Leucine rich melanocyte differentiation associated

Overview
NameLeucine rich melanocyte differentiation associated
Smed IDSMED30005425
Length (bp)1568
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine rich melanocyte differentiation associated (SMED30005425) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine rich melanocyte differentiation associated (SMED30005425) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine rich melanocyte differentiation associated (SMED30005425) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine rich melanocyte differentiation associated (SMED30005425) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005425

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005425SMESG000076354.1 PL030013A10D05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30005425 SmedASXL_074423SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30005425SMESG000076354.1 dd_Smed_v4_1865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005425SMESG000076354.1 dd_Smed_v4_1865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Human
Match: LRMDA (leucine rich melanocyte differentiation associated [Source:HGNC Symbol;Acc:HGNC:23405])

HSP 1 Score: 49.6766 bits (117), Expect = 3.709e-6
Identity = 52/140 (37.14%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  116 KVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNL 535
            K L +S N  + LE L    +L E+I DNN + +++ +P L +L+ L+LNKN+I DL+ LLD+LAE TP L+ LSLLGN   P+++ S               E  E D                  R+R  +LY+LPNL
Sbjct:   34 KRLDLSFNLLRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSL--------------EKDEEDYK----------------RYRCFVLYKLPNL 143          
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Human
Match: LRMDA (leucine rich melanocyte differentiation associated [Source:HGNC Symbol;Acc:HGNC:23405])

HSP 1 Score: 48.9062 bits (115), Expect = 5.139e-6
Identity = 51/144 (35.42%), Postives = 75/144 (52.08%), Query Frame = 2
Query:  113 EKVLLISDNQF---KDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNL 535
            EK L +S N     + LE L    +L E+I DNN + +++ +P L +L+ L+LNKN+I DL+ LLD+LAE TP L+ LSLLGN   P+++ S                                 D ++  R+R  +LY+LPNL
Sbjct:    2 EKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVS------------------------------LEKDEEDYKRYRCFVLYKLPNL 115          
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Human
Match: LRMDA (leucine rich melanocyte differentiation associated [Source:HGNC Symbol;Acc:HGNC:23405])

HSP 1 Score: 46.9802 bits (110), Expect = 8.078e-6
Identity = 48/130 (36.92%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  146 KDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNL 535
            + LE L    +L E+I DNN + +++ +P L +L+ L+LNKN+I DL+ LLD+LAE TP L+ LSLLGN   P+++ S               E  E D                  R+R  +LY+LPNL
Sbjct:    1 RSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSL--------------EKDEEDYK----------------RYRCFVLYKLPNL 100          
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Zebrafish
Match: lrmda (leucine rich melanocyte differentiation associated [Source:ZFIN;Acc:ZDB-GENE-050522-285])

HSP 1 Score: 51.2174 bits (121), Expect = 7.559e-7
Identity = 36/84 (42.86%), Postives = 57/84 (67.86%), Query Frame = 2
Query:  128 ISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYS 379
            +S NQ + L  L     L E+I DNN +  ++++P+L +L+ L+LNKN++ D++ LL++L E TP L+ LSLLGN   P+Q+ S
Sbjct:   42 LSFNQLRSLTGLKAFSQLEELIVDNNLLGNDLRLPRLPRLHTLTLNKNQLTDIEALLEHLVEVTPALEYLSLLGNEACPNQLVS 125          
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Mouse
Match: Lrmda (leucine rich melanocyte differentiation associated [Source:MGI Symbol;Acc:MGI:1923883])

HSP 1 Score: 49.6766 bits (117), Expect = 1.349e-6
Identity = 40/86 (46.51%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  116 KVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQI 373
            K L +S N  + LE L    +L E+I DNN + +++ +P L  L+ L+LNKN+I DL+ LLD+LAE TP+L+ LSLLGN   P+++
Sbjct:   34 KRLDLSFNLLRSLEGLSAFRSLEELILDNNLLGDDLVLPGLPHLHTLTLNKNQITDLEYLLDHLAEVTPSLEYLSLLGNVACPNEL 119          
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Mouse
Match: Lrmda (leucine rich melanocyte differentiation associated [Source:MGI Symbol;Acc:MGI:1923883])

