CAP-Gly domain-containing protein

Overview
NameCAP-Gly domain-containing protein
Smed IDSMED30005421
Length (bp)2516
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CAP-Gly domain-containing protein (SMED30005421) t-SNE clustered cells

Violin plots show distribution of expression levels for CAP-Gly domain-containing protein (SMED30005421) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CAP-Gly domain-containing protein (SMED30005421) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CAP-Gly domain-containing protein (SMED30005421) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005421

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30005421SMESG000006189.1 SmedASXL_015183SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005421SMESG000006189.1 dd_Smed_v4_14698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005421SMESG000006189.1 dd_Smed_v4_14698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005421SMESG000006189.1 dd_Smed_v4_14698_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30005421SMESG000006189.1 dd_Smed_v4_12985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005421SMESG000006189.1 dd_Smed_v4_12985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005421SMESG000006189.1 dd_Smed_v4_12985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005421SMESG000006189.1 dd_Smed_v4_12985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005421SMESG000006189.1 dd_Smed_v6_14698_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005421SMESG000006189.1 dd_Smed_v6_12985_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005421SMESG000006189.1 dd_Smed_v4_14698_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005421SMESG000006189.1 dd_Smed_v4_12985_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-175f12.2 (si:ch211-175f12.2 [Source:ZFIN;Acc:ZDB-GENE-110411-220])

HSP 1 Score: 64.3142 bits (155), Expect = 1.452e-10
Identity = 29/85 (34.12%), Postives = 50/85 (58.82%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLEL-GEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYK 2424
            F P    DL     V+ + P G++ TGT+ ++G++    +  +G+EL   + G+HDG +EG RYF C    G F+ F K+++A++
Sbjct:  220 FVPHSPMDLKTGHRVRIMLPSGRICTGTLRYLGNMHNSPDHYLGVELEMADNGQHDGTYEGQRYFDCDPGYGAFVPFSKLLMAWE 304          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-175f12.2 (si:ch211-175f12.2 [Source:ZFIN;Acc:ZDB-GENE-110411-220])

HSP 1 Score: 63.1586 bits (152), Expect = 1.636e-10
Identity = 29/85 (34.12%), Postives = 50/85 (58.82%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLEL-GEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYK 2424
            F P    DL     V+ + P G++ TGT+ ++G++    +  +G+EL   + G+HDG +EG RYF C    G F+ F K+++A++
Sbjct:  147 FVPHSPMDLKTGHRVRIMLPSGRICTGTLRYLGNMHNSPDHYLGVELEMADNGQHDGTYEGQRYFDCDPGYGAFVPFSKLLMAWE 231          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01072096.1 (pep chromosome:GRCz11:10:44408675:44411032:-1 gene:ENSDARG00000079483.4 transcript:ENSDART00000111509.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01072096.1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.621e-6
Identity = 32/77 (41.56%), Postives = 40/77 (51.95%), Query Frame = 1
Query: 2182 KVASDLHLDDVVKFVRPGGKMATGTVCFIGHLP-GRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKI 2409
            K+  +L L D V     GG  A G V F+G     + E C G+EL E  GK+DG   G RYFQC    G+F   HK+
Sbjct:  171 KIQRELKLGDRVLV---GGSKA-GVVRFLGETDFAKGEWC-GVELDEPLGKNDGAVAGGRYFQCLPKYGLFAPTHKV 242          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016691.1 (uncharacterized LOC100495307 [Source:NCBI gene;Acc:100495307])

HSP 1 Score: 109.768 bits (273), Expect = 1.472e-24
Identity = 53/102 (51.96%), Postives = 71/102 (69.61%), Query Frame = 1
Query: 2134 TENYTYP-----PRYEYSFTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLEL-GEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 2421
            TE+ T P     PR    F PK  +DL + D+VKF RP GK++ GT+ + G LPGR EV +G+EL G E GKHDG+F+G RYF C+ N+GVF++F KII+A+
Sbjct:  378 TESSTRPSALVLPRR--PFAPKSIADLKVGDLVKFSRPAGKISKGTIQYKGCLPGRVEVYLGVELEGSEVGKHDGIFQGTRYFLCKPNKGVFVNFSKIIMAW 477          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016706.1 (uncharacterized LOC100495307 [Source:NCBI gene;Acc:100495307])

