RanBP-type and C3HC4-type zinc finger containing 1

Overview
NameRanBP-type and C3HC4-type zinc finger containing 1
Smed IDSMED30005404
Length (bp)1702
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RanBP-type and C3HC4-type zinc finger containing 1 (SMED30005404) t-SNE clustered cells

Violin plots show distribution of expression levels for RanBP-type and C3HC4-type zinc finger containing 1 (SMED30005404) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RanBP-type and C3HC4-type zinc finger containing 1 (SMED30005404) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RanBP-type and C3HC4-type zinc finger containing 1 (SMED30005404) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005404

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005404h1SMcG0021908 dd_Smed_v4_1293_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005404h1SMcG0021908 dd_Smed_v4_1293_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005404h1SMcG0021908 dd_Smed_v4_1293_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 276.559 bits (706), Expect = 1.184e-85
Identity = 174/498 (34.94%), Postives = 272/498 (54.62%), Query Frame = 1
Query:  100 LFLFEQSFKNKFYLMSSNNNQNAVKLYVFVDNLQ------YTSERP-LTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANR------YKNVDQEHRWN-EPIKSIMIIADVVDVSKPQ-----PVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            ++L EQ       L    +    ++L+V V++ Q      + + RP +TV   K   F D          +    Q WV+ +    D     E +      + G  A+L++LS    +  P+        R      +K++  + R   EP      +       +P      P VGW C  CTF NKP    C++C  +RPE + +P +Y   ++++ R+  ++E   + ++ +++ ++        N  +  ++ + S+ L TE  ECP+C +   PG A+VL  CLH  C+EC +  I NSQ+  + C F +N   C G + ++EI+ +L  E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C   NCLLC AIHE   CKEYQ++LA++A+ND AA++    L+ ++  G+AM+CP CQI+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:   32 IWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYG--------FPPVLQQWVIGQRLARD----QETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQE-------GNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 510          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 272.322 bits (695), Expect = 1.780e-84
Identity = 170/483 (35.20%), Postives = 268/483 (55.49%), Query Frame = 1
Query:  145 SSNNNQNAVKLYVFVDNLQ------YTSERP-LTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANR------YKNVDQEHRWN-EPIKSIMIIADVVDVSKPQ-----PVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            + +  ++  +L+V V++ Q      + + RP +TV   K   F D          +    Q WV+ +    D     E +      + G  A+L++LS    +  P+        R      +K++  + R   EP      +       +P      P VGW C  CTF NKP    C++C  +RPE + +P +Y   ++++ R+  ++E   + ++ +++ ++        N  +  ++ + S+ L TE  ECP+C +   PG A+VL  CLH  C+EC +  I NSQ+  + C F +N   C G + ++EI+ +L  E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C   NCLLC AIHE   CKEYQ++LA++A+ND AA++    L+ ++  G+AM+CP CQI+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:    5 TPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYG--------FPPVLQQWVIGQRLARD----QETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQE-------GNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 468          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 203.371 bits (516), Expect = 1.016e-59
Identity = 104/205 (50.73%), Postives = 146/205 (71.22%), Query Frame = 1
Query:  922 KECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            +EC +  I NSQ+  + C F +N   C G + ++EI+ +L  E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C   NCLLC AIHE   CKEYQ++LA++A+ND AA++    L+ ++  G+AM+CP CQI+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:  136 RECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 340          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 203.371 bits (516), Expect = 1.016e-59
Identity = 104/205 (50.73%), Postives = 146/205 (71.22%), Query Frame = 1
Query:  922 KECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            +EC +  I NSQ+  + C F +N   C G + ++EI+ +L  E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C   NCLLC AIHE   CKEYQ++LA++A+ND AA++    L+ ++  G+AM+CP CQI+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:  136 RECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 340          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RNF19B (ring finger protein 19B [Source:HGNC Symbol;Acc:HGNC:26886])

HSP 1 Score: 66.6254 bits (161), Expect = 8.354e-11
Identity = 60/215 (27.91%), Postives = 85/215 (39.53%), Query Frame = 1
Query:  817 ESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEF-ERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCP-------LCKQNNCLLCSAI-HENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQ--IIVQKKSGCDWMQCNMCKTEICW 1416
            E      E+VECP+C     P  A  L +C H  C++C R Y    I+ S+ P I C E  C   +   +IR +L D     +Y++  LR   +   +   C  P+C   V+         CP        C+   C  C  I H NQTC   + + A   R        +++ Q          CP C   II      C+ M C +C  E CW
Sbjct:  108 EGGGPGAEEVECPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVP-ISCPE--CSERLNPHDIRLLLADPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIA---YGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCW 316          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Celegans
Match: F56D2.5 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:Q20871])

HSP 1 Score: 65.4698 bits (158), Expect = 3.741e-11
Identity = 57/215 (26.51%), Postives = 90/215 (41.86%), Query Frame = 1
Query:  847 ECPICETDCEPGTAIVLHNCLHAICKEC-FRDYINNSQDPLIK---CFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNC--VAWVVYDDDVNFFPCPLCKQNNCLLC-SAIHENQTCK--EYQDELAIKARN--DEAAKKDI----------AFLQNLIDTG----QAMKCPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            +C +C         I    C H  CK C F  YI+ ++  + K   C  E C    +   ++E L +E F +Y+   L  A  +  ++  C   NC  VA++  D   N   C  C  + C LC    H    CK  +  +E  +K  N  DEA K+++          A  +  ++ G     + +CP C + ++K  GC+ M C  C    CW
Sbjct:  183 DCQVCFESQMGQHCIKFQPCSHVFCKSCTFNYYISIAKGFVSKPMSCLAEGCENEAQQGMVQEALGEELFAKYEAHMLEKAIREMDDSMECPNENCQMVAYLT-DSQRNLVECSYCNYSFCNLCKGTFHGVSRCKFRKEDEERIMKEWNEADEAGKEEMYKRYGEKNMKALEERFLNRGWLEENSKQCPKCLVYIEKDEGCNKMHCTKCNASFCW 396          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Celegans
Match: Y57A10A.31 (pep chromosome:WBcel235:II:12289385:12300573:1 gene:WBGene00013270.1 transcript:Y57A10A.31.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57A10A.31)

HSP 1 Score: 61.2326 bits (147), Expect = 1.774e-9
Identity = 53/209 (25.36%), Postives = 88/209 (42.11%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPL---IKCFEENCVGFIEDQEIREV-------LNDEEFERYQQLSLRAAE---SKTGNTFHCKTPNCVAWVVYDDD---VNFFPCPLCKQNNCLLCSA-IHENQTCKEYQDELAIKARNDEAAK--KDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWA 1419
            CPIC  +           C H +C+ C    I +  D     I+C  + C   +   EI  +       + + + ++ ++L+ RA +       +   C + +CV  +   DD     F  C  C ++ C  C A  H + TC+E+     I+   D  A+  KD+          +  KCP C ++V+K+ GC+ MQC  C T  CW 
Sbjct:  804 CPICTAETGISNDFYRLECGHVMCRTCINTQIRSRIDEQQFNIRCEIDGCHRVLTPAEIMNIILGGSDRMKELDTQKLRRLTDRAKQLLIQTNEDLAACPSADCVGILSKSDDGLISEFKKCEACDRSYCRKCLAEPHPDDTCEEFA---RIRRPEDSIARYQKDMG--------SRVKKCPKCAVLVEKREGCNHMQCG-CGTHYCWT 1000          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 60.4622 bits (145), Expect = 2.756e-9
Identity = 57/208 (27.40%), Postives = 86/208 (41.35%), Query Frame = 1
Query:  847 ECPICETDCEPGTAIV-LHNCLHAICKECFRDYINNS-QDPLIKCFEENCVGFIEDQEIREVLND--EEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNC--LLC----SAIHENQTCKEYQDELAIKARN---DEAAKKDIAFLQNLIDT---GQAMKCPGCQ--IIVQKKSGCDWMQCNMCKTEICW 1416
            ECP+C     PG+A   L  C H  C+ C R Y+  S  +  ++     C  ++   +I+ ++ D     E+Y+  SLR       +   C  P+C  +V         P   C++ +C  L C       H NQTC E +     K+R    +E  +    F Q+   T   G    CP C+  I+      C+ M C MC  E CW
Sbjct:   54 ECPLCAAKM-PGSAFPKLKGCQHRSCRACLRQYVELSITENRVEVPCPECSSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDC-GFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMR--TGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHMVCTMCNAEFCW 257          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 60.4622 bits (145), Expect = 2.756e-9
Identity = 57/208 (27.40%), Postives = 86/208 (41.35%), Query Frame = 1
Query:  847 ECPICETDCEPGTAIV-LHNCLHAICKECFRDYINNS-QDPLIKCFEENCVGFIEDQEIREVLND--EEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNC--LLC----SAIHENQTCKEYQDELAIKARN---DEAAKKDIAFLQNLIDT---GQAMKCPGCQ--IIVQKKSGCDWMQCNMCKTEICW 1416
            ECP+C     PG+A   L  C H  C+ C R Y+  S  +  ++     C  ++   +I+ ++ D     E+Y+  SLR       +   C  P+C  +V         P   C++ +C  L C       H NQTC E +     K+R    +E  +    F Q+   T   G    CP C+  I+      C+ M C MC  E CW
Sbjct:   54 ECPLCAAKM-PGSAFPKLKGCQHRSCRACLRQYVELSITENRVEVPCPECSSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDC-GFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMR--TGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHMVCTMCNAEFCW 257          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 60.077 bits (144), Expect = 2.877e-9
Identity = 57/208 (27.40%), Postives = 86/208 (41.35%), Query Frame = 1
Query:  847 ECPICETDCEPGTAIV-LHNCLHAICKECFRDYINNS-QDPLIKCFEENCVGFIEDQEIREVLND--EEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNC--LLC----SAIHENQTCKEYQDELAIKARN---DEAAKKDIAFLQNLIDT---GQAMKCPGCQ--IIVQKKSGCDWMQCNMCKTEICW 1416
            ECP+C     PG+A   L  C H  C+ C R Y+  S  +  ++     C  ++   +I+ ++ D     E+Y+  SLR       +   C  P+C  +V         P   C++ +C  L C       H NQTC E +     K+R    +E  +    F Q+   T   G    CP C+  I+      C+ M C MC  E CW
Sbjct:   84 ECPLCAAKM-PGSAFPKLKGCQHRSCRACLRQYVELSITENRVEVPCPECSSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDC-GFVFIATKCAACPQLKCQRPDCGTLFCYHCKREWHSNQTCDEARRPEKRKSRGLAFEEIMR--TGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHMVCTMCNAEFCW 287          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Match: ari-2 (gene:FBgn0025186 transcript:FBtr0071774)

HSP 1 Score: 56.225 bits (134), Expect = 4.763e-8
Identity = 59/221 (26.70%), Postives = 82/221 (37.10%), Query Frame = 1
Query:  817 ESIALATEQVE---CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENC-VGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDD-DVNFFPCPLCKQNNCLLCSA-IHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKG 1449
            ++ A AT Q     CP+C +  + G       C H+ CK+C+  Y    I       I C  + C V   ED  +  V      ++YQQ + +           C  PNC   V   +       C  C    C  C    H    C+  +  L   A + E A        N I +     CP C I ++K  GC+ MQC  CK + CW   G  W   G
Sbjct:  139 KTTASATPQYRSQMCPVCASS-QLGDKFYSLACGHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQSSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETA--------NYI-SAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCLGD-WKTHG 348          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Match: CG12362 (gene:FBgn0036082 transcript:FBtr0076281)

HSP 1 Score: 51.2174 bits (121), Expect = 2.126e-6
Identity = 56/212 (26.42%), Postives = 79/212 (37.26%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQ-----DPLIKCFEENCVGFIEDQEIREVLNDEEF-ERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHEN-QTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMK-CPGCQIIVQKKSGCDWMQCN--MCKTEICWATKGPRWGPKGKG 1455
            C IC   C+    +    C H  C  C++ Y+ N          IKC   NC   ++     ++ +D E  ERYQQL              C  PNC   V            +C +   +LC   HE    C E   E A  +   +  KK +   +      Q  K CP C + ++K  GC+ M C    C+ + CW   G  W P G  
Sbjct:  140 CGICFCSCDELIGL---GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVK----------AVCAEPRAVLCKCGHEFCFACGENWHEPASCSSLKKWVKKCLEDSETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGS-WEPHGSS 337          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Match: CG12362 (gene:FBgn0036082 transcript:FBtr0076282)