HSP 1 Score: 50.0618 bits (118), Expect = 1.521e-6
Identity = 40/86 (46.51%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  116 KVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQI 373
            K L +S N  + LE L    +L E+I DNN + +++ +P L  L+ L+LNKN+I DL+ LLD+LAE TP+L+ LSLLGN   P+++
Sbjct:   34 KRLDLSFNLLRSLEGLSAFRSLEELILDNNLLGDDLVLPGLPHLHTLTLNKNQITDLEYLLDHLAEVTPSLEYLSLLGNVACPNEL 119          
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Mouse
Match: Lrmda (leucine rich melanocyte differentiation associated [Source:MGI Symbol;Acc:MGI:1923883])

HSP 1 Score: 49.6766 bits (117), Expect = 2.599e-6
Identity = 40/86 (46.51%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  116 KVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQI 373
            K L +S N  + LE L    +L E+I DNN + +++ +P L  L+ L+LNKN+I DL+ LLD+LAE TP+L+ LSLLGN   P+++
Sbjct:   34 KRLDLSFNLLRSLEGLSAFRSLEELILDNNLLGDDLVLPGLPHLHTLTLNKNQITDLEYLLDHLAEVTPSLEYLSLLGNVACPNEL 119          
BLAST of Leucine rich melanocyte differentiation associated vs. TrEMBL
Match: A0A267GTT8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006051g1 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.500e-10
Identity = 60/158 (37.97%), Postives = 90/158 (56.96%), Query Frame = 2
Query:   62 FAGRGLETLSPNSLTNDEKVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNL 535
            F  + L  L P++      +L IS N F+ L+SL  L  L  +IAD+N +   +++P L  L  LSLNKNKI+DL+ L   L    P L+ LSL+GNP +PD I+ H+SRL+    +   + D  +DS+        +FD D+  R+RL + + LP+L
Sbjct:    7 FCWQDLSQLPPDA-DAAVTILDISHNHFRSLDSLAPLKQLKVLIADDNELDSQLRLPDLPHLETLSLNKNKISDLEQLCSELGRRAPRLEFLSLMGNPAAPDAIFQHISRLADAAAA-ADDADDFVDSA------TPDFDEDDFARYRLLVAHLLPSL 156          

HSP 2 Score: 29.261 bits (64), Expect = 1.500e-10
Identity = 17/39 (43.59%), Postives = 25/39 (64.10%), Query Frame = 1
Query:  517 LPAAEFALIDSLKVTDIERTEAKRRGQFLQIKRLDPSEN 633
            LP+  +  +DS  VTD ER EA++RG++L   RL  S+ 
Sbjct:  153 LPSLRY--LDSSPVTDRERLEARQRGRYLLKVRLAESDG 189          
BLAST of Leucine rich melanocyte differentiation associated vs. TrEMBL
Match: A0A267GIX2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023296g1 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.563e-10
Identity = 60/158 (37.97%), Postives = 90/158 (56.96%), Query Frame = 2
Query:   62 FAGRGLETLSPNSLTNDEKVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNL 535
            F  + L  L P++      +L IS N F+ L+SL  L  L  +IAD+N +   +++P L  L  LSLNKNKI+DL+ L   L    P L+ LSL+GNP +PD I+ H+SRL+    +   + D  +DS+        +FD D+  R+RL + + LP+L
Sbjct:    6 FCWQDLSQLPPDA-DAAVTILDISHNHFRSLDSLAPLKQLKVLIADDNELDSQLRLPDLPHLETLSLNKNKISDLEQLCSELGRRAPRLEFLSLMGNPAAPDAIFQHISRLADAAAA-ADDADDFVDSA------TPDFDEDDFARYRLLVAHLLPSL 155          

