHYDSFGLAPWLAYGADSNGSGVAILLELARLFQRLYSDPRNKAPYHLLFSLTGGGKYNFLGTKRWLEE-----NMDHAESSLLHDSVAFVICLDSLGSG--DELFLHVSRPPKPGTPQYGFIQQLEEVISSRFPWVRFGTVHKKINLQESTVAWEHERYGMRHIPGFTVSHLEDPRSERRGSILDTGAQVDIRKIKRNAVIIAESLARYMYNLSDKGSPKEIQVFRGSLDVVDSRLSALMAMLTSVPRATQLMD-KEPQQMLLINSLEQEFRRYLQQVYRHT-FRTDRKDPDITFFDQMKQPMIMYRVKPAAFDLFLGGCIAGYLGIVYYAIQNFGKL 543          
BLAST of Nicalin vs. Ensembl Nematostella
Match: EDO34607 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNU3])

HSP 1 Score: 343.969 bits (881), Expect = 2.261e-109
Identity = 208/549 (37.89%), Postives = 317/549 (57.74%), Query Frame = 2
Query:  218 DLTECLRSV-IPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNSSLN--VVHKRINLNEDELQWEHERFSL--RKMPALTVSAERD-RFTNRKSILD--DSISVELLARNTRAVADTLMRLLYGL-EDGYGPIIEEHW----VMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENF 1822
            D  E  +S  +    + ++P ++   P+ PV+ A +F  FR+ Q+D+     GSRS+  N+EA+      L+R+C++ ++ E+S   +   I Q  G ++ILLP   S  +    E    LEKELL     + +YFA+    + ++Y +++  + S ++ SA +AL+    ++GYQL +S+ ++ K  +D  IT+I GKLAG G++E LPT+ IVAHYD+ G+APS+A G DSNGSGVV +++L R+FSRLYA   + AK +L FLLSGGGK N+ GTKKWLE      DG         + +   +CL+   +A+ D + +H SKPPKEG+     ++   +    +   LN   VHK+INL +D L WEHERFS+  +++PA T+S   D   T R SI D         L  N + +A+TL R ++ L   GY   +E       V  E IK  +  L   PR+ QL+   HP++   E ++ +++  +V+   ++AD RDPEFV Y   E  + A+RVKPA+FD  +A  I AYLG+ YL ++NF
Sbjct:    7 DFLELFKSFPVSVSILCVLPFVLLSGPVSPVRGAYEFPVFRMQQFDLHHPA-GSRSALVNMEARPISGSALTRRCVVSRLSELSIDRVHEVIEQGAGGLLILLPRDLSKLNQQEVEEWQTLEKELLFQSVPVAVYFAYEDDYLLDVYKHIKVAINSDQAKSAFEALLGVTSASGYQLVSSASES-KARKDTTITSIQGKLAGMGVDENLPTIAIVAHYDTFGIAPSIANGSDSNGSGVVALLELARLFSRLYADPHTHAKSHLVFLLSGGGKFNYQGTKKWLE------DGLDNPEQSVLNDVDFVLCLD--SIAKGDTLFLHYSKPPKEGTKAFDLVEEFKHVSEAMFPQLNFSTVHKKINLADDTLSWEHERFSVHTQRLPAGTLSHYEDPTATGRGSIFDVRSPAHDSKLETNIKFIAETLARHIFNLTHKGYPRNLEVFQAGLEVDSEFIKTWMDYLGSQPRAAQLIQKDHPMLAGLETVLTKFV-KDVKKITMKADKRDPEFVFYDQFEAKMSAYRVKPAIFDLFLAFGIAAYLGIFYLVMQNF 544          
BLAST of Nicalin vs. Ensembl Medaka
Match: ncln (nicalin [Source:NCBI gene;Acc:101166710])

HSP 1 Score: 373.629 bits (958), Expect = 3.432e-120
Identity = 220/580 (37.93%), Postives = 348/580 (60.00%), Query Frame = 2
Query:  209 VFEDLTECL----RSVIPYYFVLIVP-LLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK-STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVT--LLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSA-ERDRFTNRKSILD-----------------DSISVELLARNTRAVADTLMRLLYGLEDGYGP-----IIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKIS 1855
            +FE+ +E      +S  P  F++ +P +LI +SP+ P +AA +FT +R+ QYD+QG   G+R+S  N EA+T  + +LSR+C+L+++ + S    + A+ Q+ G+++I+LP   S     + +    LE ++L  +  +P+YFA    E+ +IY+       S  S SAA+ L+ +  +NG+Q+ TS  Q+ K + D+ IT++ G+L G G E+ LPT+++VAHYDS G+AP L++G DSNGSGV M+++L R+FS+LY  +R+ A YNL F +SGGGK N+ GTK+WLE+  +  D     S++  D +   +CL+ +G    D + +HVSKPPKEG+     +K L   ++        ++VHK+INL +D L WEHERF +R++PA T+S     R   R SI+D                   + V+ L RNT+ VA+ L R++Y L +   P       E+  V EE + A +  LT  PR+ QL+     ++ + E  + R+L  +V+   ++AD RDPEFV Y   + T+ A+RVKPA+FD L+A  I AYLGL+YL ++NF  +  IV +++