HSP 1 Score: 51.2174 bits (121), Expect = 2.126e-6
Identity = 56/212 (26.42%), Postives = 79/212 (37.26%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQ-----DPLIKCFEENCVGFIEDQEIREVLNDEEF-ERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHEN-QTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMK-CPGCQIIVQKKSGCDWMQCN--MCKTEICWATKGPRWGPKGKG 1455
            C IC   C+    +    C H  C  C++ Y+ N          IKC   NC   ++     ++ +D E  ERYQQL              C  PNC   V            +C +   +LC   HE    C E   E A  +   +  KK +   +      Q  K CP C + ++K  GC+ M C    C+ + CW   G  W P G  
Sbjct:  140 CGICFCSCDELIGL---GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVK----------AVCAEPRAVLCKCGHEFCFACGENWHEPASCSSLKKWVKKCLEDSETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGS-WEPHGSS 337          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:ZFIN;Acc:ZDB-GENE-040704-3])

HSP 1 Score: 296.204 bits (757), Expect = 2.355e-93
Identity = 167/464 (35.99%), Postives = 256/464 (55.17%), Query Frame = 1
Query:  157 NQNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQE--HRWNEPIKSIMIIADVVDVSKPQP--VVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            +Q+ ++L V V + +     P+TV++  Y +  +LK +      +    Q WV+ K    D     E +           AFLFI S +      E        R  +V  E   R  +     +   +      P+P  + GW C  CT+ NKP    C++C  +RP+N+ +P  Y   + +  R+++++    + ++   + ++R   E+  N E+L +    S+   T+Q+EC IC     PG   VL  CLH+ C++C +  + N  D  + C + +N   C   ++D+EI+ +L  +E++++ +L L  AES++ N++HCKTP+C  W +++DDVN F C +C + NCLLC AIH+   CKEYQD+L ++A+NDEAA++    L  L+  G+AM CP CQ+IVQKK GCDW+ C MCKTEICW TK  RWGP G GD SGGC+CRV G  C P C NCH
Sbjct:   56 SQDNIRLRVGVADAESEHHIPITVMVPVYMTISELKEKINGDYGFHPSLQRWVIGKRLAQD----KETLYFYGIRNHDDSAFLFIRSAQSVNLRREQERREKEERQIDVIMETIERPLQRPPERITRGNTRPALPPKPKFLDGWACPQCTYLNKPTRPGCEMCSTARPDNYQVPDLYQPDESETRRLQQEELASLQYEQSLLQEEERNFLERQRNYEELLQTDAHSLVGNTDQLECAICFGTIMPGEGAVLRECLHSFCRDCLKGTVVNCLDAEVCCPYGDNAYACNCKLQDREIKSLLTQDEYQKFLELRLNIAESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLCKAIHKGMNCKEYQDDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGAGDTSGGCKCRVNGVLCHPQCQNCH 515          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:ZFIN;Acc:ZDB-GENE-040704-3])

HSP 1 Score: 296.204 bits (757), Expect = 2.355e-93
Identity = 167/464 (35.99%), Postives = 256/464 (55.17%), Query Frame = 1
Query:  157 NQNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQE--HRWNEPIKSIMIIADVVDVSKPQP--VVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            +Q+ ++L V V + +     P+TV++  Y +  +LK +      +    Q WV+ K    D     E +           AFLFI S +      E        R  +V  E   R  +     +   +      P+P  + GW C  CT+ NKP    C++C  +RP+N+ +P  Y   + +  R+++++    + ++   + ++R   E+  N E+L +    S+   T+Q+EC IC     PG   VL  CLH+ C++C +  + N  D  + C + +N   C   ++D+EI+ +L  +E++++ +L L  AES++ N++HCKTP+C  W +++DDVN F C +C + NCLLC AIH+   CKEYQD+L ++A+NDEAA++    L  L+  G+AM CP CQ+IVQKK GCDW+ C MCKTEICW TK  RWGP G GD SGGC+CRV G  C P C NCH
Sbjct:   56 SQDNIRLRVGVADAESEHHIPITVMVPVYMTISELKEKINGDYGFHPSLQRWVIGKRLAQD----KETLYFYGIRNHDDSAFLFIRSAQSVNLRREQERREKEERQIDVIMETIERPLQRPPERITRGNTRPALPPKPKFLDGWACPQCTYLNKPTRPGCEMCSTARPDNYQVPDLYQPDESETRRLQQEELASLQYEQSLLQEEERNFLERQRNYEELLQTDAHSLVGNTDQLECAICFGTIMPGEGAVLRECLHSFCRDCLKGTVVNCLDAEVCCPYGDNAYACNCKLQDREIKSLLTQDEYQKFLELRLNIAESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLCKAIHKGMNCKEYQDDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGAGDTSGGCKCRVNGVLCHPQCQNCH 515          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: shrprbck1r (sharpin and rbck1 related [Source:NCBI gene;Acc:569903])

HSP 1 Score: 287.73 bits (735), Expect = 6.340e-88
Identity = 167/490 (34.08%), Postives = 251/490 (51.22%), Query Frame = 1
Query:  220 LTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILS-----------------------------QEEKANIPEYFG------SFLANRYKNVDQEHRWNEPIKSIMIIADVVDV----------------SKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEEN----CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRV-RGKCTPTCGNCH 1521
            ++V +  + +   LK +      +    Q WV+ ++ C D   ++    +    + G  AFL+++S                             QE  +N P          S L  R  N       N      + ++D+ D+                +  QP  GW C +CT+ NKP    C++C   RPE + +P NY     +  RI+++KE   + +       Q  E E+ EN  +L +M  + +    E+VEC IC  + E G  ++L  CLH  CKEC R  I  S+DP + C   +    C   ++++EIR +++ ++++ + Q  L  AES+   ++HC T +C  W VY+D VN F CP+CK+ NCLLC AIHE   CK+YQD+L  +A ND AA++    L+ L+++G+AM CP C IIVQKK GCDW++C +C TEICW T+GPRWGPKG GD SGGC+C V + +C P C NCH
Sbjct:  238 VSVKVFPHSTIGALKQQVFSDYGFHPRVQRWVIGQSLCSDHRSLASYGVQ----RDGDTAFLYLISARQARLSRGIYQQDQESALLMVPTTHQAHQEAVSNGPAALNTASRPYSTLPTRLHNSHNTLSNNAGGSERLGLSDIRDLINLELPQLNEALGPNRTSIQP--GWACPTCTYINKPTRPGCEMCSADRPEGYTVPGNYRPDALELRRIQQEKEAIRQYQ-------QARETERRENFARLVQMDGQDLVPNPERVECRICYVELESGEGVLLRECLHCFCKECLRSVILMSEDPQVACPYRDESYACDCVLQEREIRALVSVDDYQHWLQRGLSVAESRCEGSYHCATADCPGWCVYEDTVNTFHCPVCKKQNCLLCKAIHEGMNCKQYQDDLTARAINDSAARRTRDLLKTLVNSGEAMHCPQCGIIVQKKEGCDWLRCTVCHTEICWVTRGPRWGPKGPGDISGGCRCNVNKQRCHPKCQNCH 714          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:ZFIN;Acc:ZDB-GENE-040704-3])

HSP 1 Score: 204.527 bits (519), Expect = 1.422e-62
Identity = 90/167 (53.89%), Postives = 121/167 (72.46%), Query Frame = 1
Query: 1012 EIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTC 1509
            +  ++L  +E++++ +L L  AES++ N++HCKTP+C  W +++DDVN F C +C + NCLLC AIH+   CKEYQD+L ++A+NDEAA++    L  L+  G+AM CP CQ+IVQKK GCDW+ C MCKTEICW TK  RWGP G GD SGGC+CRV G  C P C
Sbjct:    7 QYEQLLTQDEYQKFLELRLNIAESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLCKAIHKGMNCKEYQDDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGAGDTSGGCKCRVNGVLCHPQC 173          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: zmp:0000000524 (zmp:0000000524 [Source:ZFIN;Acc:ZDB-GENE-130530-527])

HSP 1 Score: 87.0409 bits (214), Expect = 5.164e-18
Identity = 54/199 (27.14%), Postives = 91/199 (45.73%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAI-HENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGP 1431
            C IC T+    + ++ + C H  CK C +DY    I + +   + C E  C       +++ +++ E F RY +L L+ + +   +  +C   +C   V+ + D     CP CK   C LC+ + H    C E Q E     R +   K+D  +++       + +CP C + +QK  GCD M C+ C+   CW    P
Sbjct:  163 CGICFTENLGSSFVLFNECQHVYCKTCVKDYFEIQIKDGKVQFLSCPEAECTSLATPAQVKLLVSQEVFARYDRLLLQWSLNLMTDVVYCPRKSCGMAVMLEPDRTMGICPSCKFVFCTLCNRVYHALALCNEIQRE---NERRENQRKEDEVWVKQ-----NSKQCPTCGVKIQKDMGCDMMTCSSCQQFFCWTCVSP 353          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000033448.1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:100491300])

HSP 1 Score: 249.21 bits (635), Expect = 4.063e-78
Identity = 114/233 (48.93%), Postives = 159/233 (68.24%), Query Frame = 1
Query:  838 EQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            E ++C IC ++   G  ++L  CLH+ C+EC R  +N  ++P + C F +    C   ++ +EIR ++  EE+ R+ +  L  AES++ +++HC+T +C  W VY+D VN F CP+C   NCL C AIH+   C+EYQD+L I+A+ND AA++    L+ L+ TG+AM CP CQIIVQKK GCDW++C MC+TEICW TKGPRWGP+G GD SGGCQC + G KC P C NCH
Sbjct:   50 EPIDCLICFSEVPVGGGVLLRECLHSFCRECLRQLVNCCEEPEVSCPFRDETYACNSKLQQREIRALVAQEEYSRFLERGLVVAESRSHDSYHCRTADCRGWCVYEDSVNEFTCPICHAQNCLTCKAIHDGMNCREYQDDLRIRAQNDAAARQTNDMLKTLVQTGEAMYCPVCQIIVQKKDGCDWIRCTMCQTEICWVTKGPRWGPQGPGDTSGGCQCNINGKKCDPRCQNCH 282          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000029029.1 (ring finger protein 14 gene 4 [Source:NCBI gene;Acc:100485068])

HSP 1 Score: 78.1814 bits (191), Expect = 9.503e-15
Identity = 56/211 (26.54%), Postives = 87/211 (41.23%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCS-AIHENQTCKEYQDELAI----KARNDEAAKKDIA--FLQNLIDTGQAMK-----------CPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            C IC ++          +C H  C  C +DY    I + Q   + C E  C       +++ ++ +E F RY +L L+++     +  +C  PNC    + +       C  CK   C LC  A H    C   Q++L +        DEA KK +   + +N+I     MK           CP C++ ++K  GC  M C  CK   CW
Sbjct:  214 CNICFSEKLGSECTHFKDCQHVYCNACLKDYYTVQIQDGQVQALNCPEPKCSSVATPAQVKLLVGEEFFSRYDRLLLQSSLDLMADVVYCPRPNCRTPFILEPGAKMGICSSCKYAFCTLCKLAYHAVAYCNITQEKLLLVREEYLEADEAGKKLLEKRYGKNVIVKAVEMKSFEWVEKNSKRCPNCRVNIEKSGGCFVMFCTACKENFCW 424          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000012890.1 (ring finger protein 14 gene 4 [Source:NCBI gene;Acc:100485068])

HSP 1 Score: 77.0258 bits (188), Expect = 2.195e-14
Identity = 56/211 (26.54%), Postives = 86/211 (40.76%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCS-AIHENQTCKEYQDELAI----KARNDEAAKKDI--AFLQNLIDTGQAMK-----------CPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            C IC ++           C H  C  C +DY    I + Q   + C E  C       +++ ++ +E F RY +L L+++     +  +C  PNC    + +       C  CK   C LC  A H    C   Q++L +        DEA KK +   + +N+I     MK           CP C++ ++K  GC  M C  CK   CW
Sbjct:  214 CNICFSEKVGSECTHFKKCEHIYCNACLKDYYTVQIQDGQVQALNCPEPKCSSVATPAQVKLLVGEEFFSRYDRLLLQSSLDLMADVVYCPRPNCRTPFILEPGAKMGICSSCKYAFCTLCKLAYHAVAYCNITQEKLLLVREEYLEADEAGKKLLEKRYGKNVIVKAVEMKSFEWVEKNSKRCPNCRVNIEKSGGCFVMFCTACKENFCW 424          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000012882.1 (ring finger protein 14 gene 4 [Source:NCBI gene;Acc:100485068])

HSP 1 Score: 71.633 bits (174), Expect = 1.170e-12
Identity = 52/216 (24.07%), Postives = 85/216 (39.35%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARN-----DEAAKKDIA------FLQNLIDTGQ--------AMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKG 1428
            C IC ++          +C H  C  C +DY    I + Q   + C E  C       +++ ++ +E F RY +L L+++     +  +C  PNC   V+ +       C  C    C LC   +   +  +   E  +  RN     DEA K+ +        +Q  ++  +        A  CP C   +QK  GC+ + C  CK   CW   G
Sbjct:  214 CNICFSEKLGSECTHFKDCQHVYCNACLKDYYTVQIQDGQVQALNCPEPKCSSVATPAQVKLLVGEELFSRYDRLLLQSSLDLMADVVYCPRPNCQTPVMLEPGGTMGICSNCNYAFCTLCKMTYHGVSACKLSAEKLMALRNEYLEADEAGKQFMEKRYGKRMIQKALEEMESKEWLEENAKSCPRCGTNIQKTEGCNKLTCTGCKQYFCWLCLG 429          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Xenopus
Match: znf347 (zinc finger protein 347 [Source:Xenbase;Acc:XB-GENE-6039618])