HSP 2 Score: 28.8758 bits (63), Expect = 1.563e-10
Identity = 17/39 (43.59%), Postives = 25/39 (64.10%), Query Frame = 1
Query:  517 LPAAEFALIDSLKVTDIERTEAKRRGQFLQIKRLDPSEN 633
            LP+  +  +DS  VTD ER EA++RG++L   RL  S+ 
Sbjct:  152 LPSLRY--LDSSLVTDRERLEARQRGRYLLKVRLAESDG 188          
BLAST of Leucine rich melanocyte differentiation associated vs. TrEMBL
Match: A0A1I8GPF3 (Ig-like domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 7.378e-7
Identity = 46/130 (35.38%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  152 LESLHFLPNLIEIIADNNYITENIKIP--XXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNL 535
            L+SL  L  L  +IAD+N +   +++P    L+  +L+ NK  I+DL+ L   L    P L+ LSL+GNP +PD I+ H+SRL+    +   + D  +DS+        +FD D+  R+RL + + LP+L
Sbjct:    2 LDSLAPLKQLKVLIADDNELDSQLRLPDLPHLETLSLNKNKASISDLEQLCSELGRRAPRLEFLSLMGNPAAPDAIFQHISRLADAAAA-ADDADDFVDSA------TPDFDEDDFARYRLLVAHLLPSL 124          

HSP 2 Score: 29.6462 bits (65), Expect = 7.378e-7
Identity = 15/31 (48.39%), Postives = 21/31 (67.74%), Query Frame = 1
Query:  541 IDSLKVTDIERTEAKRRGQFLQIKRLDPSEN 633
            +DS  VTD ER EA++RG++L   RL  S+ 
Sbjct:  127 LDSSPVTDRERLEARQRGRYLLKVRLAESDG 157          
BLAST of Leucine rich melanocyte differentiation associated vs. TrEMBL
Match: A0A2C9JFC0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055708 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 3.916e-6
Identity = 33/80 (41.25%), Postives = 54/80 (67.50%), Query Frame = 2
Query:  128 ISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPD 367
            IS N+FKDL  L  LP L  ++AD+N++T ++KIP    L  L +N+N+I +L + +  +A++ PNLK+LS++ N  +P 
Sbjct:   39 ISYNKFKDLRFLQELPKLKSLVADHNHLTSHVKIPHCASLETLWVNQNRIQNLSLFIATVAKSCPNLKILSMMKNEAAPS 118          
BLAST of Leucine rich melanocyte differentiation associated vs. TrEMBL
Match: A0A2I4AYJ9 (leucine-rich repeat-containing protein C10orf11 homolog isoform X2 OS=Austrofundulus limnaeus OX=52670 GN=LOC106515339 PE=4 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 4.369e-6
Identity = 48/140 (34.29%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  116 KVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNL 535
            K L +S NQ + L  L     L E+I DNN +  ++++P+L  L+ L+LNKN++ D++VLL++LA+ TP+L+ LSLLGN   P+Q+ S                               + D D+  R+R  +LY+LP L
Sbjct:   38 KRLDLSFNQLRSLAGLKMFTELEELIVDNNQLGNDLQLPRLCNLHTLTLNKNQLTDIEVLLEHLADLTPSLQYLSLLGNEACPNQLVS------------------------------PDKDEDDYQRYRYFVLYKLPQL 147          

HSP 2 Score: 26.5646 bits (57), Expect = 4.369e-6
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = 1
Query:  517 LPAAEFALIDSLKVTDIERTEAKRRGQFLQI 609
            LP  +F  +DS KVT  E  EA+ RG F+++
Sbjct:  144 LPQLKF--LDSRKVTKEELMEAQARGAFMKV 172          
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Medaka
Match: lrmda (leucine rich melanocyte differentiation associated [Source:NCBI gene;Acc:101174451])

HSP 1 Score: 53.5286 bits (127), Expect = 1.012e-7
Identity = 36/84 (42.86%), Postives = 58/84 (69.05%), Query Frame = 2
Query:  128 ISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYS 379
            +S NQ + L  L     L E++ DNN +  ++++P+L  L+ L+LNKN++ D++ LL++LA+ TP+LK LSLLGN   P+Q+ S
Sbjct:   42 LSFNQLRSLAGLKMFTELEELVVDNNLLGNDLQLPRLPNLHTLTLNKNQLTDIEALLEHLADVTPSLKYLSLLGNEACPNQLVS 125          
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Medaka
Match: lrmda (leucine rich melanocyte differentiation associated [Source:NCBI gene;Acc:101174451])