HSP 1 Score: 110.923 bits (276), Expect = 2.176e-24
Identity = 53/102 (51.96%), Postives = 71/102 (69.61%), Query Frame = 1
Query: 2134 TENYTYP-----PRYEYSFTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLEL-GEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 2421
            TE+ T P     PR    F PK  +DL + D+VKF RP GK++ GT+ + G LPGR EV +G+EL G E GKHDG+F+G RYF C+ N+GVF++F KII+A+
Sbjct:  632 TESSTRPSALVLPRR--PFAPKSIADLKVGDLVKFSRPAGKISKGTIQYKGCLPGRVEVYLGVELEGSEVGKHDGIFQGTRYFLCKPNKGVFVNFSKIIMAW 731          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: K1PSP0 (CAP-Gly domain-containing linker protein 3 OS=Crassostrea gigas OX=29159 GN=CGI_10008448 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.613e-24
Identity = 48/83 (57.83%), Postives = 69/83 (83.13%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 2421
            F+P+   DL+L+DVVKF R GGK++ GTV F+GHLPGRS+  +G+EL +E GKHDG FEG RYF+C+ N+GVF++F+K+++A+
Sbjct: 1505 FSPRSPGDLNLEDVVKFSRAGGKLSQGTVKFVGHLPGRSDAYLGVELDKEDGKHDGKFEGMRYFRCKPNKGVFVAFNKVVMAW 1587          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A210PHN7 (Restin-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07661 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.647e-24
Identity = 47/83 (56.63%), Postives = 69/83 (83.13%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 2421
            F+P+   D+HL+DVVKF R GGK++ GTV F+GHLPGR++V +G+EL +E GKHDG FE  RYF+C+ N+GVF++F+K+++A+
Sbjct: 1894 FSPRTPGDIHLEDVVKFSRQGGKLSQGTVKFVGHLPGRNDVYLGVELDKEEGKHDGTFESARYFKCKPNKGVFVAFNKVVMAW 1976          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A2C9LH93 (CAP-Gly domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106051307 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.206e-22
Identity = 45/83 (54.22%), Postives = 65/83 (78.31%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 2421
            F P+  +DL  +DVVKF R GGK+  G V ++GHLPGRSE  +G+EL ++ GKHDG FEG RYF+C+ N+GVF++F+K+++A+
Sbjct: 1109 FAPRSIADLRNEDVVKFSRVGGKLTQGVVKYVGHLPGRSEAYLGVELDKDEGKHDGTFEGIRYFKCKPNKGVFVAFNKVVMAW 1191          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A2C9LHY3 (CAP-Gly domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106051307 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.313e-22
Identity = 45/83 (54.22%), Postives = 65/83 (78.31%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 2421
            F P+  +DL  +DVVKF R GGK+  G V ++GHLPGRSE  +G+EL ++ GKHDG FEG RYF+C+ N+GVF++F+K+++A+
Sbjct: 1092 FAPRSIADLRNEDVVKFSRVGGKLTQGVVKYVGHLPGRSEAYLGVELDKDEGKHDGTFEGIRYFKCKPNKGVFVAFNKVVMAW 1174          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A1I8IZN2 (CAP-Gly domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.322e-22
Identity = 43/85 (50.59%), Postives = 66/85 (77.65%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYKS 2427
            F PK A+D+   D+VKF R GG+++ G V F+G LPGR++  VG+EL +E GKHDG+++G RYFQC+  +GVF++F+K+I+ Y++
Sbjct:  140 FAPKQAADIRSGDLVKFTRYGGRISKGLVHFVGRLPGRTDYYVGIELDQEEGKHDGVYDGRRYFQCKPRKGVFVAFNKLIMCYQA 224          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-175f12.2 (uncharacterized LOC103030656 [Source:NCBI gene;Acc:103030656])

HSP 1 Score: 65.0846 bits (157), Expect = 6.135e-11
Identity = 30/85 (35.29%), Postives = 51/85 (60.00%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELG-EEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYK 2424
            F P    DL     V+ + P G+++TGT+ ++G L G  E+ +G+EL   E G+  G +EG  YF C+   G F++F K+++A++
Sbjct:  213 FVPHSPMDLQPGHRVRIMLPSGRISTGTLRYLGPLQGLPEMHLGVELELAENGQQTGTYEGQFYFDCKPGYGAFVAFSKLLMAWE 297          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Match: cyldl (cylindromatosis (turban tumor syndrome), like [Source:ZFIN;Acc:ZDB-GENE-131127-190])