HSP 1 Score: 70.8626 bits (172), Expect = 2.222e-12
Identity = 54/211 (25.59%), Postives = 84/211 (39.81%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCS-AIHENQTCKEYQDELAI----KARNDEAAKKDI--AFLQNLIDTGQAM-----------KCPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            C IC ++           C H  C  C +DY    I + Q   + C E  C       +++ ++ +E F RY +L L+++     +  +C  PNC   V+ +       C  CK   C LC  A H    C    ++L +        D A KK +   + +N+I     M           +CP C+  V+K  GC+ M C  C    CW
Sbjct:  214 CDICFSEKVGSECTHFKKCEHIYCNACLKDYYTVQIQDGQVQALNCPEPKCSSVATPAQVKLLVGEELFSRYDRLLLQSSLDLMADVVYCPRPNCRTPVMLEPGGEMGICSSCKYAFCTLCKLAYHAVAYCNITSEKLLLVRDEYLEADAAGKKLLERRYGKNVIVKAVEMRSFEWLEKNSKRCPSCRANVEKIDGCNRMFCTRCNKNFCW 424          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Match: Rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:MGI Symbol;Acc:MGI:1344372])

HSP 1 Score: 277.33 bits (708), Expect = 3.296e-86
Identity = 157/423 (37.12%), Postives = 247/423 (58.39%), Query Frame = 1
Query:  304 QHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANR------YKNVDQEHRWNEPIKSIMIIADV------VDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC----FEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            Q WV+ +    D     E +      + G  A+L++LS    +  P+        R      +K++  + R   P++ ++            D +   P VGW C  CTF NKP    C++C  +RPE + IP +Y   ++++ R+  ++E   + ++ +++ ++        N  +  ++ + S+ L TE  ECP+C +   PG A+VL  CLH  C+EC +  I NSQ+  + C       +C G + ++EIR +L+ E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C + NCLLC AIHE+  C+EYQD+LA++A+ND AA++    L+ ++  G+AM CP C+I+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:   99 QQWVVGQRLARD----QETLHSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRG--PLEPVLPKPRTNQEPGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQRKQQQQE-------GNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 508          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Match: Rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:MGI Symbol;Acc:MGI:1344372])

HSP 1 Score: 277.33 bits (708), Expect = 3.296e-86
Identity = 157/423 (37.12%), Postives = 247/423 (58.39%), Query Frame = 1
Query:  304 QHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANR------YKNVDQEHRWNEPIKSIMIIADV------VDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC----FEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            Q WV+ +    D     E +      + G  A+L++LS    +  P+        R      +K++  + R   P++ ++            D +   P VGW C  CTF NKP    C++C  +RPE + IP +Y   ++++ R+  ++E   + ++ +++ ++        N  +  ++ + S+ L TE  ECP+C +   PG A+VL  CLH  C+EC +  I NSQ+  + C       +C G + ++EIR +L+ E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C + NCLLC AIHE+  C+EYQD+LA++A+ND AA++    L+ ++  G+AM CP C+I+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:   99 QQWVVGQRLARD----QETLHSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRG--PLEPVLPKPRTNQEPGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQRKQQQQE-------GNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 508          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Match: Rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:MGI Symbol;Acc:MGI:1344372])

HSP 1 Score: 116.701 bits (291), Expect = 3.428e-29
Identity = 62/183 (33.88%), Postives = 93/183 (50.82%), Query Frame = 1
Query:  814 KESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC----FEENCVGFIEDQEIREV---------------------------------------LNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKE 1233
            + S+ L TE  ECP+C +   PG A+VL  CLH  C+EC +  I NSQ+  + C       +C G + ++EIR V                                       L+ E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C + NCLLC AIHE+  C+E
Sbjct:   51 QRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRAVGEEELGTGLKCLVSWDHLIGGGHLLGVLNPSSKAVYVQLLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCRE 233          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Match: Rnf14 (ring finger protein 14 [Source:MGI Symbol;Acc:MGI:1929668])

HSP 1 Score: 63.929 bits (154), Expect = 1.601e-10
Identity = 52/216 (24.07%), Postives = 82/216 (37.96%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARN-----DEAAKKDI------AFLQNLIDTGQ--------AMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKG 1428
            C IC  +      +    C H  CK C +DY    I + Q   + C E  C       +++E++  + F RY +L L++      +  +C  P C   V+ +       C  C    C LC   +   +  +   E  I  RN     DEA K+ +        +Q  ++  +        +  CP C   +QK  GC+ M C  C    CW   G
Sbjct:   95 CSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMG 310          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Match: Rnf14 (ring finger protein 14 [Source:MGI Symbol;Acc:MGI:1929668])

HSP 1 Score: 63.929 bits (154), Expect = 2.954e-10
Identity = 52/216 (24.07%), Postives = 82/216 (37.96%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARN-----DEAAKKDI------AFLQNLIDTGQ--------AMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKG 1428
            C IC  +      +    C H  CK C +DY    I + Q   + C E  C       +++E++  + F RY +L L++      +  +C  P C   V+ +       C  C    C LC   +   +  +   E  I  RN     DEA K+ +        +Q  ++  +        +  CP C   +QK  GC+ M C  C    CW   G
Sbjct:  221 CSICFCEKLGSDCMYFLECKHVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQSTLDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLIDLRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNKMTCTGCMQYFCWICMG 436          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|E6ZIJ1|HOIL1_DICLA (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Dicentrarchus labrax OX=13489 GN=rbck1 PE=3 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 1.372e-92
Identity = 169/481 (35.14%), Postives = 256/481 (53.22%), Query Frame = 1
Query:  220 LTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYF----------------------GSFLANRYKNVDQEHRWNEPIK----------SIMIIADVVDVSKPQ----------PVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEEN----CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            +TV +  + +   LK +   +  +    Q WV+ +  C D   ++         + G  AFL++LS        +                         +  AN   ++DQ      P +          +I  I D++++  PQ             GW+C SCT+ NKP    C++C  +RPEN++IP  Y   + +  RI+++KE   + +       Q  E+E+ EN  +L  M  + +    E V+C IC  D +PG  ++L  CLH  C+EC R  I  S++P + C   +    C   ++++EIR ++  EE+ER+ Q  L  AES+   ++HC TP+C+ W VY+D VN F CP+C+++NCL+C +IHE   CK+YQD+LA +A ND AA++    L+ L+ +G+AM CP C IIVQK+ GCDW++C +C TEICW T+GPRWGPKG GD SGGC+C V   KC P C NCH
Sbjct:  238 VTVKVFPHMTTAALKQQMFLEYGFHPRVQRWVIGQCLCTDQRSLASYGV----HQDGDTAFLYLLSARHARLTLQVLQQDQESALLLSSPSLSLPTPPLPATSANGPSSLDQRPYTTLPPRLHTSSSTERRNISEIKDLINLEMPQLNEALSPNTASTQGWSCPSCTYINKPTRPGCEICSTNRPENYIIPGGYRPDQLELRRIQQEKEAIRQYQ-------QAREEERRENFARLVMMDSQDLLPNPEPVDCRICYMDLQPGEGVLLRECLHCFCRECLRSVIMLSEEPEVSCPYRDDTYSCACSLQEREIRALVPAEEYERWLQRGLSVAESRCEGSYHCATPDCLGWCVYEDTVNVFHCPVCRKHNCLICKSIHEGMNCKQYQDDLAARAINDSAARRTTQLLKTLVQSGEAMHCPQCGIIVQKRDGCDWLRCTVCHTEICWVTRGPRWGPKGPGDTSGGCRCNVNNQKCHPKCQNCH 707          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|A9JTG5|HOIL1_DANRE (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=rbck1 PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 4.786e-87
Identity = 167/490 (34.08%), Postives = 251/490 (51.22%), Query Frame = 1
Query:  220 LTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILS-----------------------------QEEKANIPEYFG------SFLANRYKNVDQEHRWNEPIKSIMIIADVVDV----------------SKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEEN----CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRV-RGKCTPTCGNCH 1521
            ++V +  + +   LK +      +    Q WV+ ++ C D   ++    +    + G  AFL+++S                             QE  +N P          S L  R  N       N      + ++D+ D+                +  QP  GW C +CT+ NKP    C++C   RPE + +P NY     +  RI+++KE   + +       Q  E E+ EN  +L +M  + +    E+VEC IC  + E G  ++L  CLH  CKEC R  I  S+DP + C   +    C   ++++EIR +++ ++++ + Q  L  AES+   ++HC T +C  W VY+D VN F CP+CK+ NCLLC AIHE   CK+YQD+L  +A ND AA++    L+ L+++G+AM CP C IIVQKK GCDW++C +C TEICW T+GPRWGPKG GD SGGC+C V + +C P C NCH
Sbjct:  238 VSVKVFPHSTIGALKQQVFSDYGFHPRVQRWVIGQSLCSDHRSLASYGVQ----RDGDTAFLYLISARQARLSRGIYQQDQESALLMVPTTHQAHQEAVSNGPAALNTASRPYSTLPTRLHNSHNTLSNNAGGSERLGLSDIRDLINLELPQLNEALGPNRTSIQP--GWACPTCTYINKPTRPGCEMCSADRPEGYTVPGNYRPDALELRRIQQEKEAIRQYQ-------QARETERRENFARLVQMDGQDLVPNPERVECRICYVELESGEGVLLRECLHCFCKECLRSVILMSEDPQVACPYRDESYACDCVLQEREIRALVSVDDYQHWLQRGLSVAESRCEGSYHCATADCPGWCVYEDTVNTFHCPVCKKQNCLLCKAIHEGMNCKQYQDDLTARAINDSAARRTRDLLKTLVNSGEAMHCPQCGIIVQKKEGCDWLRCTVCHTEICWVTRGPRWGPKGPGDISGGCRCNVNKQRCHPKCQNCH 714          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|Q9WUB0|HOIL1_MOUSE (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Mus musculus OX=10090 GN=Rbck1 PE=1 SV=2)

HSP 1 Score: 277.33 bits (708), Expect = 2.305e-85
Identity = 157/423 (37.12%), Postives = 247/423 (58.39%), Query Frame = 1
Query:  304 QHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANR------YKNVDQEHRWNEPIKSIMIIADV------VDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC----FEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            Q WV+ +    D     E +      + G  A+L++LS    +  P+        R      +K++  + R   P++ ++            D +   P VGW C  CTF NKP    C++C  +RPE + IP +Y   ++++ R+  ++E   + ++ +++ ++        N  +  ++ + S+ L TE  ECP+C +   PG A+VL  CLH  C+EC +  I NSQ+  + C       +C G + ++EIR +L+ E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C + NCLLC AIHE+  C+EYQD+LA++A+ND AA++    L+ ++  G+AM CP C+I+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:   99 QQWVVGQRLARD----QETLHSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRG--PLEPVLPKPRTNQEPGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQRKQQQQE-------GNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 508          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|Q9BYM8|HOIL1_HUMAN (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=RBCK1 PE=1 SV=2)

HSP 1 Score: 276.559 bits (706), Expect = 5.688e-85
Identity = 174/498 (34.94%), Postives = 272/498 (54.62%), Query Frame = 1
Query:  100 LFLFEQSFKNKFYLMSSNNNQNAVKLYVFVDNLQ------YTSERP-LTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANR------YKNVDQEHRWN-EPIKSIMIIADVVDVSKPQ-----PVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            ++L EQ       L    +    ++L+V V++ Q      + + RP +TV   K   F D          +    Q WV+ +    D     E +      + G  A+L++LS    +  P+        R      +K++  + R   EP      +       +P      P VGW C  CTF NKP    C++C  +RPE + +P +Y   ++++ R+  ++E   + ++ +++ ++        N  +  ++ + S+ L TE  ECP+C +   PG A+VL  CLH  C+EC +  I NSQ+  + C F +N   C G + ++EI+ +L  E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C   NCLLC AIHE   CKEYQ++LA++A+ND AA++    L+ ++  G+AM+CP CQI+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:   32 IWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYG--------FPPVLQQWVIGQRLARD----QETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQE-------GNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 510          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|Q62921|HOIL1_RAT (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Rbck1 PE=1 SV=3)