HSP 1 Score: 52.7582 bits (125), Expect = 2.081e-7
Identity = 36/84 (42.86%), Postives = 58/84 (69.05%), Query Frame = 2
Query:  128 ISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYS 379
            +S NQ + L  L     L E++ DNN +  ++++P+L  L+ L+LNKN++ D++ LL++LA+ TP+LK LSLLGN   P+Q+ S
Sbjct:   42 LSFNQLRSLAGLKMFTELEELVVDNNLLGNDLQLPRLPNLHTLTLNKNQLTDIEALLEHLADVTPSLKYLSLLGNEACPNQLVS 125          
BLAST of Leucine rich melanocyte differentiation associated vs. Planmine SMEST
Match: SMESG000076354.1 (SMESG000076354.1)

HSP 1 Score: 278.1 bits (710), Expect = 7.651e-118
Identity = 160/160 (100.00%), Postives = 160/160 (100.00%), Query Frame = 2
Query:   59 MFAGRGLETLSPNSLTNDEKVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPXXXXXXXXXXXXXXXXDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNLH 538
            MFAGRGLETLSPNSLTNDEKVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPKLLKLNALSLNKNKINDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNLH
Sbjct:    1 MFAGRGLETLSPNSLTNDEKVLLISDNQFKDLESLHFLPNLIEIIADNNYITENIKIPKLLKLNALSLNKNKINDLDVLLDNLAENTPNLKLLSLLGNPVSPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRLRILYRLPNLH 160          

