SMED30005408

Overview
NameSMED30005408
Smed IDSMED30005408
Length (bp)1226
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005408 (SMED30005408) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005408 (SMED30005408) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005408

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30005408SMESG000073939.1 SmedASXL_054069SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005408SMESG000073939.1 SmedASXL_000240SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005408 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.012846:4819..6044 -6130
Homology
BLAST of SMED30005408 vs. TrEMBL
Match: A0A1I8JM23 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.838e-21
Identity = 81/267 (30.34%), Postives = 130/267 (48.69%), Query Frame = -2
Query:  212 KSIMQKNLLFLSSAEFVFNLCNFSFVITLLML---PSTNSHFNNNTIRVKILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIFF-GFQXXXXXXXXXXXXXXXXXXINASTMTNNRRNQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISD-----FNIINLSIWIGNVLITFDSTANFVIYMATMANYR 985
            +SI++  LL LSS E + +    S  I  L+L   P    + ++   R   L+ FL+I++   N FL  RNWC+V+IA SRCEA+ RP      +         I + +L++ + F   + F+  ++ C  +G I   K+ L    FY +FY   +FF     V+ + V S++  +  +    S      +  +K T+ V  LLL F+  E+PM L   I V   + D      + +  +I + N  I  DST NFV+YM T + +R
Sbjct:   64 ESIIRLLLLMLSSTEVLASFGMTSVAIARLVLEVAPHRVGYASDEAARQ--LVRFLSITWVMANAFLLARNWCVVLIAVSRCEAVVRPFSRNTGRCCGHRTVSGIFVGILLLGLAFGIPKAFQEQYVYCAETGRIVA-KVPLYPFNFYGEFYLSSMFFQAVLPVILVSVASVAMTIGLRRHRGSGAVGGNQAHMKATRMVQLLLLVFVCMEMPMFLTVLIGV--KVPDDSQAWDSFMKYAIELSNFCINLDSTCNFVVYMKTNSTFR 325          
BLAST of SMED30005408 vs. TrEMBL
Match: A0A1I8HPQ6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 5.207e-21
Identity = 81/267 (30.34%), Postives = 129/267 (48.31%), Query Frame = -2
Query:  212 KSIMQKNLLFLSSAEFVFNLCNFSFVITLLML---PSTNSHFNNNTIRVKILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIFF-GFQXXXXXXXXXXXXXXXXXXINASTMTNNRRNQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISD-----FNIINLSIWIGNVLITFDSTANFVIYMATMANYR 985
            +SI++  LL LSS E + +    S  I  L+L   P    + ++   R   L+ FL+I++   N FL  RNWC+V+IA SRCEA+ RP      +         I   +L++ + F   + F+  ++ C  +G I   K+ L    FY +FY   +FF     V+ + V S++  +  +    S      +  +K T+ V  LLL F+  E+PM L   I V   + D      + +  +I + N  I  DST NFV+YM T + +R
Sbjct:  678 ESIIRLLLLMLSSTEVLASFGMTSVAIARLVLEVAPHRVGYASDEAARQ--LVRFLSITWVMANAFLLARNWCVVLIAVSRCEAVVRPFSRNTGRCCGHRTVSGIFAGILLLGLAFGIPKAFQEQYVYCAETGRIVA-KVPLYPFNFYGEFYLSSMFFQAVLPVILVSVASVAMTIGLRRHRGSGAVGGNQAHMKATRMVQLLLLVFVCMEMPMFLTVLIGV--KVPDDSQAWDSFMKYAIELSNFCINLDSTCNFVVYMKTNSTFR 939          
BLAST of SMED30005408 vs. TrEMBL