HSP 1 Score: 275.404 bits (703), Expect = 1.329e-84
Identity = 160/423 (37.83%), Postives = 247/423 (58.39%), Query Frame = 1
Query:  304 QHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANR------YKNVDQEHRWNEPIKSIMIIADV------VDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC-FEEN---CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            Q WV+ +    D     E +      + G  A+L++LS    +  P+        R      +K++  + R   P++ ++            D +   P VGW C  CTF NKP    C++C  +RPE + IP +Y   ++++ R+  ++E   + ++ +++ ++        N  +  ++ + S+ L TE  ECP+C +   PG A+VL  CLH  C+EC +  I NSQ+  + C F +N   C G + ++EIR +L+ E+++R+  L +  AE+++  ++HCKTP+C  W  ++DDVN F CP+C + NCLLC AIHE   C+EYQD+LA +ARND AA++    L+ ++  G+AM CP C+I+VQKK GCDW++C +C TEICW TKGPRWGP G GD SGGC+CRV G  C P+C NCH
Sbjct:   99 QQWVVGQRLARD----QETLHSHGIRRNGDSAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQPRG--PLEPVLPKPRTHQETGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQIPASYQPDEEERARLAGEEEALRQYEQRKQQQQE-------GNYLQHVQLEQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHERMNCREYQDDLAHRARNDVAAQQTTEMLRVMLQQGEAMYCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH 508          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: A0A3B5M556 (RanBP-type and C3HC4-type zinc finger containing 1 OS=Xiphophorus couchianus OX=32473 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.552e-103
Identity = 176/473 (37.21%), Postives = 264/473 (55.81%), Query Frame = 1
Query:  160 QNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVS------------------KPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            Q++ +L V V + +     P+T+I+S   +  ++K + ++   +    Q WV+ K    D     E +        G  AFLFILS    AN  +        ++    ++ R  E + S+ +    V                      P+P +GW C  CTF NKP    C++CG  RP+++ +P  Y   +D+  RI++++    + ++ ++  +++                  ++   T + +CPIC +  EPG  +VL  CLH  C+EC +  + NSQD  + C + +C   + D+EI+E+L +EE +R+ +L L  AES++ ++FHC+TPNC  W VY+DDVN FPC LC + NC+LC AIH++  CK+YQD+L I+A NDEAA+K    L+N++  G+AMKCP C IIVQKK GCDW+ C MCKTEICW TK  RWGPKG GD SGGC+CRV  + C P C NCH
Sbjct:   64 QDSFRLMVGVQDAESEDYIPVTLIVSTGMTIAEVKDKISQDFGFHPTLQRWVIGKRLAQD----QETLYSHGIRNSGDQAFLFILS----ANAAQ----LTRQQHNQDQEQQRIVESLPSLQLCPRGVGSGDKTVPPPVPPKNVTPPKPAPKPQLGWACTMCTFLNKPTRPGCEICGAERPQDYEVPDVYQPDQDEVLRIQQEQLALLQYEQAQQLEREQNYLYLLATD-------DHNLITNTTETDCPICFSTLEPGDGVVLRECLHTFCRECLKGTVINSQDAEVSCADTDCESKLLDREIKELLTEEEHQRFLELRLSIAESRSEHSFHCQTPNCRGWCVYEDDVNEFPCDLCNETNCILCRAIHKDMNCKDYQDDLRIRAENDEAAQKTKQMLENMLQNGEAMKCPRCDIIVQKKDGCDWICCLMCKTEICWVTKQARWGPKGAGDTSGGCKCRVNNQPCHPNCQNCH 517          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: M3ZUM2 (RanBP-type and C3HC4-type zinc finger containing 1 OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 4.972e-103
Identity = 177/473 (37.42%), Postives = 264/473 (55.81%), Query Frame = 1
Query:  160 QNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVS------------------KPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            Q++ +L V V + +     P+T+I+S   +  ++K + ++   +    Q WV+ K    D     E +      K G  AFLFILS    AN  +       N+ +   +     E + S+ +    V                      P+P +GW C  CTF NKP    C++CG  RP+++ +P  Y   +D+  RI++++    + ++ ++  +++                  ++   T + +CPIC +  EPG  +VL  CLH  C+EC +  + NSQD  + C + +C   + D+EI+E+L +EE +R+ +L L  AES++ ++FHC+TPNC  W VY+DDVN FPC LC + NC+LC AIH++  CK+YQD+L I+A NDEAA+K    L+N++  G+AMKCP C IIVQKK GCDW+ C MCKTEICW TK  RWGPKG GD SGGC+CRV  + C P C NCH
Sbjct:   59 QDSFRLMVGVQDAESEDYIPVTLIVSTGMTIAEVKDKISQDFGFHPTLQRWVIGKRLAQD----QETLYSHGIRKSGDQAFLFILS----ANAAQ-LTRQQHNQDQEQQRIAGIVESLPSLQLCPRGVGSGDKTVPPPVPPKNVTPPKPAPKPQLGWACTMCTFLNKPTRPGCEICGAERPQDYEVPDVYQPDQDEVLRIQQEQLALLQYEQAQQLEREQNYLYLLATD-------DHNLITNTTETDCPICFSTLEPGDGVVLRECLHTFCRECLKGTVINSQDAEVSCADTDCESKLLDREIKELLTEEEHQRFLELRLSIAESRSEHSFHCQTPNCRGWCVYEDDVNEFPCDLCNETNCILCRAIHKDMNCKDYQDDLRIRAENDEAAQKTKQMLENMLQNGEAMKCPRCDIIVQKKDGCDWICCLMCKTEICWVTKQARWGPKGAGDTSGGCKCRVNNQPCHPNCQNCH 515          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: A0A3Q2DNH7 (RanBP-type and C3HC4-type zinc finger containing 1 OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 6.552e-103
Identity = 181/493 (36.71%), Postives = 272/493 (55.17%), Query Frame = 1
Query:  118 SFKNKFYLMSSNNNQNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQEHR----WNEPIKSIMIIADVVDVSK--------PQPV------------VGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            S KN  Y       Q++++L V V++ Q     P+T+++S      +LK + ++   +    Q WV+ K    D     + +      K G  AFLFILS +          + L     N DQE +      E + SI +    V V++        P+ +            VGWNC  CTF NKP    C++CG  RP+++ +P  Y   +++  RI++++   +  ++ +E  +Q+                ++++   T + +CPIC +  +PG  +VL  CLH  C+EC    + NSQD  + C + +C   + D+EI+E+L +EE +R+ +L L  AES++ ++FHC+TPNC  W +Y+DDVN F C LC + NCLLC AIH++  CK+YQD+L ++A ND+AA++    L+N++  G+AMKCP C IIVQKK GCDW+ C MCKTEICW TK  RWGP G GD SGGC+CRV    C P C NCH
Sbjct:   50 SIKNHAY------PQDSIRLMVGVEDAQSEDYIPVTLVVSSGMKISELKEKISQDFGFHPTLQRWVIGKRLAQD----QDTLYSHGVRKSGDQAFLFILSAD---------AAHLTRHQHNQDQEQQRLASIVESLHSIELQPRGVGVAEKRAPPHIPPKNIPTPKPPLPPKPQVGWNCTLCTFLNKPTRPGCEICGAERPQDYEVPDVYEPDQEEVLRIQQEQLAFQLYEEAQELERQQNYMYLLATE-------EQNLIPNTTETDCPICMSTLQPGEGVVLRECLHTFCRECLAGTVINSQDAEVCCADTDCESKLLDREIKELLTEEEHQRFLELRLNIAESRSEHSFHCQTPNCRGWCIYEDDVNEFQCDLCNETNCLLCRAIHKDMNCKDYQDDLRVRAENDQAAQQTKQMLENMLQNGEAMKCPRCDIIVQKKDGCDWICCLMCKTEICWVTKQARWGPNGHGDTSGGCKCRVNNMACHPNCQNCH 516          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: A0A3B3XA81 (RanBP-type and C3HC4-type zinc finger containing 1 OS=Poecilia mexicana OX=48701 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 6.772e-103
Identity = 175/471 (37.15%), Postives = 261/471 (55.41%), Query Frame = 1
Query:  160 QNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEK----------------ANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            Q++ +L V V + +     P+T+I+S   +  ++K + ++   +    Q WV+ K    D     E +      K G  AFLFILS                    A I E   SF  +   + ++          +           P+P +GW C  CTF NKP    C++CG  RP+++ +P  Y   +D+  RI++++    + ++ ++  ++R                 +++   T + +CPIC +  EPG  +VL  CLH  C+EC +  + NSQD  + C + +C   + D+EI+E+L +EE +R+ +L L  AES++ ++FHC+TPNC  W +Y+DDVN F C LC + NC+LC AIH++  CK+YQD+L I+A NDEAA+K    L+N++  G+AMKCP C IIVQKK GCDW+ C MCKTEICW TK  RWGPKG GD SGGC+CRV  + C P C NCH
Sbjct:   58 QDSFRLMVGVQDAESEDYIPVTLIVSTGMTIAEVKDKISQDFGFHPTLQRWVIGKRLAQD----QETLYSHGIRKSGDQAFLFILSANAAQLTRQQHNQDQEQQRIAGIAESLVSFQLHPRGSGNKIVP-----PPVPPKTVTPPKPAPKPQLGWACVMCTFLNKPTRPGCEMCGAERPQDYEVPDIYQPDQDEVLRIQQEQLALMQYEQAQQLERERNYLHLLATD-------DQNLITNTTETDCPICFSTLEPGDGVVLRECLHTFCRECLKGTVINSQDAEVSCADTDCESKLLDREIKELLTEEEHQRFLELRLSIAESRSEHSFHCQTPNCRGWCIYEDDVNEFHCDLCDETNCILCRAIHKDMNCKDYQDDLRIRAENDEAAQKTKQMLENMLQNGEAMKCPRCDIIVQKKDGCDWICCLMCKTEICWVTKQARWGPKGTGDISGGCRCRVNNQPCHPNCQNCH 512          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: A0A087X8X7 (RanBP-type and C3HC4-type zinc finger containing 1 OS=Poecilia formosa OX=48698 PE=4 SV=2)

HSP 1 Score: 328.176 bits (840), Expect = 2.350e-102
Identity = 174/471 (36.94%), Postives = 260/471 (55.20%), Query Frame = 1
Query:  160 QNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEK----------------ANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            Q++ +L V V + +     P+T+I+S   +  ++K + ++   +    Q WV+ K    D     E +      K G  AFLFILS                    A I E   S   +   + ++          +           P+P +GW C  CTF NKP    C++CG  RP+++ +P  Y   +D+  RI++++    + ++ ++  ++R                 +++   T + +CPIC +  EPG  +VL  CLH  C+EC +  + NSQD  + C + +C   + D+EI+E+L +EE +R+ +L L  AES++ ++FHC+TPNC  W +Y+DDVN F C LC + NC+LC AIH++  CK+YQD+L I+A NDEAA+K    L+N++  G+AMKCP C IIVQKK GCDW+ C MCKTEICW TK  RWGPKG GD SGGC+CRV  + C P C NCH
Sbjct:   58 QDSFRLMVGVQDAESEDYIPVTLIVSTGMTIAEVKDKISQDFGFHPTLQRWVIGKRLAQD----QETLYSHGIRKSGDQAFLFILSANAAQLTRQQHNQDQEQQRIAGIAESLVSLQLHPRGSGNKIVP-----PPVPPKTVTPPKPAPKPQLGWACVMCTFLNKPTRPGCEMCGAERPQDYEVPDIYQPDQDEVLRIQQEQLALMQYEQAQQLERERNYLHLLATD-------DQNLITNTTETDCPICFSTLEPGDGVVLRECLHTFCRECLKGTVINSQDAEVSCADTDCESKLLDREIKELLTEEEHQRFLELRLSIAESRSEHSFHCQTPNCRGWCIYEDDVNEFHCDLCDETNCILCRAIHKDMNCKDYQDDLRIRAENDEAAQKTKQMLENMLQNGEAMKCPRCDIIVQKKDGCDWICCLMCKTEICWVTKQARWGPKGTGDISGGCRCRVNNQPCHPNCQNCH 512          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: rbck1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:103044240])