HSP 2 Score: 166.392 bits (420), Expect = 7.651e-118
Identity = 83/88 (94.32%), Postives = 83/88 (94.32%), Query Frame = 1
Query:  517 LPAAEFALIDSLKVTDIERTEAKRRGQFLQIKRLDPSENRSISMKANNIVSLIPGRVTDWISTYNPLKPLQNTENFTPLDDPKQKDSK 780
            LP   F  IDSLKVTDIERTEAKRRGQFLQIKRLDPSENRSISMKANNIVSLIPGRVTDWISTYNPLKPLQNTENFTPLDDPKQKDSK
Sbjct:  156 LPNLHF--IDSLKVTDIERTEAKRRGQFLQIKRLDPSENRSISMKANNIVSLIPGRVTDWISTYNPLKPLQNTENFTPLDDPKQKDSK 241          
The following BLAST results are available for this feature:
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
LRMDA3.709e-637.14leucine rich melanocyte differentiation associated... [more]
LRMDA5.139e-635.42leucine rich melanocyte differentiation associated... [more]
LRMDA8.078e-636.92leucine rich melanocyte differentiation associated... [more]
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrmda7.559e-742.86leucine rich melanocyte differentiation associated... [more]
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lrmda1.349e-646.51leucine rich melanocyte differentiation associated... [more]
Lrmda1.521e-646.51leucine rich melanocyte differentiation associated... [more]
Lrmda2.599e-646.51leucine rich melanocyte differentiation associated... [more]
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GTT81.500e-1037.97Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GIX21.563e-1037.97Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GPF37.378e-735.38Ig-like domain-containing protein OS=Macrostomum l... [more]
A0A2C9JFC03.916e-641.25Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2I4AYJ94.369e-634.29leucine-rich repeat-containing protein C10orf11 ho... [more]
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lrmda1.012e-742.86leucine rich melanocyte differentiation associated... [more]
lrmda2.081e-742.86leucine rich melanocyte differentiation associated... [more]
back to top
BLAST of Leucine rich melanocyte differentiation associated vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000076354.17.651e-118100.00SMESG000076354.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005425 ID=SMED30005425|Name=Leucine rich melanocyte differentiation associated|organism=Schmidtea mediterranea sexual|type=transcript|length=1568bp
CTTGTTTAAATAATGCAAAATCTATCAATTTTATTTAAAATTGAACCTTG
ACGGAAAAATGTTTGCTGGTCGGGGTTTGGAAACTTTGAGTCCGAATTCA
TTAACCAACGATGAAAAGGTTCTACTAATTAGTGATAATCAGTTCAAAGA
TTTGGAATCTTTGCATTTTCTTCCGAATCTGATTGAGATTATTGCGGATA
ACAATTATATTACTGAAAATATTAAAATTCCAAAACTCCTGAAGCTTAAT
GCGTTGTCATTAAATAAAAATAAAATTAATGACCTTGATGTTTTGCTTGA
TAATCTGGCCGAAAATACTCCTAACTTGAAATTATTGAGCTTGCTTGGAA
ATCCTGTGTCACCGGATCAGATTTATTCACATTTATCCAGATTATCAATT
CTCCACGAGAGCAGAGATCAGAATGAAGATCAAGAGATTGATTCCAGCAT
TATTAGAGAAGACGGGATAACTAATTTTGATCTTGATGAATGTCTTAGAT
TTAGACTTCGGATTCTCTACCGGCTGCCGAATTTGCACTCATCGACTCTT
TGAAAGTGACAGACATTGAGCGGACGGAGGCCAAAAGGAGAGGTCAATTT
CTTCAAATAAAAAGATTAGATCCCAGTGAGAACCGAAGTATTTCAATGAA
AGCGAACAATATTGTCTCCCTGATTCCGGGACGAGTGACGGATTGGATTT
CGACATATAACCCATTGAAACCCTTACAAAATACTGAAAATTTTACTCCG
CTAGACGACCCTAAGCAAAAGGATTCCAAAGGTTAGTTTTGTTCTTGATT
AATATAATGATGTAAAATTTGGGAAAACTTATTAAATTGTCATTTACTAA
ACCGTAATTTGAACTTGAAAGGTTCATAACTGGAACCAGCAAATTGCTGG
CTTATTCGGTTTATTTGACATCATTAATACATTTAGATCTCGATTGTAGG
TAAGTCTCATGATATGAAAAGAATGTGTTGAAAATTTATGTTAAATAGAA
AAAAACACTGATCTAGAGCAGAGGTCTCCAATGTTTTAAAGAAGTGAGCC
ACATAAAAACTTATCCTGAGTTCAGCGGGCCATATCAAAGTCATAAGTAT
TTGAGCGGGACATAAAGACTACCACGCGGGCCTTAGTTTGGGGTCGCTGG
TCTAGGAGGTTAAATGTAAATGAAATTCCAAAGGTAAACAGATCAATGAT
CATTCTTACTGATTATTAATACTGGAACACAACGAAAGGATTGACACCTG
CCTATATCATGCTGGATCCTTTAATATGTCTTTTATTATTGGACTACTTC
TTGCCAAAGTGAAAGAGTCCTACTATTAACAATAATTCTTTTTTGATTCC
TAGTCATTCAGTTATTACTAAACCTTCCTGCCAATTGGTGCTGGAATCAT
CTACCGATTTGAACCAAAGTTCCTGAAATAAGTTCCTTGAATCCCTAAGA
ATCTGGAAACAAATTTCCTTGTTCCATGACATCAAATAGCAATCACAAAA
CAAGAAAAAAGAGAAAATATACCAGTAAAATCCTTTATCCTTTGTACCAT
TGATCTATTAATCTCTTA
back to top

protein sequence of SMED30005425-orf-1

>SMED30005425-orf-1 ID=SMED30005425-orf-1|Name=SMED30005425-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
MFAGRGLETLSPNSLTNDEKVLLISDNQFKDLESLHFLPNLIEIIADNNY
ITENIKIPKLLKLNALSLNKNKINDLDVLLDNLAENTPNLKLLSLLGNPV
SPDQIYSHLSRLSILHESRDQNEDQEIDSSIIREDGITNFDLDECLRFRL
RILYRLPNLHSSTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043473pigmentation
GO:0030154cell differentiation
GO:0030318melanocyte differentiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR46282:SF2LEUCINE-RICH MELANOCYTE DIFFERENTIATION-ASSOCIATED PROTEINcoord: 21..107
NoneNo IPR availablePANTHERPTHR46282FAMILY NOT NAMEDcoord: 21..107
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 19..101