Sbjct:    1 MFEEASEVFDNMFKSSFPLTFIVFIPAVLILVSPL-PAEAAHEFTVYRMQQYDLQGQPYGTRNSILNTEARTMEADVLSRRCVLMRLADFSFDKYQKALRQSAGAVVIMLPKNMSAMPQDVLQQFMELEPDMLTTETIVPVYFAIEDDELLSIYTQTLTSSSSQGSLSAAEVLLHTATANGFQMVTSGAQS-KAISDWAITSLEGRLTGVGGED-LPTIVLVAHYDSFGVAPWLSYGADSNGSGVSMLLELARLFSKLYTYKRTHAAYNLLFFVSGGGKFNYQGTKRWLEDNLDHTD-----SSLLQDNVAFVMCLDTVG--NGDSLHLHVSKPPKEGTPQSSLLKELEMVISSQYPEVKFSMVHKKINLADDMLAWEHERFGIRRLPAFTLSHLPSHRSVQRSSIMDVRSVSFSRHGAGEPPSGPHVDVKRLCRNTKVVAEALARVIYNLTEKGAPGDLQIFTEQMQVQEEQLAAVVEWLTAQPRAAQLVDKDSSVVSTLEYHLGRHL-KDVKRHYVKADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLAVCIAAYLGLMYLAIQNFGVLYGIVRRLT 569          
BLAST of Nicalin vs. Ensembl Medaka
Match: zgc:109965 (nicalin-1-like [Source:NCBI gene;Acc:101170423])

HSP 1 Score: 249.98 bits (637), Expect = 9.632e-74
Identity = 176/497 (35.41%), Postives = 268/497 (53.92%), Query Frame = 2
Query:  302 PVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLK------STWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNSSLNV--VHKRINLNEDELQWEHERFSLRKMPALTVSAERD-RFTNRKSILDDSISVEL--LARNTRAVADTLMRLLYGLEDGYGP----IIEEHWVMEEA-IKADLSLLTRFPRSQQLLGPKHPLIL---SFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAH 1735
            P  ++ +FTAFR+ QY++   K G R +    EA+++    L+R+C+++K+ + SA     A  QN  +++ILLP        ST    M      L+KE L     IP+Y A    ++  +Y  V+Q   +  S+   + L S + +  +Q+  S+    K + D  I  + G L G G  E  PT++I A+YDS G+AP L+FG DSNGS V ++++L R+F +LY++  S   YNL F L+GGGK NF+GTK+W+EE     +   A S++  D +   VCL+ LG  + D + VHVS+PPK  +  H +I+ L   V+   S + V  VHK+INL E  + WEHER+SLR++P  T+S   D +   R SILD    V+   L RN   +A+TL R +Y L D   P    + +     +++ + + +S LT  PR+ QLL  +   IL   S E   +RYL    R T  R D RDP+   +      I+ +
Sbjct:   23 PAVSSYEFTAFRMQQYNLGQQKHGCRGAIVVAEARSADEPSLTRRCIIMKVEDFSAEKYLEAQGQNAAAVLILLPKNISSVPHSTVQTFMMSESVALQKETL-----IPVYVAPEDEQLLYMYEEVKQAAAARTSSIFVRVLRSIVTATAFQILVSNNAPIKAITDNAIVTLEGVLPGAG--EDAPTIVITAYYDSYGLAPWLSFGADSNGSSVTILLELARLFQKLYSSS-STRPYNLMFSLTGGGKYNFLGTKRWIEE-----NLDHAESSLLHDNVAFVVCLDTLG--KSDELFVHVSRPPKPDTPVHSFIQQLEEVVSSRFSWVKVGLVHKKINLVESTIAWEHERYSLRRIPGFTLSHLEDPKSALRGSILDTMSQVDFRKLKRNGLIIAETLARFMYNLTDKGSPKDVQVFKGQLDFQDSRLSSLMSFLTSVPRATQLLDKEQSQILMVNSLEHEFKRYLQQVHRHT-FRQDRRDPDVSFFDQMNQPIVMY 503          
BLAST of Nicalin vs. Planmine SMEST
Match: SMESG000032750.1 (SMESG000032750.1)

HSP 1 Score: 1124.38 bits (2907), Expect = 0.000e+0
Identity = 560/562 (99.64%), Postives = 562/562 (100.00%), Query Frame = 2
Query:  203 MTVFEDLTECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTXXXXXXXXXXXXXXIMEVSAASIKLAISQNVGSIIILLPLKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSAERDRFTNRKSILDDSISVELLARNTRAVADTLMRLLYGLEDGYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKISITHDKNKEKHT 1888
            MTVFEDLTECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTSHSKLLSRKCLLLKIMEVSAASIKLAISQNVGSIIILLPLKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWI+ALNYSVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSAERDRFTNRKSILDDSISVELLARNTRAVADTLMRLLYGLEDGYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICR+VLKISITHDKNKEKHT
Sbjct:    1 MTVFEDLTECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYDIQGAKLGSRSSAFNLEAQTSHSKLLSRKCLLLKIMEVSAASIKLAISQNVGSIIILLPLKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIYSNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIFGKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRIFSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASSTINTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIEALNYSVTLLNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSAERDRFTNRKSILDDSISVELLARNTRAVADTLMRLLYGLEDGYGPIIEEHWVMEEAIKADLSLLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVLYSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRVVLKISITHDKNKEKHT 562          
The following BLAST results are available for this feature:
BLAST of Nicalin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NCLN3.792e-11138.16nicalin [Source:HGNC Symbol;Acc:HGNC:26923][more]
NCLN3.184e-9938.28nicalin [Source:HGNC Symbol;Acc:HGNC:26923][more]
NCLN1.151e-8341.60nicalin [Source:HGNC Symbol;Acc:HGNC:26923][more]
NCLN2.158e-6343.54nicalin [Source:HGNC Symbol;Acc:HGNC:26923][more]
NCLN1.758e-5137.23nicalin [Source:HGNC Symbol;Acc:HGNC:26923][more]
back to top
BLAST of Nicalin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nra-22.562e-4027.03Nicalin [Source:UniProtKB/TrEMBL;Acc:A5JYX8][more]
nra-24.191e-4026.63Nicalin [Source:UniProtKB/TrEMBL;Acc:A5JYX8][more]
back to top
BLAST of Nicalin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG49721.405e-5830.14gene:FBgn0032217 transcript:FBtr0079988[more]
back to top
BLAST of Nicalin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ncln1.759e-11939.02nicalin [Source:NCBI gene;Acc:336844][more]
ncln4.831e-11838.96nicalin [Source:NCBI gene;Acc:336844][more]
zgc:1099651.914e-8834.48zgc:109965 [Source:ZFIN;Acc:ZDB-GENE-050913-21][more]
back to top
BLAST of Nicalin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncln9.936e-12639.22nicalin [Source:NCBI gene;Acc:595051][more]
ncln2.590e-12538.70nicalin [Source:NCBI gene;Acc:595051][more]
ncln1.352e-11038.24nicalin [Source:NCBI gene;Acc:595051][more]
ncln6.028e-10436.12nicalin [Source:NCBI gene;Acc:595051][more]
ncln8.925e-9036.54nicalin [Source:NCBI gene;Acc:595051][more]
back to top
BLAST of Nicalin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ncln8.605e-11338.73nicalin [Source:MGI Symbol;Acc:MGI:1926081][more]
Ncln3.492e-11238.66nicalin [Source:MGI Symbol;Acc:MGI:1926081][more]
Ncln2.847e-1147.54nicalin [Source:MGI Symbol;Acc:MGI:1926081][more]