HSP 1 Score: 295.434 bits (755), Expect = 7.839e-93
Identity = 178/525 (33.90%), Postives = 273/525 (52.00%), Query Frame = 1
Query:   13 FCVSKSQIVTKSQLVFNLNLNFANIKLVYLFLFEQSFKNKFYLMSSNNNQNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYD-DFEISEIITKMPPFKKGYVAFLFILS------------QEEK----ANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCF----EENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            FC+   + V  S   F L  + +      +F+ ++    K   ++  + Q  ++L V V++       P+T++++      +LK +      +    Q WV+ K    D D   S  +T+       Y A+LFI S            QEE+      I E   +F       V+   R + P+    I  +          VGW+C  CT+ NKP    C++C   RP N+ +P  Y   +D+  R+++++    + ++   E +++      E          +++   TE+++C IC     PG    L  CLH+ C+EC +  I N  D  ++C     E  C   ++D+EI+ +L+ EE++++++L L  AES++ N++HCKTP+C  W +++DDVN F C  C + NCLLC AIH++  CKEYQD+L I+A ND AAKK    L+ L+  G+AM CP C++IVQKK GCDW+ C MCKTEICW TK  RWGP G GD SGGC+CRV G  C P C NCH
Sbjct:   25 FCLYMYRSVCSSTRRFTLQRS-SGTSTTPVFIRDRLSNGKRLCLTFYHLQLNLRLRVGVEDALSDVSIPITMLVNPAMRISELKDKINHDYGFHPSLQCWVIGKRIAKDADTLFSHNVTE-----DNYQAYLFIRSAQAANLSREQQKQEEEDRRLGGIIENIETFSLQARGTVEGARRKHPPVP---IKQNPPKPPVKPKPVGWSCPQCTYVNKPTRPGCEMCSTDRPANYKVPDLYQPDEDEILRLQQEELASLQYEQSIVEEREKNFYNLLEID-------SQNLVSNTEELDCTICFCPVMPGEGATLRECLHSFCRECLKQTIVNCTDAEVQCPYRDDEYACAYTLQDREIKTLLSAEEYQKFEELRLSIAESRSENSYHCKTPDCGGWCIFEDDVNEFICDSCGEKNCLLCKAIHKDMNCKEYQDDLRIRAENDTAAKKTTEMLEMLVTNGEAMYCPKCKVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGNGDTSGGCRCRVNGVLCHPRCQNCH 533          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: rbck1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:103044240])

HSP 1 Score: 295.434 bits (755), Expect = 8.863e-93
Identity = 178/525 (33.90%), Postives = 273/525 (52.00%), Query Frame = 1
Query:   13 FCVSKSQIVTKSQLVFNLNLNFANIKLVYLFLFEQSFKNKFYLMSSNNNQNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYD-DFEISEIITKMPPFKKGYVAFLFILS------------QEEK----ANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCF----EENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            FC+   + V  S   F L  + +      +F+ ++    K   ++  + Q  ++L V V++       P+T++++      +LK +      +    Q WV+ K    D D   S  +T+       Y A+LFI S            QEE+      I E   +F       V+   R + P+    I  +          VGW+C  CT+ NKP    C++C   RP N+ +P  Y   +D+  R+++++    + ++   E +++      E          +++   TE+++C IC     PG    L  CLH+ C+EC +  I N  D  ++C     E  C   ++D+EI+ +L+ EE++++++L L  AES++ N++HCKTP+C  W +++DDVN F C  C + NCLLC AIH++  CKEYQD+L I+A ND AAKK    L+ L+  G+AM CP C++IVQKK GCDW+ C MCKTEICW TK  RWGP G GD SGGC+CRV G  C P C NCH
Sbjct:   39 FCLYMYRSVCSSTRRFTLQRS-SGTSTTPVFIRDRLSNGKRLCLTFYHLQLNLRLRVGVEDALSDVSIPITMLVNPAMRISELKDKINHDYGFHPSLQCWVIGKRIAKDADTLFSHNVTE-----DNYQAYLFIRSAQAANLSREQQKQEEEDRRLGGIIENIETFSLQARGTVEGARRKHPPVP---IKQNPPKPPVKPKPVGWSCPQCTYVNKPTRPGCEMCSTDRPANYKVPDLYQPDEDEILRLQQEELASLQYEQSIVEEREKNFYNLLEID-------SQNLVSNTEELDCTICFCPVMPGEGATLRECLHSFCRECLKQTIVNCTDAEVQCPYRDDEYACAYTLQDREIKTLLSAEEYQKFEELRLSIAESRSENSYHCKTPDCGGWCIFEDDVNEFICDSCGEKNCLLCKAIHKDMNCKEYQDDLRIRAENDTAAKKTTEMLEMLVTNGEAMYCPKCKVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGNGDTSGGCRCRVNGVLCHPRCQNCH 547          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: rbck1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:103044240])

HSP 1 Score: 292.352 bits (747), Expect = 7.411e-92
Identity = 169/473 (35.73%), Postives = 253/473 (53.49%), Query Frame = 1
Query:  169 VKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYD-DFEISEIITKMPPFKKGYVAFLFILS------------QEEK----ANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC----FEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            ++L V V++       P+T++++      +LK +      +    Q WV+ K    D D   S  +T+       Y A+LFI S            QEE+      I E   +F       V+   R + P+    I  +          VGW+C  CT+ NKP    C++C   RP N+ +P  Y   +D+  R+++++    + ++   E +++      E          +++   TE+++C IC     PG    L  CLH+ C+EC +  I N  D  ++C     E  C   ++D+EI+ +L+ EE++++++L L  AES++ N++HCKTP+C  W +++DDVN F C  C + NCLLC AIH++  CKEYQD+L I+A ND AAKK    L+ L+  G+AM CP C++IVQKK GCDW+ C MCKTEICW TK  RWGP G GD SGGC+CRV G  C P C NCH
Sbjct:   60 IRLRVGVEDALSDVSIPITMLVNPAMRISELKDKINHDYGFHPSLQCWVIGKRIAKDADTLFSHNVTE-----DNYQAYLFIRSAQAANLSREQQKQEEEDRRLGGIIENIETFSLQARGTVEGARRKHPPVP---IKQNPPKPPVKPKPVGWSCPQCTYVNKPTRPGCEMCSTDRPANYKVPDLYQPDEDEILRLQQEELASLQYEQSIVEEREKNFYNLLEID-------SQNLVSNTEELDCTICFCPVMPGEGATLRECLHSFCRECLKQTIVNCTDAEVQCPYRDDEYACAYTLQDREIKTLLSAEEYQKFEELRLSIAESRSENSYHCKTPDCGGWCIFEDDVNEFICDSCGEKNCLLCKAIHKDMNCKEYQDDLRIRAENDTAAKKTTEMLEMLVTNGEAMYCPKCKVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGNGDTSGGCRCRVNGVLCHPRCQNCH 517          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: shrprbck1r (ranBP-type and C3HC4-type zinc finger-containing protein 1-like [Source:NCBI gene;Acc:103029459])

HSP 1 Score: 262.307 bits (669), Expect = 1.332e-78
Identity = 129/295 (43.73%), Postives = 182/295 (61.69%), Query Frame = 1
Query:  571 GWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEEN----CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGP 1443
            GW C SCT+ NKP    C++C   RPEN+ +P  Y     +  RI+++KE   + +       Q  E E+ EN  +L +M  + +    E VEC IC    +PG  ++L  CLH  C+EC R  I  S+DP + C   +    C   ++++EIR +++ EE+ER+ Q  L  AES+   ++HC T +C  W VY+D VN F CP+C ++NCLLC AIHE   CK+YQD+LA +A ND AA++    L+ L+ +G+AM CP C IIVQKK GCDW++C +C TEICW T+GPRWGP
Sbjct:  382 GWACPSCTYINKPTRPGCEMCSADRPENYTVPGGYRPDALELRRIQQEKEAIRQYQ-------QAQEAERRENYARLVQMDGQELVPNPESVECRICYLQLQPGEGVLLRECLHCFCRECLRSVILLSEDPQVACPYRDEAYACDCVLQEREIRALVSGEEYERWLQRGLSVAESRCEGSYHCATTDCPGWCVYEDTVNTFHCPVCTKHNCLLCKAIHEGMNCKQYQDDLAARAINDTAARRTRDLLKTLVRSGEAMHCPQCGIIVQKKEGCDWLRCTVCHTEICWVTRGPRWGP 669          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: shrprbck1r (ranBP-type and C3HC4-type zinc finger-containing protein 1-like [Source:NCBI gene;Acc:103029459])

HSP 1 Score: 262.692 bits (670), Expect = 1.776e-78
Identity = 144/322 (44.72%), Postives = 200/322 (62.11%), Query Frame = 1
Query:  571 GWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEEN----CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRV-RGKCTPTCGNCH 1521
            GW C SCT+ NKP    C++C   RPEN+ +P  Y     +  RI+++KE   + +       Q  E E+ EN  +L +M  + +    E VEC IC    +PG  ++L  CLH  C+EC R  I  S+DP + C   +    C   ++++EIR +++ EE+ER+ Q  L  AES+   ++HC T +C  W VY+D VN F CP+C ++NCLLC AIHE   CK+YQD+LA +A ND AA++    L+ L+ +G+AM CP C IIVQKK GCDW++C +C TEICW T+GPRWGP G GD SGGC+C V + +C P C NCH
Sbjct:  411 GWACPSCTYINKPTRPGCEMCSADRPENYTVPGGYRPDALELRRIQQEKEAIRQYQ-------QAQEAERRENYARLVQMDGQELVPNPESVECRICYLQLQPGEGVLLRECLHCFCRECLRSVILLSEDPQVACPYRDEAYACDCVLQEREIRALVSGEEYERWLQRGLSVAESRCEGSYHCATTDCPGWCVYEDTVNTFHCPVCTKHNCLLCKAIHEGMNCKQYQDDLAARAINDTAARRTRDLLKTLVRSGEAMHCPQCGIIVQKKEGCDWLRCTVCHTEICWVTRGPRWGPGGPGDTSGGCRCNVNKQRCHPKCQNCH 725          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Sea Lamprey
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 273.863 bits (699), Expect = 2.066e-85
Identity = 164/488 (33.61%), Postives = 249/488 (51.02%), Query Frame = 1
Query:  139 LMSSNNNQNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILS-QEEKANIPEY--------------FGSFLANRYKNVDQE-----HRWNEPIKSIMIIADVVDVSKPQ--PVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKC----FEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            L +   + ++ ++ V V++   +S  P+ V +S + +   LK +         + Q WV+N+    D   +     +    ++G  AFL+++S Q+    + EY               GS    R +   Q       R + P+      A        Q    VGW C  CTF N P    CD CG +RP ++ +P  Y  T D + RI   +    R  +     K+R   ++    +      ++ +    E   CPIC  D EPG  + L  CLH  CK+C    I N +D  + C     E +C   +  +EI+ ++++ E+ R+    L  AE+++ +++HC T +C+ W  Y+D VN F CP+CK++NCL C AIHE   C+EYQD+L +++ ND+AA +    LQ ++ TG AM CP C++IVQKK GCDW+ C++CKTEICW TKG RWGP G GD SGGCQCR+  + C P C NCH
Sbjct:   45 LKTPGQSSSSFRIKVQVEDT-TSSVGPIYVKVSSHMTVDTLKQQIFRHYDIHPKVQRWVINQRLAEDSKSLHSYGLQ----REGDEAFLYLVSAQQANLKVEEYKRAQSGGPQVPLFKGGSASILRLQPAGQPLQPPGGRQSNPLIPERPSAPPPPRPPAQNHKQVGWPCPVCTFVNLPLRPGCDQCGTARPADYQVPAGYQPT-DRERRITDQEMDNRRKLEETRVKKRRENFQRLMQED------EQELVPNKEAFTCPICFVDYEPGEGVTLRECLHNFCKDCLHGTIVNCEDAEVTCPNQDGEISCEFKLHQREIKALVSEVEYCRFLGKGLAIAENRSADSYHCVTADCLGWCFYEDMVNDFLCPICKKSNCLTCKAIHEGMDCQEYQDDLKLRSDNDQAAMQTNLMLQTMVQTGDAMHCPTCKVIVQKKDGCDWICCSICKTEICWVTKGARWGPNGTGDTSGGCQCRINDRMCHPDCMNCH 520          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Sea Lamprey
Match: zmp:0000000524 (zmp:0000000524 [Source:ZFIN;Acc:ZDB-GENE-130530-527])