HSP 1 Score: 55.0694 bits (131), Expect = 2.609e-7
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = 1
Query: 2251 GTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFI 2394
            GTV +IGHLP ++++  GLEL E+ G +DG F   RYF C   RG+F+
Sbjct:  282 GTVRWIGHLPEKTDLMAGLELEEDWGVNDGTFRNDRYFFCPPKRGIFV 329          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004647.1 (pep scaffold:Pmarinus_7.0:GL484285:5077:12891:1 gene:ENSPMAG00000004232.1 transcript:ENSPMAT00000004647.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 1.277e-6
Identity = 29/73 (39.73%), Postives = 38/73 (52.05%), Query Frame = 1
Query: 2194 DLHLDDVVKFVRPGGKMATGTVCFIGHLP-GRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKI 2409
            DL + D V      G    G V F+G     + E C G+EL E  GK+DG   G RYFQC++  G+F   HK+
Sbjct:  190 DLKMGDRVLV----GGTKAGVVRFVGETDFAKGEWC-GVELDEPLGKNDGAVAGTRYFQCQQRYGLFAPIHKV 257          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkeyp-47f9.4 (si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9])

HSP 1 Score: 49.6766 bits (117), Expect = 2.536e-6
Identity = 24/53 (45.28%), Postives = 29/53 (54.72%), Query Frame = 1
Query: 2236 GKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFI 2394
            G    GTV F+G +   +   +GLEL    GKHDG   GHRYF CR   GV +
Sbjct:  585 GTGEMGTVRFVGEVGFAAGTWLGLELRAPRGKHDGAVGGHRYFSCRPGCGVMV 637          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Match: EDO30311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T153])

HSP 1 Score: 83.1889 bits (204), Expect = 3.324e-16
Identity = 33/83 (39.76%), Postives = 51/83 (61.45%), Query Frame = 1
Query: 2173 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 2421
            F P    D+ L   V   R  G +  G V ++G LP R++  +G+EL    GKHDG F G R+F+C+ NRG+F+S++K+++ Y
Sbjct: 1180 FAPNSPQDIQLGMRVLVTRTRGNVGRGVVKYVGSLPDRTDTYIGVELDSGEGKHDGSFGGKRFFRCKPNRGIFVSYNKVVMCY 1262          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Match: EDO33600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRR5])

HSP 1 Score: 48.1358 bits (113), Expect = 9.414e-6
Identity = 28/75 (37.33%), Postives = 40/75 (53.33%), Query Frame = 1
Query: 2188 ASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKII 2412
            +S L + D  + V  G K+  GT+ ++G          G+EL E  GK+DG   G RYFQC +  G+F   HK+I
Sbjct:   90 SSSLEIGD--RVVVSGNKI--GTLRYVGTTEFAKGEWAGVELDEPLGKNDGAVAGTRYFQCIQGYGLFAPVHKVI 160          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: cyldl (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101168449])

HSP 1 Score: 51.2174 bits (121), Expect = 4.221e-6
Identity = 27/69 (39.13%), Postives = 38/69 (55.07%), Query Frame = 1
Query: 2200 HLD--DVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISF 2400
            HLD   +V+     G +  G + +IG LP R E+  GLEL E+ G  DG F+G R+F C   R +F+  
Sbjct:  290 HLDVNSMVEVTLGAGNLY-GIIRWIGKLPEREEIMAGLELEEDRGVSDGTFKGVRFFVCPNKRALFVKL 357          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: cyldl (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101168449])

HSP 1 Score: 51.2174 bits (121), Expect = 4.685e-6
Identity = 27/69 (39.13%), Postives = 38/69 (55.07%), Query Frame = 1
Query: 2200 HLD--DVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISF 2400
            HLD   +V+     G +  G + +IG LP R E+  GLEL E+ G  DG F+G R+F C   R +F+  
Sbjct:  290 HLDVNSMVEVTLGAGNLY-GIIRWIGKLPEREEIMAGLELEEDRGVSDGTFKGVRFFVCPNKRALFVKL 357          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: cyldl (ubiquitin carboxyl-terminal hydrolase CYLD [Source:NCBI gene;Acc:101168449])