Match: A0A1I8IS56 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.282e-17
Identity = 87/297 (29.29%), Postives = 147/297 (49.49%), Query Frame = -2
Query:  203 LWYK---SIMQKNLLFLSSAEFVFNLCNFSFVITLLMLPSTNSHFNNNTIRV-KILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRR-RKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVI---QKMKLILDSSWFY--NKFYKI---VIFFGFQXXXXXXXXXXXXXXXXXXINAST-----------------MTNNRRNQIKVTKTVNFLLLTFIAFELPMVL--LYTIRVIGLISDFNI-INLSIWIGNVLITFDSTANFVIYMATMANYRQSL 994
            LW++   SI++  LLFLS+ E + +L   S     L+        +  +  V K  I++L++S+   N FL  RNWCIV+IA +RCE + RP      R++F+    +   + +L++S  F   + F+  +  C  +G I   Q ++   + + FY  + F++    VI  G  +V   IV+   T V  + IN ST                  +N RR+  + T+ V  LL+ F++ E+PM L  +  IR+      ++I +  ++ + N+ +  DST NF IYM T + +RQ L
Sbjct: 1068 LWHRQKESIVRILLLFLSATESLASLGMTSVQTIRLLTDILRDRVSYPSAAVAKATIDYLSVSWVIANTFLMARNWCIVLIAVTRCEVVLRPFSRHGVRRVFSHRTVLISFIGILLLSCAFGVPKAFQENYDFCSSTGRIVGVQPVEPFSNYAGFYLASMFFQAVLPVIIVGLVSVAMTIVLRRETNVGNQLINESTSQSVDQRTQSSQLHRCHCSNARRS--RATRMVQLLLVAFVSLEMPMFLTVMVGIRLPDESEFWDIFMAYAMEVTNLCLNLDSTCNFFIYMKTNSTFRQVL 1362          

HSP 2 Score: 62.003 bits (149), Expect = 1.653e-6
Identity = 42/148 (28.38%), Postives = 72/148 (48.65%), Query Frame = -2
Query:  524 LLFLSSAEFVFNLCNFSFVITLLMLPSTNSHFNNNTIRVKI-LINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIF 964
            LL LS  E + +    S     +ML   +     ++  V + L+ +LTI++   N FL  RNW IV+IA SRCEA+ RP      +  +    I +  +++++ +  A  + F+  F  C  +G++   K  +    FY++FY    F
Sbjct:  587 LLILSFNEMLTSFGMTSVETIRIMLEVAHHRIPYSSPAVPLGLVQYLTITWVTANAFLMARNWSIVLIAVSRCEAVLRPFSRNTGRCCSHRTLIVMSALIILLGLVSAVPKAFQERFHYCSDTGIVY-YKQSVSPFRFYSEFYVASTF 733          
BLAST of SMED30005408 vs. TrEMBL
Match: A0A1I8IWJ4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.666e-15
Identity = 85/304 (27.96%), Postives = 148/304 (48.68%), Query Frame = -2
Query:  149 IMQKNLLFLSSAEFVFNLCNFSFVITLLMLPSTNSHFNNNTIRVKILINFLT----ISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFII----CKHSGVIQKMKLI-------LDSSWFYNKFYKIVIFFGFQXXXXXXXXX---------XXXXXXXXXINASTMTNNRRNQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGL--ISDFNIINL-SIWIGNVLITFDSTANFVIYMATMANYRQSLKLIFCFKSNNPAYSSTMN 979
            IM++ LL LS +E V N+C  S    +L + +    F     ++    NF+T    +SF   N F+ +RNWC+V+IA SRCE +  PL  R  ++F+   T+   +++ VIS+   + R+FE+T+ +    C  +G      L+       LD+ + Y K YK ++ F  QT+ PI +IS         +      +   +       R+Q   TKTV  LL+ F+ FELP  + + +       +++   + L + +I N+L+  DS +NF++Y +T   +R +++ +        A     N