HSP 1 Score: 67.0106 bits (162), Expect = 5.277e-12
Identity = 54/214 (25.23%), Postives = 85/214 (39.72%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCS-AIHENQTC---KEYQDELAIKARNDEAAKKDIAFLQNLID-----------------TGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            C IC  +    + + L  C H  C++C   Y    I       + C E  C       ++RE++ +E F RY +L L+++     +  +C   +C   V+ + +     CP CK   C +C  A H    C    E  + +  K  N +AA +  AFL+                        A  CP C   +QK  GC+ M C+ C+   CW
Sbjct:  226 CHICLCEKLGSSCVNLSGCEHVYCRDCLSAYFQLQIQEGNVHSLTCPEPKCQTVATPSQVRELVGEELFSRYDRLLLQSSLDLMADVVYCPRTSCQTPVLLEPNKTMGHCPQCKFAFCNVCRHAYHGISACIIKSENLENILKKYNNADAASR--AFLEQRYGKHTIKRAIEEVHSKDWLAQNAKACPRCCTNIQKVDGCNKMTCSSCQLYFCW 437          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006333.1 (pep scaffold:Pmarinus_7.0:GL479789:448:31336:-1 gene:ENSPMAG00000005679.1 transcript:ENSPMAT00000006333.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 9.163e-11
Identity = 54/219 (24.66%), Postives = 85/219 (38.81%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY---------INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFE--RYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFF-PCPLCKQNNCLLCSAI--HENQTC---KEYQDELAI-KARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGK 1452
            CP+C        A +   C H+ CK C+R+Y         + N + P+ +C  +    FI     R +L    F   +Y +  +R       N   C  P     ++  D +     C  C  ++C  C+ +  H   +C    ++ D+    +  N EA  K +A L        + +CP CQ  ++K  GC  M C  C    CW    P W P  K
Sbjct: 1992 CPVCLLTTVDHIAPLC--CRHSCCKSCWREYLSMRVEQNMVTNCKCPISECLAQPPPDFI-----RSILECMRFAPPQYNRGLVRCYVESCTNLTWCTNPQGCDRILCTDSIGHAGTCAKCHWSSCFSCNFLEAHYPASCGHMSQWMDDGGYYEGMNSEALSKHLAKLI-------SKRCPSCQAQIEKNEGCLHMTCAKCNHGFCWRCLKP-WKPTHK 2195          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007741.1 (pep scaffold:Pmarinus_7.0:GL477427:676:25209:1 gene:ENSPMAG00000006996.1 transcript:ENSPMAT00000007741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 2.059e-10
Identity = 55/216 (25.46%), Postives = 81/216 (37.50%), Query Frame = 1
Query:  826 ALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQD---------PLIKCFEENCVGFIEDQEIREVLNDE--EFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDV--NFFPCPLCKQNNCLLCSAI--HENQTCKE---YQDELAI-KARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            A A +Q  CPIC         +    C H  CK C+R Y+  S D         P++ C  +    FI     R ++ D+    E Y++  LR       N   C  P     V+  D    +   C  C  + C  CS +  H   +C +   + DE    +  + +A  K +A L        +  CP C   ++K  GC  M C  C    CW
Sbjct: 1385 AAADQQPTCPICLGVTGEVELLAPLYCTHRCCKSCWRAYLKTSIDQNMLAKCTCPIMDCPAQPTGAFI-----RTMMEDDSDRLELYKRALLRGYVESCSNLAWCANPQGCDRVLCKDGTGGHAATCAKCHWSTCFSCSFLEAHCPASCNQIAWWVDEGGYYEGMSSDALSKHLAKLI-------SKPCPSCHAQIEKNEGCLHMTCAKCNHSFCW 1588          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Sea Lamprey
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030131-9414])

HSP 1 Score: 50.447 bits (119), Expect = 9.707e-7
Identity = 49/206 (23.79%), Postives = 79/206 (38.35%), Query Frame = 1
Query:  832 ATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDY--INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEF-ERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLL-----CSAI-HENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKK--SGCDWMQCNMCKTEICW 1416
             ++ +ECP+C           L +C H  C +C R Y  I  S+  +  C  E C   +   +I+ +L D     +Y++  LR       +   C  P+C  + V        P   C++  C       C A+ H NQTC   + + +   R         ++ Q+         CP C   + K     C+ M C +C  E CW
Sbjct:  104 GSDALECPLCLVRRSAEHFPELLSCPHRSCLDCLRQYLRIEISESRVNICCPE-CAERLNPHDIQRILADATLMGKYEEFMLRRFLVADPDCRWCPAPDC-GFAVIATGCASCPKLTCEREGCGTEFCYHCKAMWHPNQTCDAARQQRSATLRLRSIQSASASYSQDGAHADDIKPCPRCAAYIMKMNDGSCNHMTCAVCGCEFCW 307          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Yeast
Match: HEL1 (RING finger ubiquitin ligase (E3); involved in ubiquitination and degradation of excess histones; interacts with Ubc4p and Rad53p; null mutant sensitive to hydroxyurea (HU) [Source:SGD;Acc:S000001725])

HSP 1 Score: 56.9954 bits (136), Expect = 4.503e-9
Identity = 50/198 (25.25%), Postives = 86/198 (43.43%), Query Frame = 1
Query:  904 CLHAICKECFRDYINNS--QDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFH-CKTPNCVAWVVYDDDVNFFP-------CPLCKQNN----CLLCS-AIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGK 1452
            C H  C  C+R YI +   +  +I C +  C   +++++I +V+      +    S+++   K    +  C   +C + +V+  D +  P        P  K N+    C  C   +H    CK       I     + A+K+   L  ++      +CP C + ++K  GC+ M C+ CK E CW  +GP W P GK
Sbjct:  195 CGHEYCINCYRHYIKDKLHEGNIITCMD--CSLALKNEDIDKVMGHPSSSKLMDSSIKSFVQKHNRNYKWCPFADCKS-IVHLRDTSSLPEYTRLHYSPFVKCNSFHRFCFNCGFEVHSPADCK-------ITTAWVKKARKESEILNWVL--SHTKECPKCSVNIEKNGGCNHMVCSSCKYEFCWICEGP-WAPHGK 379          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Match: EDO39228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAP2])

HSP 1 Score: 248.825 bits (634), Expect = 3.708e-79
Identity = 117/239 (48.95%), Postives = 162/239 (67.78%), Query Frame = 1
Query:  823 IALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEEN----CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIH-ENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            + L  E+ +C IC T+  PG  +VL  CLH  C +C R++I N  DP ++C  ++    C   I  QEI+ +L++E+F ++   SL  AES+  N+FHCKTPNC  W +Y+D+VN F C +C + NCL C AIH     C+EYQ ++  +A ND+AAK+   +L+++I  G AM+CP CQII+ KK GCDWM+C+MC+ EICWAT+GPRWGP+G GD + GC+CRV G KC P C NCH
Sbjct:    3 LILNQEEFDCAICFTEVPPGEGVVLRECLHRFCIDCLREHIRNCTDPEVQCPYQDEQFACHFIITAQEIKALLSEEDFNKFLNRSLATAESQAANSFHCKTPNCPGWCLYEDNVNTFHCEVCSKVNCLTCKAIHFPEMNCREYQQDIQRRALNDDAAKQTQLYLEDMIKKGDAMRCPQCQIILLKKDGCDWMRCSMCRMEICWATRGPRWGPQGVGDTTAGCKCRVGGRKCHPNCRNCH 241          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Match: EDO47022 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN84])

HSP 1 Score: 73.9442 bits (180), Expect = 5.076e-14
Identity = 51/217 (23.50%), Postives = 84/217 (38.71%), Query Frame = 1
Query:  835 TEQVECPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCS-AIHENQTCKEYQDELA------IKARNDEAAKKDIAFLQNLID------------TGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            T    C +C ++      +  HNC H  C EC   Y    IN+     + C    C       +++ V+++E F +Y +  L+++     +  +C  P+C + V+ D +     CP C    C +C    H    C     E        +KA  +E A  D  + ++ +                  KCP C   +QK  GC+ M C  C+   CW
Sbjct:  193 TSYFTCDVCFSEKPGSMCLAFHNCGHVFCCECMTGYFTVQINDGSVKALTCPTSKCESQALPSQVKRVVSEETFAKYDKFLLQSSLDGMSDITYCPRPDCQSPVLVDSESTIGLCPACSFAFCKICRLGYHGVSPCSIKNSEFRKLRTEYLKATEEERALLDQRYGRDRLKKVFEEVVSEDWVKSNCTKCPSCSYQIQKFDGCNKMTCIKCRANFCW 409          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Match: EDO37437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFQ2])

HSP 1 Score: 53.5286 bits (127), Expect = 8.361e-8
Identity = 48/201 (23.88%), Postives = 79/201 (39.30%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCV--GFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWV-VYDDDVNFFPCPLCKQNNCLLCSAI-HENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAM----KCPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            C IC  DC      +L +C    CKEC + Y    I +     I C +  C   G + + EI +++ ++ F+ +Q++        + +   C  P+C   V           C  C  + C  C    H  + C           +N       I F + L++  + +     CP CQ+++Q+  GC  M C  CK   CW
Sbjct:   24 CKICLADCPTKKGAILKSCGCFFCKECLKQYVAHAIADGSVLQIPCPDGVCPDKGDLMESEIADLIAEDLFQNFQKMRAIKEIQISKSKAFCPKPDCKGVVESIPGAAKEVCCSECGYSFCFACKGPWHPEKHC-----------QNKGEKANGIKFFE-LVNGEEVLVEIKACPTCQVLIQRDEGCAQMMCGNCKHIFCW 212          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Match: EDO47093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN86])

HSP 1 Score: 53.5286 bits (127), Expect = 2.057e-7
Identity = 58/209 (27.75%), Postives = 82/209 (39.23%), Query Frame = 1
Query:  847 ECPICETDCEPGTAIVLHNCLHAICKECFRDYINNS---QDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCK-------------TPNCVAWVVYDDDVNFFPCPLCKQNN--CLLC-SAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICW 1416
            EC IC  D        L +C H+ C EC+  Y+ +     +  I C   NC   +++  I   L    + ++ +  L  A   T +   C              +PN  AW V           LCK     C  C S  H   +C E +    I A N E  K  I   + LI++     CP C   ++K  GC++M C MCKT  CW
Sbjct:  545 ECGICFGDFRENKMTALMSCGHSFCTECWEFYLKSQISRGEGDIGCPGYNCDVTLDNVTIMS-LTPSWYPKFLKRKLNRALEMTSSWRWCPGKNCRQVVNGTELSPNSSAWSV-----------LCKCGGIWCFKCGSQAHWPASCVEARKFYRI-AGNYE--KLLINERKELINSVMVKNCPSCHYPIEKHLGCNFMTCVMCKTNFCW 738          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Match: EDO31527 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP1])

HSP 1 Score: 51.6026 bits (122), Expect = 3.394e-7
Identity = 58/235 (24.68%), Postives = 96/235 (40.85%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDYINN--SQDPL-IKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAW-----VVYDDDVNF-------------------FPCPLCKQNNCLLCSA-IHENQTCKEY---QDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDN 1461
            C +C T      +++   C    CKEC R +I    +Q  + I C  ENC G + +  I+E+ ++E +++Y +  +    + +  T     PNC        +   D  N                      C  CK   C  C A  H   +C+++      L I ARN  A  ++            A +CP C++ +Q+ SGCD M C+ C+T+ C+       G +  GD+
Sbjct:    8 CYVCLTFVALSESVLSECCGGKTCKECLRYHIEEKVTQGIVQIICPFENCDGVLSETVIKEISDEEIWKKYVKFKVDRDPNSSVKT----CPNCAMVFRKQPLKEQDQQNVCATKSKKKEKKEQISKDCKIVCEECKFVWCFDCHAPWHYGISCEKFCKGDTSLRIWARNRGALTRN------------ATQCPKCRVYIQRISGCDSMACSRCQTQFCYRCGRHFRGNRFLGDH 226          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Match: rbck1 (ranBP-type and C3HC4-type zinc finger-containing protein 1 [Source:NCBI gene;Acc:101166217])

HSP 1 Score: 298.901 bits (764), Expect = 2.108e-94
Identity = 166/482 (34.44%), Postives = 259/482 (53.73%), Query Frame = 1
Query:  160 QNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVD---------------------------VSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTCGNCH 1521
            Q+ ++L V V++ Q  S  P+T+ +S   +   LK +      +    Q WV+ K    D     + +        G  AFLFI S            + L     N+DQE +  E I   +   ++                              + P+P +GW+C +CT+ NKP    C++CG  RP+++++P  Y   +++  R++ +     + ++ ++E +Q+                ++++ +     +CPIC    +PG  +VL  CLH  C+EC    I NS +  + C  ++C   + D+EI+E+L +EE +R+ +L L  AES++ ++FHC+TPNC  W +Y+D+VN F C LC + NCLLC AIH++  CK+YQD+L I+A+ND+AA++    L++++  G+AM CP C IIVQKK GCDW+ C MCKTEICW TK  RWGP G GD SGGC+CRV  + C P C NCH
Sbjct:   58 QDRIRLRVGVEDAQSESSIPVTLEVSSAMTIAQLKDKINRDFGFHPLLQRWVIGKRLAQD----RDTLYSHGIRSNGDQAFLFIRSAS---------SARLTRHQYNLDQEQQLLESIVESIPSMELCSRGFGGNATEKKVLPPSVPPKTYKTAKPANPPKPQLGWSCKTCTYVNKPTRPGCEMCGDERPDDYLVPDLYQPDQEEVERLQLEDLALLQYQEAQQEERQQNYLNLLATD-------EQNLIVNATVADCPICFNALQPGEGVVLRECLHTFCRECLIGTIRNSNNAEVSC-PDDCESKLLDREIKELLTEEEHQRFLELRLSIAESRSEHSFHCQTPNCRGWCIYEDEVNEFHCDLCLEVNCLLCRAIHKDMNCKDYQDDLRIRAQNDKAAQQTKQMLESMLQNGEAMNCPRCAIIVQKKDGCDWICCLMCKTEICWVTKQARWGPNGPGDTSGGCRCRVNNQPCHPNCQNCH 518          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Match: shrprbck1r (ranBP-type and C3HC4-type zinc finger-containing protein 1 [Source:NCBI gene;Acc:101169745])