HSP 1 Score: 51.2174 bits (121), Expect = 4.685e-6
Identity = 27/69 (39.13%), Postives = 38/69 (55.07%), Query Frame = 1
Query: 2200 HLD--DVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISF 2400
            HLD   +V+     G +  G + +IG LP R E+  GLEL E+ G  DG F+G R+F C   R +F+  
Sbjct:  290 HLDVNSMVEVTLGAGNLY-GIIRWIGKLPEREEIMAGLELEEDRGVSDGTFKGVRFFVCPNKRALFVKL 357          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: dctn1a (dynactin subunit 1 [Source:NCBI gene;Acc:101162870])

HSP 1 Score: 50.447 bits (119), Expect = 8.459e-6
Identity = 27/67 (40.30%), Postives = 36/67 (53.73%), Query Frame = 1
Query: 2209 DVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKI 2409
            D+   V   GK   GTV +IG     S   VG+ L E  GK+DG  +G RYF C +N G+F+   +I
Sbjct:   10 DIGSVVEVTGKGQRGTVAYIGTTLFASGKWVGVILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQI 76          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: dctn1a (dynactin subunit 1 [Source:NCBI gene;Acc:101162870])

HSP 1 Score: 50.447 bits (119), Expect = 9.258e-6
Identity = 31/94 (32.98%), Postives = 46/94 (48.94%), Query Frame = 1
Query: 2143 YTYPPRYEYSFTPKVASDLHLDD-----VVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKI 2409
            ++Y PR       K++S   ++      +   V   GK   GTV +IG     S   VG+ L E  GK+DG  +G RYF C +N G+F+   +I
Sbjct:    7 HSYTPRLTSPLISKMSSAGSVESGKPPKIGSVVEVTGKGQRGTVAYIGTTLFASGKWVGVILDEPKGKNDGTVQGKRYFTCEENHGIFVRQSQI 100          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000006189.1 (SMESG000006189.1)