Sbjct:  372 IMRRLLLLLSLSETVLNICLASNFTVMLWVGNRQRLF-----QLPDSANFITGAFFLSFMLFNAFIMIRNWCLVMIAGSRCEVVRNPLSTRSGQLFSPNRTLGGYILLTVISLALCSPRMFEFTWTVFPKPCNATGNETSTYLLTIMTHQRLDNLYEY-KHYKTLLLFPMQTIAPIFLISFLSFLIIFTLRRRQFNQQPGSLGGGGAARSQDAATKTVMVLLICFVVFELPTFVFFVLNNTAFKKLANSRTVKLHTTFIANILVCVDSFSNFIVYSSTSNTFRDTVRRLLGLPGRKGAGVGGPN 669          
BLAST of SMED30005408 vs. TrEMBL
Match: A0A5J4N8C8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0012780 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.643e-10
Identity = 76/296 (25.68%), Postives = 140/296 (47.30%), Query Frame = -2
Query:  179 VFKKLWYKSIMQKNLLFLSSAEFVFNL---CNFSFVITLLMLPSTNSHFNNNTIRVKILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSW-----FYNKFYKIVIFFGFQXXXXXXXXXXXXXXXXXXINA-------STMTNNRRNQIKVTKTVNFLLLTFIAFELP----MVLLYTIRVIGLISDFNI-INLSIWIGNVLITFDSTANFVIYMATMANYRQSLKLIFCFKS 1006
            VF +   +S+M+ +LL LS+ E VF+L    ++   +    +P+T        +     IN  +      + FL  RNWC V+I ++R E I  PL+ RR   F   + +FI  +VL  S   + +R+F    ++C+ S  I K   +   S+      +   Y    FF +Q +LP++++   +I I   ++           +  RR+Q+  T+TV  + LTF+  ++P    ++L      +G  +  ++ +N++  I +VL+  DS  + +IY   +  +R  L   FC + 
Sbjct:   54 VFARHNRRSVMRSSLLLLSATEVVFHLFFSIDYMMRLGFCTIPTTQDSLAR--VMAAAAINLGS------DTFLCTRNWCNVLITSARTEVIVVPLRTRR--YFTRKSIVFIYALVLFSSFGLSLVRVFYEYALVCQPSVSISKQHYMEIRSFDLLPRHFADHYDAYCFFIYQVILPVLLVLSMSITIASYVSPWRQSAILEATSIRRRHQMNATRTVLLMALTFLCCQMPTFIFVILDNYTDFLGNRTGTDLTMNIAHVIADVLLLLDSVTSILIYSYKLPGFRNHL---FCLRG 336          
BLAST of SMED30005408 vs. Planmine SMEST
Match: SMESG000073939.1 (SMESG000073939.1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 368/368 (100.00%), Postives = 368/368 (100.00%), Query Frame = -2
Query:   65 MLVPYQMSENCSNYNVTFLTFYKYFTMKWENSVLXXXXXXXXXXXXXXXXXXXFVFKKLWYKSIMQKNLLFLSSAEFVFNLCNFSFVITLLMLPSTNSHFNNNTIRVKILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIFFGFQXXXXXXXXXXXXXXXXXXINASTMTNNRRNQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISDFNIINLSIWIGNVLITFDSTANFVIYMATMANYRQSLKLIFCFKSNNPAYSSTMNRIDSITQIHNPVITENQFFYSNLKNTQC 1168
            MLVPYQMSENCSNYNVTFLTFYKYFTMKWENSVLLFVVISFSFINFITSFLSIFVFKKLWYKSIMQKNLLFLSSAEFVFNLCNFSFVITLLMLPSTNSHFNNNTIRVKILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIFFGFQTVLPIIVISISTIVITKSINASTMTNNRRNQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISDFNIINLSIWIGNVLITFDSTANFVIYMATMANYRQSLKLIFCFKSNNPAYSSTMNRIDSITQIHNPVITENQFFYSNLKNTQC
Sbjct:    1 MLVPYQMSENCSNYNVTFLTFYKYFTMKWENSVLLFVVISFSFINFITSFLSIFVFKKLWYKSIMQKNLLFLSSAEFVFNLCNFSFVITLLMLPSTNSHFNNNTIRVKILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIFFGFQTVLPIIVISISTIVITKSINASTMTNNRRNQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISDFNIINLSIWIGNVLITFDSTANFVIYMATMANYRQSLKLIFCFKSNNPAYSSTMNRIDSITQIHNPVITENQFFYSNLKNTQC 368          
BLAST of SMED30005408 vs. Planmine SMEST