back to top
BLAST of Nicalin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NZ07|NCLN_DANRE3.647e-11738.96Nicalin-1 OS=Danio rerio OX=7955 GN=ncl1 PE=2 SV=1[more]
sp|Q8VCM8|NCLN_MOUSE2.443e-11138.66Nicalin OS=Mus musculus OX=10090 GN=Ncln PE=1 SV=2[more]
sp|Q5XIA1|NCLN_RAT9.030e-11138.48Nicalin OS=Rattus norvegicus OX=10116 GN=Ncln PE=2... [more]
sp|Q969V3|NCLN_HUMAN1.821e-11038.16Nicalin OS=Homo sapiens OX=9606 GN=NCLN PE=1 SV=2[more]
sp|Q5ZJH2|NCLN_CHICK3.064e-10436.35Nicalin OS=Gallus gallus OX=9031 GN=NCLN PE=2 SV=1[more]
back to top
BLAST of Nicalin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1R1W91.166e-13140.79Nicalin-1 OS=Crassostrea gigas OX=29159 GN=CGI_100... [more]
A0A0L8H6112.891e-12940.75Nicalin OS=Octopus bimaculoides OX=37653 GN=OCBIM_... [more]
A0A401NQ323.444e-12639.47Nicalin OS=Scyliorhinus torazame OX=75743 GN=scyTo... [more]
A0A210QKS95.576e-12642.39Nicalin OS=Mizuhopecten yessoensis OX=6573 GN=KP79... [more]
A0A3B3ZSQ83.324e-12539.82Nicalin OS=Periophthalmus magnuspinnatus OX=409849... [more]
back to top
BLAST of Nicalin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ncln3.185e-12139.86nicalin [Source:NCBI gene;Acc:103037483][more]
ncln3.185e-12139.86nicalin [Source:NCBI gene;Acc:103037483][more]
zgc:1099651.342e-8734.91nicalin-1-like [Source:NCBI gene;Acc:103024115][more]
back to top
BLAST of Nicalin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nicalin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nicalin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346072.261e-10937.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nicalin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ncln3.432e-12037.93nicalin [Source:NCBI gene;Acc:101166710][more]
zgc:1099659.632e-7435.41nicalin-1-like [Source:NCBI gene;Acc:101170423][more]
back to top
BLAST of Nicalin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000032750.10.000e+099.64SMESG000032750.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005444 ID=SMED30005444|Name=Nicalin|organism=Schmidtea mediterranea sexual|type=transcript|length=2275bp
TTCGATCTAATAAATAAAAAAATGAAATATAATAATTTGTAATAAATTGA
AATTATGTAATTATTAACATTACAAATTTCCTTAACTCTAAATAAATGAG
CATACTTTTTTAATTTTCATATTTAATAATTTTCCTCAAAGATTCTATTC
GACCGATTGTTTTAATACATTTCGCTTGTGCGTCACAATCAAAAAAAGCA
ACATGACTGTATTTGAAGATTTAACAGAATGTTTGCGAAGTGTTATTCCA
TATTATTTTGTCCTAATTGTTCCATTATTAATATTTATTTCGCCAATCGA
TCCTGTAAAAGCTGCTCAACAGTTTACAGCTTTTAGACTCCACCAATATG
ATATTCAGGGAGCGAAATTAGGTAGTCGTAGCTCTGCTTTTAATTTGGAG
GCACAAACTTCACATTCAAAATTATTAAGTAGAAAATGCTTGCTTTTAAA
AATTATGGAAGTATCTGCCGCTTCAATTAAACTTGCAATTTCTCAAAATG
TTGGAAGTATAATTATATTGCTTCCTTTAAAATCGACCTGGGATGCCACA
ATGAAAGAGCATATTAGTAATTTAGAGAAGGAATTGTTGATGGATGATTT
CGCGATTCCGATATATTTTGCATTCAGCACTGCTGAAGTGGAAAATATTT
ACAGTAATGTACAACAGCTAATGGAATCCTCCAAATCGACCTCAGCAGCG
CAAGCATTGATCAGCTCGATCATGAGCAACGGATACCAGCTTTACACGTC
TTCATATCAGACACAAAAGCCGCTGCAAGATTTTCAAATTACGAATATTT