HSP 1 Score: 1309.28 bits (3387), Expect = 0.000e+0
Identity = 762/762 (100.00%), Postives = 762/762 (100.00%), Query Frame = 1
Query:  145 MSLPENYVTVSHHNFSPIDENRNYSSLPTSGRLSESKIERNVDDFXXXXXXXXXXXXXXXXXSDSITLKENSRHSSLLFDNESEIPIDLEDENIRPSIHHDHNINASREVSNHSKTPILDLMNDQVIKSPRVSTVNSIENNDIQNENDHEKIATPTIKFTKNSNHSTNDSTGKNDDKFHEKSSDYQEFVLKLTEMSSLLLQKDDEIKKLSQKLIEIETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNEEKNKIPKGVSMENSIEILNVSLEQENQSNLDTKNNPNLSNVNPDGNENLKSVSIDNFTIDRDELTPDIRKKLGDLESEVRRLQQANVDSILTLQKLEDNNASSGHLSNFTAINQLLVDHNLLKEELQQLKWDHAKLTQVGLLAEEISQLKKDMKFLKNYTKMSSKSLNHLPTSSIYNRHVKDTIDSKIKDRQIFVSNIPDSNGNSNYIYQKLQSQRKPMAETPSIHKMLKSSIESLESPYHITCQNIQHSVPFSGGPTYRARKVSDSSSVLVEDIKPKSWIQPIPKSYNHSYQLLPNELSSPFNDCYNNKDFDAQXXXXXXXXXXXXXEKSEDNWQSTNKNYNENNGDFLSTLENESSEVSTVKNTENYTYPPRYEYSFTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYKSH 2430
            MSLPENYVTVSHHNFSPIDENRNYSSLPTSGRLSESKIERNVDDFLNKIALNNNLINDIENNSDSITLKENSRHSSLLFDNESEIPIDLEDENIRPSIHHDHNINASREVSNHSKTPILDLMNDQVIKSPRVSTVNSIENNDIQNENDHEKIATPTIKFTKNSNHSTNDSTGKNDDKFHEKSSDYQEFVLKLTEMSSLLLQKDDEIKKLSQKLIEIETKNKSRKNSSSSSSSSSSSSDESDKSSKEKPILKKNKKEKSKDKNETKKNKKEKENSKDKSETKKQSAKKDKKMKISKSNEEKNKIPKGVSMENSIEILNVSLEQENQSNLDTKNNPNLSNVNPDGNENLKSVSIDNFTIDRDELTPDIRKKLGDLESEVRRLQQANVDSILTLQKLEDNNASSGHLSNFTAINQLLVDHNLLKEELQQLKWDHAKLTQVGLLAEEISQLKKDMKFLKNYTKMSSKSLNHLPTSSIYNRHVKDTIDSKIKDRQIFVSNIPDSNGNSNYIYQKLQSQRKPMAETPSIHKMLKSSIESLESPYHITCQNIQHSVPFSGGPTYRARKVSDSSSVLVEDIKPKSWIQPIPKSYNHSYQLLPNELSSPFNDCYNNKDFDAQSVDSYVSVTTSVTEKSEDNWQSTNKNYNENNGDFLSTLENESSEVSTVKNTENYTYPPRYEYSFTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYKSH
Sbjct:    1 MSLPENYVTVSHHNFSPIDENRNYSSLPTSGRLSESKIERNVDDFLNKIALNNNLINDIENNSDSITLKENSRHSSLLFDNESEIPIDLEDENIRPSIHHDHNINASREVSNHSKTPILDLMNDQVIKSPRVSTVNSIENNDIQNENDHEKIATPTIKFTKNSNHSTNDSTGKNDDKFHEKSSDYQEFVLKLTEMSSLLLQKDDEIKKLSQKLIEIETKNKSRKNSSSSSSSSSSSSDESDKSSKEKPILKKNKKEKSKDKNETKKNKKEKENSKDKSETKKQSAKKDKKMKISKSNEEKNKIPKGVSMENSIEILNVSLEQENQSNLDTKNNPNLSNVNPDGNENLKSVSIDNFTIDRDELTPDIRKKLGDLESEVRRLQQANVDSILTLQKLEDNNASSGHLSNFTAINQLLVDHNLLKEELQQLKWDHAKLTQVGLLAEEISQLKKDMKFLKNYTKMSSKSLNHLPTSSIYNRHVKDTIDSKIKDRQIFVSNIPDSNGNSNYIYQKLQSQRKPMAETPSIHKMLKSSIESLESPYHITCQNIQHSVPFSGGPTYRARKVSDSSSVLVEDIKPKSWIQPIPKSYNHSYQLLPNELSSPFNDCYNNKDFDAQSVDSYVSVTTSVTEKSEDNWQSTNKNYNENNGDFLSTLENESSEVSTVKNTENYTYPPRYEYSFTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYKSH 762          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000011534.1 (SMESG000011534.1)

HSP 1 Score: 120.168 bits (300), Expect = 5.307e-28
Identity = 45/84 (53.57%), Postives = 69/84 (82.14%), Query Frame = 1
Query: 2170 SFTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 2421
            +F P+  SD+ ++DVVKF+R GG+++ G V FIGHLP R+++ +G+EL  E GKH+G+++G RYFQCR+N+GVF++F+KII+ Y
Sbjct:  494 AFAPRAGSDISINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYLGIELEIEEGKHNGIYDGVRYFQCRENKGVFVAFNKIIMVY 577          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000031119.1 (SMESG000031119.1)

HSP 1 Score: 79.337 bits (194), Expect = 5.087e-15
Identity = 29/77 (37.66%), Postives = 52/77 (67.53%), Query Frame = 1
Query: 2194 DLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYK 2424
            ++ + D+V+F R   ++  G V FIG LP + ++ +GL+L  + G +DG + G RYF+  KNRG+F+SF ++++ +K
Sbjct:  438 NIDVGDIVRFSRETCRVCLGIVKFIGDLPNQKDIFLGLKLERDDGLNDGTYNGQRYFEFEKNRGIFVSFQRVMMIFK 514          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000031119.1 (SMESG000031119.1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.825e-15
Identity = 30/83 (36.14%), Postives = 53/83 (63.86%), Query Frame = 1
Query: 2176 TPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAYK 2424
             P    ++ + D+V+F R   ++  G V FIG LP + ++ +GL+L  + G +DG + G RYF+  KNRG+F+SF ++++ +K
Sbjct:  346 VPVHPCNIDVGDIVRFSRETCRVCLGIVKFIGDLPNQKDIFLGLKLERDDGLNDGTYNGQRYFEFEKNRGIFVSFQRVMMIFK 428          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000031119.1 (SMESG000031119.1)