Match: SMESG000003710.1 (SMESG000003710.1)

HSP 1 Score: 78.5666 bits (192), Expect = 7.882e-16
Identity = 81/287 (28.22%), Postives = 140/287 (48.78%), Query Frame = -2
Query:  170 KSIMQKNLLFLSSAEFVFNLCN----FSFVITLLMLPSTNSHFNNNTIRVKILI-NFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIFFGFQXXXXXXXXXXXXXXXXXXINASTMTNN---------RRNQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISDFNIINLSIWIGNVLITFDSTANFVIYMATMANYRQSLKLIF-CFKSNNP 985
            KSIM+ +L+ LS  E +F+ CN    F   +  L +P  N          KI++  F  +    I+ F++ RNWC ++I+ASR EAI+ PL+   RK+FN    + ++     ++   + +R  +Y   +C++  +  K++  L  S    K    +++F  Q+ +P  ++   T +I   +   T +NN         RRNQ    +TV  L + F  FELP    + I V  +  D    + +  IGN ++  DS  NF++Y  ++  +R ++KL+  C K   P
Sbjct:   60 KSIMRTSLILLSVTEIMFHTCNQVNYFFLYVNSLFVPRKNWE--------KIIVAEFFGVLSLLIDVFVSSRNWCNLVISASRAEAIAFPLKT--RKLFNQSRIVMMIFFAGSMASVISFMRYLDYKLAVCQYPRLQTKLETFLTMS---TKRKIDIVYFTLQSGIPCFIVISCTGIIITVL--CTKSNNNLPNFCQQRRRNQYFAIRTVLSLAVLFSLFELPN---FVITVSSMEQD----SKTTSIGNTMVVLDSIFNFIVYTFSLPYFRMNMKLLLQCKKFREP 324          
BLAST of SMED30005408 vs. Planmine SMEST
Match: SMESG000016965.1 (SMESG000016965.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.097e-15
Identity = 69/238 (28.99%), Postives = 119/238 (50.00%), Query Frame = -2
Query:  191 ISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIFFGFQXXXXXXXXXXXXXXXXXXINAST--------------------MTNNRR------NQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISDFNIINLSI-WIGNVLITFDSTANFVIYMATMANYRQSLKLIF 823
            I FY I      RNW +VIIA SRCE I  P   RR   FN  NT  I +I+L  S   + +RLF    +IC+ + V Q    +LD   +  + +K   FF +Q+VLP++++ I ++ ++ S+  ST                    +++ R       +Q K T+T+  L + F   E+P+ ++ ++      S+ +I+ + +  + N+L+  DS +N V+Y+ T   +R  ++ IF
Sbjct:   90 IVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAY--RLFKTYCFFIYQSVLPVVIVGIVSLAMSFSLLGSTRSSSYNSTHINDCSYFRMNHLSDQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIF 325          
BLAST of SMED30005408 vs. Planmine SMEST
Match: SMESG000063918.1 (SMESG000063918.1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.303e-14
Identity = 69/232 (29.74%), Postives = 121/232 (52.16%), Query Frame = -2
Query:  191 FLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKI--VIFFGFQXXXXXXXXXXXXXXXXXXINASTMTNN-------RRN-------QIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISDFNIINLSI--WIGNVLITFDSTANFVIYMATMANYRQSLKLIF 832
            F T++F+ IN  L  RNW ++++A +R EAI RPL++R   IF+   +    +IVL++S + + IR+F    I+C++       K+I DS W  +  Y+   + +F +Q+V P+++++IST+ +   +   T  +        R N       Q K T T+  L   F   E+P   ++ I ++       + NL +   I   L+  DS  NF+IY++T  +YR+ L  +F