HSP 1 Score: 293.123 bits (749), Expect = 3.988e-90
Identity = 141/322 (43.79%), Postives = 205/322 (63.66%), Query Frame = 1
Query:  571 GWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEEN----CVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG-KCTPTCGNCH 1521
            GW+C SCT+ NKP    C++C  +RPE++++P  Y     +  RI+++KE   + +       Q  EKE+ EN  +L  M  + +    + V+C IC  D   G  ++L  CLH  C+EC R  I  S++P + C   +    C G ++++EI+ +++ EE+ER+ Q  L  AES+   ++HC TP+C+ W VY+D VN F CP+C+++NCL+C AIHE   CK+YQD+LA++A ND AA++    L  L+ +G+AM CP C IIVQK+ GCDW++C +C  EICW T+GPRWGPKG GD SGGC+C V   KC P C NCH
Sbjct:  395 GWSCPSCTYINKPTRPGCEICSTNRPESYIVPGGYQPDALELRRIQQEKESIRQYQ-------QAREKERRENFARLVMMDGQDLVPNPDPVDCRICYMDLPSGQGVLLRECLHCFCRECLRSVIMLSEEPEVSCPYRDDAYSCDGVLQEREIKALVSAEEYERWLQRGLSMAESRCEGSYHCATPDCLGWCVYEDTVNVFHCPVCRKHNCLICKAIHEGMNCKQYQDDLAVRAINDSAARRTTHLLMTLVQSGEAMYCPQCGIIVQKRDGCDWLRCTVCHIEICWVTRGPRWGPKGPGDTSGGCRCNVNNQKCHPKCQNCH 709          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Match: zmp:0000000524 (ring finger protein 14 [Source:NCBI gene;Acc:101167638])

HSP 1 Score: 63.929 bits (154), Expect = 1.844e-10
Identity = 52/229 (22.71%), Postives = 85/229 (37.12%), Query Frame = 1
Query:  850 CPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCS-AIHENQTCKEYQDELA-IKARNDEAAKKDIAFLQNLIDTGQAMK-----------------CPGCQIIVQKKSGCDWMQCNMCKTEICWATKG--PRWGPKGKGDN 1461
            C IC ++      +    C H  C  C  +Y    I +     + C E  C       ++++++++E F RY +L L++      +  +C    C   V+ + D     C  C+   C +C  A H    CK   +EL  ++     A  +   F++         K                 CP C   +QK  GC+ M C  CK   CW   G   +  P G  +N
Sbjct:  224 CGICFSEKLGSHCLCFKECQHVYCNACMTEYFQIQIRDGNVQCLNCPEPKCTSLATPLQVKQLVDEELFARYDRLLLQSTLDLMADVVYCPRQFCGTAVMVEPDTTMGICSACQHAFCTMCKLAYHGVSHCKFPAEELRNLRDEYLSATSEGKKFMEKRFGKRVIQKAVEESFSRDWLTENCKCCPKCGTNIQKVDGCNKMTCTSCKQYFCWLCLGVLSKVNPYGHFNN 452          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Match: ENSORLT00000014493.2 (E3 ubiquitin-protein ligase RNF14 [Source:NCBI gene;Acc:101172569])

HSP 1 Score: 58.9214 bits (141), Expect = 1.012e-8
Identity = 52/235 (22.13%), Postives = 83/235 (35.32%), Query Frame = 1
Query:  835 TEQVECPICETDCEPGTAIVLHNCLHAICKECFRDY----INNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSA-IHENQTCKEY----------------QDELAIKA-----RNDEAAKKDI-------AFLQNLIDTGQAM-------KCPGCQIIVQKKSGCDWMQCNMCKTEICWA 1419
            T   +C IC T       + +H C H  C+ C R++    I       + C +  C       +++ V+ +E F  Y +L L+    +  +  +C  P+C + ++ +   N   C  C    C  C    H    C E                 Q E  IKA     ++    ++ +       A L +L D    M        CP C I ++K  GC  M C  C     W 
Sbjct:  349 TTVFDCGICFTALLGSDCVQIHGCGHVFCQTCLREFCKVQITEGNVQGVTCPQAGCPAAPTPAQVKTVVGEELFSHYDRLLLQFTLDRMSDVIYCPRPSCSSVILLEKSSNVALCSECHFAFCTTCKKNYHGASKCYEEKKIQEESGTTPELSMPQSEEGIKALLEDYKSGSKERRRLLDRRYGSAILASLEDNLNEMWKIDNTQPCPHCYIPIEKNGGCSHMWCTHCNNFFVWG 583          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Match: CUL7 (cullin 9 [Source:NCBI gene;Acc:101168890])

HSP 1 Score: 56.9954 bits (136), Expect = 6.107e-8
Identity = 53/222 (23.87%), Postives = 86/222 (38.74%), Query Frame = 1
Query:  850 CPIC----ETDCEPGTAIVLHNCLHAICKECFRDYIN---------NSQDPLIKCFEENCVGFIEDQEIREVLNDEE-FERYQQLSLRAAESKTGNTFHCKTPN-CVAWVVYDDDVNFFPCPLCKQNNCLLCS--AIHENQTCK---EYQDELAI-KARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGK 1452
            CP+C        EP  ++   +CLH  C+ C+++Y+          N   P+  C  +    F        +L D++   +Y+   LR       N   C  P  C   +  ++  N   C  C  ++C  C+    H   +C    ++ D+    +  + EA  K +A L        + +CP CQ  ++K  GC  M C  C    CW    P W P  K
Sbjct: 2181 CPVCLGPRTGSVEPVPSL---SCLHYCCRSCWQEYLTARIEQNLVMNCNCPITDCQAQPTSHFF-----LSILTDKDTVAKYENALLRGYVECCSNLTWCTNPQGCDQILCKENMGNTGTCSKCCWSSCFSCNFPEAHYPASCSHMSQWMDDGGFYEGMSMEAQSKHLAKLI-------SKRCPSCQAQIEKNEGCLHMTCAKCNHGFCWRCLKP-WKPTHK 2386          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000081060.1 (SMESG000081060.1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 458/460 (99.57%), Postives = 459/460 (99.78%), Query Frame = 1
Query:  142 MSSNNNQNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGKCTPTCGNCH 1521
            MSSNNNQNAV+LYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDKEIEERAKKLEEESKQRLEKEKAENLEKLKKMCKESIALATEQVECPIC TDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGKCTPTCGNCH
Sbjct:    1 MSSNNNQNAVRLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHYLKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIPEYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDKEIEERAKKLEEESKQRLEKEKAENLEKLKKMCKESIALATEQVECPICATDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGKCTPTCGNCH 460          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000013684.1 (SMESG000013684.1)

HSP 1 Score: 306.99 bits (785), Expect = 1.052e-97
Identity = 155/335 (46.27%), Postives = 222/335 (66.27%), Query Frame = 1
Query:  526 IIADVVDV-SKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRV--RGKCTPTCGNCH 1521
            I+ D++ V S   P +GW C  CTF N P+ K+C+VC C+RPE ++IPK +     +  +IK+++++ +R ++LE+   ++ ++E+ ++LEKL ++ KE +   +E   CPIC  D +PG AIVLH+CLH ICKEC  +Y+ N  D  ++C   NC+G +EDQEIR +LND ++ +YQ+L LR AE+K   ++HCK  NC AW+ YD  V  + CP CK+ NC++C  IHE  TC+EYQ    +KA   +    D  F++ +I++G+AMKCPGC I+VQK  GCD + C  C   +CWATKGPRWGPKGKGD SGGC CR     +C P C  CH
Sbjct:  181 ILKDMIIVNSFIHPKIGWVCKFCTFLNTPYTKFCEVCICNRPEKYIIPKYWKPNTQEIEKIKQNEDLSKREEELEQLRIEKEKEEREKHLEKLIQLSKEPVTFTSEVTVCPICLVDYDPGDAIVLHSCLHTICKECLNNYLINVNDAQVRCPTTNCIGLVEDQEIRAILNDSDYIKYQELGLRMAEAKEKFSYHCKEVNCTAWITYDGIVRSYNCPRCKKENCIVCQGIHEGMTCEEYQ---KVKANERQMNPADDLFIKKMIESGEAMKCPGCGILVQKNRGCDGVTCRSCGIMMCWATKGPRWGPKGKGDTSGGCGCRFFWGKRCHPNCHYCH 512          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000013684.1 (SMESG000013684.1)

HSP 1 Score: 306.605 bits (784), Expect = 1.725e-97
Identity = 155/335 (46.27%), Postives = 222/335 (66.27%), Query Frame = 1
Query:  526 IIADVVDV-SKPQPVVGWNCDSCTFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDXXXXXXXXXXXXXXXQRXXXXXXXXXXXXXXMCKESIALATEQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRV--RGKCTPTCGNCH 1521
            I+ D++ V S   P +GW C  CTF N P+ K+C+VC C+RPE ++IPK +     +  +IK+++++ +R ++LE+   ++ ++E+ ++LEKL ++ KE +   +E   CPIC  D +PG AIVLH+CLH ICKEC  +Y+ N  D  ++C   NC+G +EDQEIR +LND ++ +YQ+L LR AE+K   ++HCK  NC AW+ YD  V  + CP CK+ NC++C  IHE  TC+EYQ    +KA   +    D  F++ +I++G+AMKCPGC I+VQK  GCD + C  C   +CWATKGPRWGPKGKGD SGGC CR     +C P C  CH
Sbjct:  194 ILKDMIIVNSFIHPKIGWVCKFCTFLNTPYTKFCEVCICNRPEKYIIPKYWKPNTQEIEKIKQNEDLSKREEELEQLRIEKEKEEREKHLEKLIQLSKEPVTFTSEVTVCPICLVDYDPGDAIVLHSCLHTICKECLNNYLINVNDAQVRCPTTNCIGLVEDQEIRAILNDSDYIKYQELGLRMAEAKEKFSYHCKEVNCTAWITYDGIVRSYNCPRCKKENCIVCQGIHEGMTCEEYQ---KVKANERQMNPADDLFIKKMIESGEAMKCPGCGILVQKNRGCDGVTCRSCGIMMCWATKGPRWGPKGKGDTSGGCGCRFFWGKRCHPNCHYCH 525          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000061950.1 (SMESG000061950.1)