HSP 1 Score: 56.6102 bits (135), Expect = 6.364e-8
Identity = 24/70 (34.29%), Postives = 41/70 (58.57%), Query Frame = 1
Query: 2176 TPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQ---CRK 2376
             P    ++ + D+V+F R   ++  G V FIG LP + ++ +GL+L  + G +DG + G RYF+   C+K
Sbjct:  476 VPVHPCNIDVGDIVRFSRETCRVCLGIVKFIGDLPNQKDIFLGLKLERDDGLNDGTYNGQRYFELKICKK 545          
The following BLAST results are available for this feature:
BLAST of CAP-Gly domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-175f12.21.452e-1034.12si:ch211-175f12.2 [Source:ZFIN;Acc:ZDB-GENE-110411... [more]
si:ch211-175f12.21.636e-1034.12si:ch211-175f12.2 [Source:ZFIN;Acc:ZDB-GENE-110411... [more]
CABZ01072096.13.621e-641.56pep chromosome:GRCz11:10:44408675:44411032:-1 gene... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000016691.11.472e-2451.96uncharacterized LOC100495307 [Source:NCBI gene;Acc... [more]
ENSXETT00000016706.12.176e-2451.96uncharacterized LOC100495307 [Source:NCBI gene;Acc... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PSP01.613e-2457.83CAP-Gly domain-containing linker protein 3 OS=Cras... [more]
A0A210PHN71.647e-2456.63Restin-like OS=Mizuhopecten yessoensis OX=6573 GN=... [more]
A0A2C9LH931.206e-2254.22CAP-Gly domain-containing protein OS=Biomphalaria ... [more]
A0A2C9LHY31.313e-2254.22CAP-Gly domain-containing protein OS=Biomphalaria ... [more]
A0A1I8IZN21.322e-2250.59CAP-Gly domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-175f12.26.135e-1135.29uncharacterized LOC103030656 [Source:NCBI gene;Acc... [more]
cyldl2.609e-750.00cylindromatosis (turban tumor syndrome), like [Sou... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004647.11.277e-639.73pep scaffold:Pmarinus_7.0:GL484285:5077:12891:1 ge... [more]
si:dkeyp-47f9.42.536e-645.28si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO303113.324e-1639.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336009.414e-637.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyldl4.221e-639.13ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
cyldl4.685e-639.13ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
cyldl4.685e-639.13ubiquitin carboxyl-terminal hydrolase CYLD [Source... [more]
dctn1a8.459e-640.30dynactin subunit 1 [Source:NCBI gene;Acc:101162870... [more]
dctn1a9.258e-632.98dynactin subunit 1 [Source:NCBI gene;Acc:101162870... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006189.10.000e+0100.00SMESG000006189.1[more]
SMESG000011534.15.307e-2853.57SMESG000011534.1[more]
SMESG000031119.15.087e-1537.66SMESG000031119.1[more]
SMESG000031119.15.825e-1536.14SMESG000031119.1[more]