Sbjct:  108 FSTLTFWSINALLCSRNWMVMLVALARLEAIFRPLKIRSYSIFSSCKSRLYTIIVLLLSFSLSVIRVFYKKAIVCENEN-----KIIFDSHWKNSSLYQCFEIGYFIYQSVFPVVIVTISTLTMIYFLFKQTFKSTHLLKQYFRENETQCMTSQQKATLTITVLAGVFTVTEIP---IFIITLLKFTYPNGLSNLMVLYQITRALVVVDSCCNFLIYVSTSEHYRRDLWYLF 331          
BLAST of SMED30005408 vs. Planmine SMEST
Match: SMESG000023730.1 (SMESG000023730.1)

HSP 1 Score: 73.559 bits (179), Expect = 8.336e-14
Identity = 89/319 (27.90%), Postives = 147/319 (46.08%), Query Frame = -2
Query:  128 FKKLWYKSIMQKNLLFLSSAEFVFNLCNFSFVIT-LLMLPSTNSHFNNNTIRVKILINF-LTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKIVIFFGFQXXXXXXXXXXXXXXXXXXINASTM------TNNRRNQIKVTKTVN----------FLLLTFIAFELP-----MVLLYTIRVIGLISDFNIINLSIWIGNVLITFDSTANFVIYMATMANYRQSLKLIFCFKSNN----PAYSSTMNRIDSITQ 1003
            F K+W KSI+   L +LS+ E VFN+  F + +T  +  PS N          K+   F L I  + +   L  RNW I+ +A  R ++I RPL    +KI+   +T  +L I  +++   A  R FEY    C+ + V++    +L+  W+          +G+Q  L  I+ + + +V T  ++ S M         R++  K  KT N          F+ L F  FE P      +  Y +R   +I D     L   + N+L+  DS  N  +Y+ +   +R+ LK IF FK+ N    P  ++ + R ++I+Q
Sbjct:  291 FDKIWKKSILSILLKYLSATEIVFNISGFLYSVTKFIDYPSINQF-------SKLFWVFILQIGTFSVASGLICRNWTILHLAIYRFDSICRPLNT--KKIYTETSTYKLLWITYILAAVIAFPRTFEYKATFCEGNLVLKPS--LLNYDWYA---------YGYQGSLIFIIQTAAPVVCTSILSISVMRAILKVKRFRKSFSKTIKTKNNAISGDALMIFICLAFFLFETPSFFSKALQSYLMRNNKIIEDV----LLATVANLLVYLDSVINIFVYILSNPVFRKKLKQIFHFKAFNLKEYPTEATALERRETISQ 585          
The following BLAST results are available for this feature:
BLAST of SMED30005408 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JM232.838e-2130.34G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8HPQ65.207e-2130.34G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8IS568.282e-1729.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IWJ45.666e-1527.96G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A5J4N8C85.643e-1025.68G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of SMED30005408 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005408 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073939.10.000e+0100.00SMESG000073939.1[more]
SMESG000003710.17.882e-1628.22SMESG000003710.1[more]
SMESG000016965.11.097e-1528.99SMESG000016965.1[more]
SMESG000063918.12.303e-1429.74SMESG000063918.1[more]
SMESG000023730.18.336e-1427.90SMESG000023730.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005408 ID=SMED30005408|Name=SMED30005408|organism=Schmidtea mediterranea sexual|type=transcript|length=1226bp
AAATAACATAGTATTTTGTTTTAATTAAGTTAGGGACTCGTTTCGTTTTG
TTTTTAATTTGTCAGCATTGAGTATTTTTAAGATTGCTGTAAAAAAACTG
ATTTTCTGTAATTACCGGATTGTGAATTTGAGTAATGCTATCAATTCGGT
TCATTGTTGACGAGTAAGCTGGATTATTTGATTTAAAACAAAATATTAAT