HSP 1 Score: 199.134 bits (505), Expect = 5.981e-58
Identity = 96/226 (42.48%), Postives = 139/226 (61.50%), Query Frame = 1
Query:  838 EQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHEN-QTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTC 1509
            E   C  C      G+ + L NC H  C++C +  IN+SQ   +KC    C   I+D+EIR++LN+ ++E Y +  +  A SK  N FHCKTPNC  + +YD+ +  F CP+C   NC+ C+ +H+N +TCK+YQD        +   K  + ++++ I  G+ MKCP C  +++K SGC+W+QC+ CK E+CW  K PRWGPKG+ DNSGGC+C V GK C P C
Sbjct:  160 EVFTCLTCLKIIPKGSGVKLMNCYHMFCRDCLKGSINSSQIIPVKCLSAECNWEIQDREIRKILNERDYEIYHEKCMNLAISKMKNNFHCKTPNCKYFCIYDEGLKNFTCPICHSLNCINCNVVHKNSETCKQYQD-----GYPNTIDKHTVKYIEDQIKKGKYMKCPACNCLLEKISGCNWVQCSNCKLELCWILKIPRWGPKGRDDNSGGCKCGVNGKPCDPAC 380          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000061945.1 (SMESG000061945.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.255e-52
Identity = 95/226 (42.04%), Postives = 132/226 (58.41%), Query Frame = 1
Query:  838 EQVECPICETDCEPGTAIVLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEEFERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNCLLCSAIHE-NQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPGCQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRGK-CTPTC 1509
            E   C IC      G+ + L NC H  C+ C  + I  S    ++C    C   I+D+EI E+LN+ + E + +  L  A+SK  N FHCKTP+C  + + D D+  F CP+C   NC++C+ IH  +QTC+EYQ      +  D+ +   I +++N I  G  MKC  C  +++K  GC+WM+C  CK E+CW  K PRWGPKGKGDNSGGC+C V  K C PTC
Sbjct:  160 ETFTCLICCKIIPKGSGVKLRNCHHMFCRNCLNESIKTSATIPVQCLNNECNVKIQDREIHEILNERDSEIFNEKCLTLAKSKLENIFHCKTPDCKYFGICDPDLKSFICPICHSLNCIICNVIHNGSQTCEEYQLSKGNYSAVDDMS---IKYIENEIQAGNCMKCVACGCLIKKWGGCNWMKCPQCKLELCWILKIPRWGPKGKGDNSGGCRCGVNNKPCHPTC 382          
The following BLAST results are available for this feature:
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBCK11.184e-8534.94RANBP2-type and C3HC4-type zinc finger containing ... [more]
RBCK11.780e-8435.20RANBP2-type and C3HC4-type zinc finger containing ... [more]
RBCK11.016e-5950.73RANBP2-type and C3HC4-type zinc finger containing ... [more]
RBCK11.016e-5950.73RANBP2-type and C3HC4-type zinc finger containing ... [more]
RNF19B8.354e-1127.91ring finger protein 19B [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F56D2.53.741e-1126.51RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
Y57A10A.311.774e-925.36pep chromosome:WBcel235:II:12289385:12300573:1 gen... [more]
C17H11.62.756e-927.40RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
C17H11.62.756e-927.40RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
C17H11.62.877e-927.40RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ari-24.763e-826.70gene:FBgn0025186 transcript:FBtr0071774[more]
CG123622.126e-626.42gene:FBgn0036082 transcript:FBtr0076281[more]
CG123622.126e-626.42gene:FBgn0036082 transcript:FBtr0076282[more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbck12.355e-9335.99RanBP-type and C3HC4-type zinc finger containing 1... [more]
rbck12.355e-9335.99RanBP-type and C3HC4-type zinc finger containing 1... [more]
shrprbck1r6.340e-8834.08sharpin and rbck1 related [Source:NCBI gene;Acc:56... [more]
rbck11.422e-6253.89RanBP-type and C3HC4-type zinc finger containing 1... [more]
zmp:00000005245.164e-1827.14zmp:0000000524 [Source:ZFIN;Acc:ZDB-GENE-130530-52... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000033448.14.063e-7848.93RanBP-type and C3HC4-type zinc finger containing 1... [more]
ENSXETT00000029029.19.503e-1526.54ring finger protein 14 gene 4 [Source:NCBI gene;Ac... [more]
ENSXETT00000012890.12.195e-1426.54ring finger protein 14 gene 4 [Source:NCBI gene;Ac... [more]
ENSXETT00000012882.11.170e-1224.07ring finger protein 14 gene 4 [Source:NCBI gene;Ac... [more]
znf3472.222e-1225.59zinc finger protein 347 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbck13.296e-8637.12RanBP-type and C3HC4-type zinc finger containing 1... [more]
Rbck13.296e-8637.12RanBP-type and C3HC4-type zinc finger containing 1... [more]
Rbck13.428e-2933.88RanBP-type and C3HC4-type zinc finger containing 1... [more]
Rnf141.601e-1024.07ring finger protein 14 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf142.954e-1024.07ring finger protein 14 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E6ZIJ1|HOIL1_DICLA1.372e-9235.14RanBP-type and C3HC4-type zinc finger-containing p... [more]
sp|A9JTG5|HOIL1_DANRE4.786e-8734.08RanBP-type and C3HC4-type zinc finger-containing p... [more]
sp|Q9WUB0|HOIL1_MOUSE2.305e-8537.12RanBP-type and C3HC4-type zinc finger-containing p... [more]
sp|Q9BYM8|HOIL1_HUMAN5.688e-8534.94RanBP-type and C3HC4-type zinc finger-containing p... [more]
sp|Q62921|HOIL1_RAT1.329e-8437.83RanBP-type and C3HC4-type zinc finger-containing p... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B5M5561.552e-10337.21RanBP-type and C3HC4-type zinc finger containing 1... [more]
M3ZUM24.972e-10337.42RanBP-type and C3HC4-type zinc finger containing 1... [more]
A0A3Q2DNH76.552e-10336.71RanBP-type and C3HC4-type zinc finger containing 1... [more]
A0A3B3XA816.772e-10337.15RanBP-type and C3HC4-type zinc finger containing 1... [more]
A0A087X8X72.350e-10236.94RanBP-type and C3HC4-type zinc finger containing 1... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbck17.839e-9333.90RANBP2-type and C3HC4-type zinc finger containing ... [more]
rbck18.863e-9333.90RANBP2-type and C3HC4-type zinc finger containing ... [more]
rbck17.411e-9235.73RANBP2-type and C3HC4-type zinc finger containing ... [more]
shrprbck1r1.332e-7843.73ranBP-type and C3HC4-type zinc finger-containing p... [more]
shrprbck1r1.776e-7844.72ranBP-type and C3HC4-type zinc finger-containing p... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBCK12.066e-8533.61RANBP2-type and C3HC4-type zinc finger containing ... [more]
zmp:00000005245.277e-1225.23zmp:0000000524 [Source:ZFIN;Acc:ZDB-GENE-130530-52... [more]
ENSPMAT00000006333.19.163e-1124.66pep scaffold:Pmarinus_7.0:GL479789:448:31336:-1 ge... [more]
ENSPMAT00000007741.12.059e-1025.46pep scaffold:Pmarinus_7.0:GL477427:676:25209:1 gen... [more]
rnf19a9.707e-723.79ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HEL14.503e-925.25RING finger ubiquitin ligase (E3); involved in ubi... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO392283.708e-7948.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470225.076e-1423.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374378.361e-823.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470932.057e-727.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315273.394e-724.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbck12.108e-9434.44ranBP-type and C3HC4-type zinc finger-containing p... [more]
shrprbck1r3.988e-9043.79ranBP-type and C3HC4-type zinc finger-containing p... [more]
zmp:00000005241.844e-1022.71ring finger protein 14 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000014493.21.012e-822.13E3 ubiquitin-protein ligase RNF14 [Source:NCBI gen... [more]
CUL76.107e-823.87cullin 9 [Source:NCBI gene;Acc:101168890][more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081060.10.000e+099.57SMESG000081060.1[more]
SMESG000013684.11.052e-9746.27SMESG000013684.1[more]
SMESG000013684.11.725e-9746.27SMESG000013684.1[more]
SMESG000061950.15.981e-5842.48SMESG000061950.1[more]
SMESG000061945.11.255e-5242.04SMESG000061945.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005404 ID=SMED30005404|Name=RanBP-type and C3HC4-type zinc finger containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1702bp
AAATGACATCCTTTTTGTGTTAGTAAATCACAAATAGTTACAAAATCTCA
ACTAGTATTTAATTTAAATTTAAATTTTGCAAATATTAAATTAGTTTATT
TATTTTTATTTGAACAGTCATTTAAAAATAAATTTTATCTCATGAGTTCT
AACAATAATCAAAATGCCGTGAAGTTATATGTTTTTGTGGACAATCTACA
GTATACTAGTGAACGTCCATTAACAGTAATTATAAGTAAATATAAAAGCT
TCCGCGATTTAAAGATTGAATTTGCCGAAAAACAACACTATCTTAAAGAA
GAACAACATTGGGTAATGAACAAAACCTATTGTTACGACGATTTCGAAAT
CAGTGAAATTATCACCAAAATGCCACCATTTAAAAAAGGATATGTAGCGT
TTTTATTCATCTTATCACAAGAAGAGAAGGCAAATATCCCTGAATATTTT
GGTTCGTTTTTAGCAAATAGATATAAGAATGTAGATCAGGAGCATCGTTG
GAATGAGCCGATAAAGTCAATTATGATCATTGCTGATGTTGTTGATGTTT
CTAAACCTCAGCCTGTGGTTGGTTGGAACTGTGATTCTTGTACCTTTTTC
AACAAGCCATTCTTGAAATATTGTGATGTCTGCGGTTGTAGTCGTCCAGA
AAATTTTGTAATTCCTAAAAATTATTATTTCACAAAAGATGATCAAAATC
GAATAAAAAAAGACAAAGAAATTGAAGAGCGGGCAAAAAAGTTAGAAGAA
GAATCGAAACAAAGATTAGAAAAAGAAAAGGCCGAAAATCTAGAAAAATT
GAAAAAGATGTGTAAAGAAAGCATTGCATTGGCAACCGAACAAGTTGAGT
GTCCTATATGTGAAACTGATTGTGAACCCGGAACAGCAATCGTACTTCAC
AATTGTCTTCACGCGATTTGCAAGGAATGTTTCAGAGATTATATAAACAA
TTCTCAAGATCCTTTGATAAAATGTTTCGAAGAAAATTGTGTAGGTTTTA
TTGAGGATCAAGAAATTCGTGAAGTTCTAAATGATGAAGAATTTGAAAGA
TATCAACAATTAAGTCTTAGGGCTGCTGAATCGAAGACTGGGAATACTTT
TCACTGTAAAACACCGAATTGTGTTGCATGGGTAGTATATGATGACGATG
TTAATTTTTTCCCCTGCCCATTATGTAAACAGAACAACTGCTTATTATGT
AGTGCTATTCACGAAAATCAGACCTGTAAAGAATATCAAGATGAATTAGC
AATTAAAGCTCGAAATGATGAAGCAGCCAAAAAAGATATTGCATTTTTAC
AGAATCTTATTGATACTGGCCAAGCTATGAAATGTCCCGGCTGTCAAATC
ATTGTTCAGAAGAAAAGCGGTTGTGATTGGATGCAATGTAACATGTGTAA
AACAGAAATTTGTTGGGCCACAAAAGGACCAAGATGGGGTCCAAAAGGGA
AAGGCGACAATAGTGGTGGATGCCAATGCAGAGTGAGGGGGAAATGTACC
CCAACCTGTGGAAATTGTCATTAAATGTTATGCTCATAGAGAAGTACAGC
GATAGGTAATGCTTGATAGTAAAATATTAGCTGACAGTGCTTTATTATTA
ATAAACAATGAATCTAGATTTTTTGATTTTTTTCAATATGAAAATTTGTT
ATTTTTTTGGATTAATGGAAATGTCTAGGCCATCTGTGAATATAAATTTC
AG
back to top

protein sequence of SMED30005404-orf-1

>SMED30005404-orf-1 ID=SMED30005404-orf-1|Name=SMED30005404-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=461bp
MSSNNNQNAVKLYVFVDNLQYTSERPLTVIISKYKSFRDLKIEFAEKQHY
LKEEQHWVMNKTYCYDDFEISEIITKMPPFKKGYVAFLFILSQEEKANIP
EYFGSFLANRYKNVDQEHRWNEPIKSIMIIADVVDVSKPQPVVGWNCDSC
TFFNKPFLKYCDVCGCSRPENFVIPKNYYFTKDDQNRIKKDKEIEERAKK
LEEESKQRLEKEKAENLEKLKKMCKESIALATEQVECPICETDCEPGTAI
VLHNCLHAICKECFRDYINNSQDPLIKCFEENCVGFIEDQEIREVLNDEE
FERYQQLSLRAAESKTGNTFHCKTPNCVAWVVYDDDVNFFPCPLCKQNNC
LLCSAIHENQTCKEYQDELAIKARNDEAAKKDIAFLQNLIDTGQAMKCPG
CQIIVQKKSGCDWMQCNMCKTEICWATKGPRWGPKGKGDNSGGCQCRVRG
KCTPTCGNCH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0048701embryonic cranial skeleton morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026261RBCK1/SHARPIN
IPR036443Znf_RanBP2_sf
IPR012317Poly(ADP-ribose)pol_cat_dom
IPR001876Znf_RanBP2
IPR013083Znf_RING/FYVE/PHD
IPR002867IBR_dom
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 191..234
NoneNo IPR availableGENE3DG3DSA:1.20.120.1750coord: 379..450
e-value: 1.0E-5
score: 27.4
NoneNo IPR availableGENE3DG3DSA:2.20.28.140coord: 138..200
e-value: 1.5E-14
score: 55.5
NoneNo IPR availablePANTHERPTHR22770UBIQUITIN CONJUGATING ENZYME 7 INTERACTING PROTEIN-RELATEDcoord: 7..460
NoneNo IPR availablePROSITEPS51873TRIADcoord: 233..456
score: 30.289
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 233..311
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 302..369
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 386..435
IPR001876Zinc finger, RanBP2-typeSMARTSM00547zf_4coord: 143..167
e-value: 0.0094
score: 25.1
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 145..164
IPR001876Zinc finger, RanBP2-typePROSITEPS50199ZF_RANBP2_2coord: 138..170
score: 8.31
IPR002867IBR domainPFAMPF01485IBRcoord: 302..362
e-value: 4.5E-6
score: 26.8
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 231..317
e-value: 1.9E-14
score: 55.4
IPR026261RanBP-type and C3HC4-type zinc finger-containing protein 1/SHARPINPANTHERPTHR22770:SF35RANBP-TYPE AND C3HC4-TYPE ZINC FINGER-CONTAINING PROTEIN 1-RELATEDcoord: 7..460
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 237..278
score: 8.786
IPR036443Zinc finger, RanBP2-type superfamilySUPERFAMILYSSF90209Ran binding protein zinc finger-likecoord: 143..168