SMESG000031119.16.364e-834.29SMESG000031119.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005421 ID=SMED30005421|Name=CAP-Gly domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2516bp
AAATATTTCTCATAATATTTGTATTTTAGATTTTATCTTAAAATATCTTA
ACGTTTTTTATAATCCATCCAATATAATTTTCGTATATAATACAAAATGA
AATTGATATATTTCATTTCGACTATTTTTATTTATCTGTTTAATATGAGT
TTACCTGAAAATTATGTAACTGTCAGTCACCATAACTTTTCGCCAATAGA
TGAAAACAGAAATTATTCATCTTTACCAACATCGGGAAGATTAAGTGAAT
CCAAAATTGAACGCAATGTTGACGATTTTTTAAACAAAATCGCACTGAAC
AATAATCTAATAAATGATATCGAAAATAATAGTGACAGTATTACACTTAA
AGAAAATTCAAGACATAGCAGTTTATTATTTGATAATGAATCCGAAATTC
CAATAGATTTGGAAGATGAAAATATACGGCCATCTATACATCACGACCAT
AACATCAATGCATCACGAGAAGTTTCCAACCATTCCAAAACTCCAATTCT
AGACCTAATGAATGATCAGGTAATAAAATCTCCAAGAGTATCCACTGTGA
ATTCTATTGAAAATAATGACATTCAAAATGAGAACGATCATGAAAAGATT
GCCACTCCAACAATAAAATTCACCAAAAATTCAAACCATTCAACCAATGA
TTCAACTGGAAAAAATGATGACAAATTTCATGAAAAATCTTCAGATTATC
AAGAGTTTGTTTTGAAATTAACTGAAATGTCTTCACTTCTTTTGCAAAAA
GACGATGAAATCAAAAAACTTTCTCAGAAACTGATTGAAATTGAAACTAA
AAATAAATCCCGTAAAAATTCTTCCTCATCGTCATCATCATCTTCATCAT
CATCCGATGAGTCTGATAAATCCTCAAAAGAAAAACCTATTCTAAAAAAA
AACAAAAAAGAAAAATCTAAGGATAAAAATGAAACAAAGAAAAACAAAAA
AGAAAAAGAAAACTCTAAGGATAAAAGTGAAACAAAGAAGCAATCAGCTA
AAAAAGATAAAAAAATGAAGATCTCAAAATCAAATGAAGAAAAAAATAAA
ATCCCTAAAGGTGTTTCGATGGAAAACTCCATTGAAATTCTGAACGTCTC
ATTAGAACAAGAAAATCAGTCAAACCTCGACACTAAAAACAATCCAAACC
TATCAAATGTTAACCCGGATGGCAATGAAAATCTCAAATCAGTTTCTATT
GACAATTTTACAATTGACAGAGACGAGTTAACTCCAGATATTAGAAAAAA
GCTCGGTGACCTCGAATCCGAAGTTCGTCGGCTCCAACAGGCCAATGTGG
ATTCCATTCTAACATTGCAAAAATTGGAAGACAATAATGCCAGTTCAGGT
CACCTGTCAAATTTTACAGCTATCAACCAGTTGCTAGTCGATCACAATTT
ACTGAAAGAAGAATTACAACAATTGAAATGGGACCATGCTAAATTAACCC
AAGTTGGTTTGTTAGCTGAAGAAATTAGCCAATTGAAAAAAGATATGAAA
TTTTTGAAAAATTATACAAAAATGTCATCGAAATCGCTCAATCATTTACC
AACGTCTTCGATTTATAACAGACATGTCAAAGACACGATTGATTCTAAAA
TAAAGGATCGACAAATTTTCGTTTCAAATATTCCGGATTCAAACGGTAAT
TCGAATTACATTTACCAAAAGCTACAAAGTCAAAGGAAACCAATGGCTGA
AACGCCATCAATACATAAAATGCTGAAATCAAGCATAGAATCCCTAGAAT
CTCCTTATCATATCACTTGTCAAAACATCCAGCATTCTGTACCATTTAGT
GGAGGTCCAACTTATCGAGCAAGAAAAGTCAGCGATTCAAGTTCCGTCCT
TGTAGAAGACATTAAGCCAAAATCATGGATTCAACCAATTCCAAAAAGTT
ACAATCATTCCTATCAATTATTACCCAATGAGTTGTCGTCCCCATTCAAT
GATTGTTATAATAATAAAGATTTTGATGCCCAATCTGTGGACAGTTATGT
AAGTGTCACAACATCGGTTACAGAAAAATCTGAAGATAACTGGCAATCAA
CTAATAAGAATTATAATGAAAATAATGGAGATTTTCTCTCGACTTTAGAA
AATGAATCTTCAGAAGTTTCAACAGTAAAAAATACAGAAAATTATACATA
TCCTCCCAGATACGAATATTCATTTACACCAAAAGTTGCATCGGATTTAC
ATTTAGATGATGTAGTAAAGTTTGTTCGTCCTGGAGGTAAAATGGCAACA
GGGACGGTTTGTTTTATTGGACACTTACCAGGTCGGTCAGAAGTTTGTGT
GGGTTTAGAATTAGGAGAAGAAGCTGGAAAACATGATGGCCTATTTGAGG
GGCACCGTTATTTTCAATGTCGAAAAAACCGTGGAGTATTCATATCGTTT
CACAAGATTATATTGGCATACAAATCTCATTGATGATAATAATTTTTATT
TTATTTCTACCATATTCTCTATCTTTAAATAGCAAATGATTATTTTATTT
CACCTTTATTGGCGCG
back to top