TTAAGTGACTGCCGATAATTGGCCATTGTAGCCATGTAAATTACAAAATT
AGCGGTTGAATCAAAAGTAATAAGGACATTTCCAATCCAAATTGATAAAT
TAATGATGTTAAAGTCGGATATAAGTCCAATGACGCGAATCGTGTACAGT
AAAACCATCGGCAACTCAAATGCAATAAATGTAAGTAGCAGAAAATTGAC
GGTTTTAGTGACTTTTATTTGATTTCTTCTATTATTTGTCATTGTGCTGG
CATTTATAGATTTGGTGATAACAATTGTACTAATAGAAATAACAATGATA
GGCAAAACCGTTTGAAATCCGAAAAAGATAACAATTTTATAGAATTTATT
ATAAAACCAAGAACTGTCGAGAATAAGTTTCATTTTTTGAATTACTCCCG
AATGTTTGCAGATGATAAAAGTGTATTCAAACAAACGAATTGTTGCAAAT
GTAATTGAGATGACAAGAACGATCATCAGAATGAAAATTGTGTTAAAGAA
ATTGAAAATCTTTCGTCTGCGGACTTGCAACGGTCGACTGATTGCCTCAC
AACGACTGGCGGCAATAATCACAATGCACCAATTTCTAACAGTTAAAAAG
CAATTAATAAAATAAAATGAAATCGTCAGGAAATTAATTAAAATCTTCAC
TCTGATTGTGTTATTGTTAAAATGACTGTTTGTTGACGGTAACATCAACA
GGGTGATAACAAAAGAAAAATTGCACAAATTGAATACGAATTCCGCCGAG
GAAAGAAACAATAGATTCTTTTGCATTATGCTTTTGTACCATAATTTCTT
GAACACAAAAATCGAAAGAAAACTTGTTATAAAATTTATGAAACTGAAAC
TTATAACGACGAACAATAGAACCGAATTCTCCCATTTCATGGTGAAGTAT
TTGTAAAATGTTAAAAATGTGACATTGTAATTGGAACAATTCTCACTCAT
TTGATACGGAACGAGCATGATGGATTTTGAATTTCAAGAGTAAAAATACA
AATCTTTGTAAGAAAATATTTTGAAA
back to top

protein sequence of SMED30005408-orf-1

>SMED30005408-orf-1 ID=SMED30005408-orf-1|Name=SMED30005408-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
MLVPYQMSENCSNYNVTFLTFYKYFTMKWENSVLLFVVISFSFINFITSF
LSIFVFKKLWYKSIMQKNLLFLSSAEFVFNLCNFSFVITLLMLPSTNSHF
NNNTIRVKILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVR
RRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLIL
DSSWFYNKFYKIVIFFGFQTVLPIIVISISTIVITKSINASTMTNNRRNQ
IKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISDFNIINLSIWIGNVLI
TFDSTANFVIYMATMANYRQSLKLIFCFKSNNPAYSSTMNRIDSITQIHN
PVITENQFFYSNLKNTQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR0194277TM_GPCR_serpentine_rcpt_Srw
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0008528G-protein coupled peptide receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 7..333
e-value: 5.2E-22
score: 80.1
NoneNo IPR availablePANTHERPTHR47323FAMILY NOT NAMEDcoord: 32..340
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 33..322
e-value: 2.73226E-12
score: 64.5764
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 4..332
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
NoneNo IPR availableTMHMMTMhelixcoord: 154..176
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
NoneNo IPR availableTMHMMTMhelixcoord: 212..234
NoneNo IPR availableTMHMMTMhelixcoord: 289..311
NoneNo IPR availableTMHMMTMhelixcoord: 257..279
NoneNo IPR availableTMHMMTMhelixcoord: 34..56
IPR0194277TM GPCR, serpentine receptor class w (Srw)PFAMPF103247TM_GPCR_Srwcoord: 127..329
e-value: 2.6E-6
score: 26.9
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 30..311
score: 16.5