TTGGTAAATTGGCTGGCAACGGGATCGAGGAGCAATTGCCGACGGTGCTG
ATTGTCGCCCACTACGATTCGATGGGAATGGCGCCAAGCTTGGCATTCGG
ATTCGATAGCAACGGTAGCGGCGTTGTCATGATGATGCAGCTGATGAGGA
TATTCTCGCGGCTCTACGCAGCCCAGAGGAGCCAGGCCAAGTACAATTTG
GGGTTCCTGCTGTCGGGAGGGGGCAAATTGAATTTCATTGGCACCAAGAA
ATGGCTGGAGGAGATTCACGAGGTTGCAGATGGTTCCTCGGCTTCATCGA
CAATCAATACCGATAGGCTGATGCTGGCCGTCTGTCTGGAGCGGCTCGGG
GTTGCCAGGGACGACGGCATATCGGTGCACGTGTCGAAGCCGCCCAAGGA
GGGATCGAGTGGACATCGGTGGATCAAAGCACTCAATTACAGCGTGACGC
TCCTCAACAGCTCTCTCAATGTTGTCCACAAGCGCATCAACCTCAATGAG
GACGAGCTGCAATGGGAACACGAGCGATTCTCATTGCGCAAGATGCCCGC
ATTGACAGTGAGTGCCGAGCGCGACAGATTCACCAATCGCAAATCGATTC
TCGATGATTCTATCTCGGTGGAATTGCTGGCGAGGAACACGCGGGCTGTA
GCGGACACATTGATGCGGCTGCTGTATGGACTGGAGGACGGCTACGGGCC
AATCATTGAGGAGCATTGGGTGATGGAGGAGGCCATCAAGGCTGATCTGT
CGCTGTTGACGCGGTTCCCGCGCAGCCAGCAGCTGCTGGGACCAAAGCAT
CCGCTGATCCTCAGCTTTGAGCGGATCATGAGGCGCTATCTCGGCAATAA
TGTGAGGCTCACCAAGATCCGTGCCGACGCTCGCGACCCAGAATTTGTGC
TCTATTCCGATGCGGAGGTGACAATCATTGCACACAGGGTGAAGCCCGCG
CTGTTCGATTTCCTGGTGGCCTGCGTAATCATCGCATATCTGGGACTCGT
CTATTTGTTTGTTGAAAACTTCTCGTCAATTTGTCGGATCGTGCTGAAAA
TATCGATCACTCATGACAAGAACAAAGAGAAGCACACGTGAATTTTAATT
AAAATATTTCTAATAATTATTATATTATCTTCCAAATGCTCCTCGGATTG
TTCGATCGATTTTGATAGTAAATAGCTTTGTTATTTGATTGGTTGATATT
GTAAATGTGTGTGTGTGTGATCGAGATGTTTGTTGCTGTTGTGGCGCTAT
TGCGCACATGCGTAAATATCATATTGCAATTCGCCGAAATTTACTTGGCA
ATGATGACGAAATAATAACGATTTTACAGCTACCTTTGTGATATTGATCC
AATTAAATTCCCAGTCAAGTTCAAAATGTTGCCAAAATTTGCGAGCGTAC
AAATGGCTTGATAACTCATTATGGCAAGTATATTGCCATCGAATCGAAAG
AAATCGTCACCCGCTATGGAGCCAG
back to top

protein sequence of SMED30005444-orf-1

>SMED30005444-orf-1 ID=SMED30005444-orf-1|Name=SMED30005444-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MTVFEDLTECLRSVIPYYFVLIVPLLIFISPIDPVKAAQQFTAFRLHQYD
IQGAKLGSRSSAFNLEAQTSHSKLLSRKCLLLKIMEVSAASIKLAISQNV
GSIIILLPLKSTWDATMKEHISNLEKELLMDDFAIPIYFAFSTAEVENIY
SNVQQLMESSKSTSAAQALISSIMSNGYQLYTSSYQTQKPLQDFQITNIF
GKLAGNGIEEQLPTVLIVAHYDSMGMAPSLAFGFDSNGSGVVMMMQLMRI
FSRLYAAQRSQAKYNLGFLLSGGGKLNFIGTKKWLEEIHEVADGSSASST
INTDRLMLAVCLERLGVARDDGISVHVSKPPKEGSSGHRWIKALNYSVTL
LNSSLNVVHKRINLNEDELQWEHERFSLRKMPALTVSAERDRFTNRKSIL
DDSISVELLARNTRAVADTLMRLLYGLEDGYGPIIEEHWVMEEAIKADLS
LLTRFPRSQQLLGPKHPLILSFERIMRRYLGNNVRLTKIRADARDPEFVL
YSDAEVTIIAHRVKPALFDFLVACVIIAYLGLVYLFVENFSSICRIVLKI
SITHDKNKEKHT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR016574Nicalin
IPR008710Nicastrin
Vocabulary: biological process
TermDefinition
GO:0016485protein processing
GO:0009966regulation of signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 140..426
e-value: 3.7E-26
score: 94.3
NoneNo IPR availablePFAMPF05450Nicastrincoord: 214..408
e-value: 1.0E-9
score: 38.3
NoneNo IPR availableCDDcd03882M28_nicalin_likecoord: 121..427
e-value: 1.14359E-89
score: 276.17
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 165..395
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 515..537
IPR016574NicalinPANTHERPTHR31826FAMILY NOT NAMEDcoord: 13..541