protein sequence of SMED30005421-orf-1

>SMED30005421-orf-1 ID=SMED30005421-orf-1|Name=SMED30005421-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=779bp
MKLIYFISTIFIYLFNMSLPENYVTVSHHNFSPIDENRNYSSLPTSGRLS
ESKIERNVDDFLNKIALNNNLINDIENNSDSITLKENSRHSSLLFDNESE
IPIDLEDENIRPSIHHDHNINASREVSNHSKTPILDLMNDQVIKSPRVST
VNSIENNDIQNENDHEKIATPTIKFTKNSNHSTNDSTGKNDDKFHEKSSD
YQEFVLKLTEMSSLLLQKDDEIKKLSQKLIEIETKNKSRKNSSSSSSSSS
SSSDESDKSSKEKPILKKNKKEKSKDKNETKKNKKEKENSKDKSETKKQS
AKKDKKMKISKSNEEKNKIPKGVSMENSIEILNVSLEQENQSNLDTKNNP
NLSNVNPDGNENLKSVSIDNFTIDRDELTPDIRKKLGDLESEVRRLQQAN
VDSILTLQKLEDNNASSGHLSNFTAINQLLVDHNLLKEELQQLKWDHAKL
TQVGLLAEEISQLKKDMKFLKNYTKMSSKSLNHLPTSSIYNRHVKDTIDS
KIKDRQIFVSNIPDSNGNSNYIYQKLQSQRKPMAETPSIHKMLKSSIESL
ESPYHITCQNIQHSVPFSGGPTYRARKVSDSSSVLVEDIKPKSWIQPIPK
SYNHSYQLLPNELSSPFNDCYNNKDFDAQSVDSYVSVTTSVTEKSEDNWQ
STNKNYNENNGDFLSTLENESSEVSTVKNTENYTYPPRYEYSFTPKVASD
LHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLF
EGHRYFQCRKNRGVFISFHKIILAYKSH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036859CAP-Gly_dom_sf
IPR000938CAP-Gly_domain
Vocabulary: biological process
TermDefinition
GO:0001578microtubule bundle formation
GO:0006810transport
GO:0031116positive regulation of microtubule polymerization
GO:0044861protein transport into plasma membrane raft
Vocabulary: cellular component
TermDefinition
GO:0001726ruffle
GO:0005635nuclear envelope
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0015630microtubule cytoskeleton
GO:0016020membrane
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0035371microtubule plus-end
GO:0042995cell projection
GO:0044354macropinosome
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008017microtubule binding
GO:0008270zinc ion binding
GO:0015631tubulin binding
GO:0046872metal ion binding
GO:0051010microtubule plus-end binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 199..219
NoneNo IPR availableCOILSCoilCoilcoord: 410..430
NoneNo IPR availableCOILSCoilCoilcoord: 377..397
NoneNo IPR availableCOILSCoilCoilcoord: 251..288
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 239..305
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 141..180
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 219..306
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 223..238
NoneNo IPR availablePANTHERPTHR18916DYNACTIN 1-RELATED MICROTUBULE-BINDINGcoord: 128..760
NoneNo IPR availablePANTHERPTHR18916:SF65coord: 128..760
IPR000938CAP Gly-rich domainSMARTSM01052CAP_GLY_2coord: 687..756
e-value: 1.2E-15
score: 67.9
IPR000938CAP Gly-rich domainPFAMPF01302CAP_GLYcoord: 699..755
e-value: 1.1E-15
score: 57.4
IPR000938CAP Gly-rich domainPROSITEPS50245CAP_GLY_2coord: 709..751
score: 12.808
IPR036859CAP Gly-rich domain superfamilyGENE3DG3DSA:2.30.30.190coord: 680..761
e-value: 1.2E-17
score: 65.1
IPR036859CAP Gly-rich domain superfamilySUPERFAMILYSSF74924Cap-Gly domaincoord: 665..757