TYR_PHOSPHATASE_2 domain-containing protein

Overview
NameTYR_PHOSPHATASE_2 domain-containing protein
Smed IDSMED30005382
Length (bp)993
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TYR_PHOSPHATASE_2 domain-containing protein (SMED30005382) t-SNE clustered cells

Violin plots show distribution of expression levels for TYR_PHOSPHATASE_2 domain-containing protein (SMED30005382) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TYR_PHOSPHATASE_2 domain-containing protein (SMED30005382) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TYR_PHOSPHATASE_2 domain-containing protein (SMED30005382) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005382

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005382SMESG000030078.1 Contig1352GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30005382SMESG000030078.1 Contig1352GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30005382SMESG000030078.1 Contig1352GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30005382SMESG000030078.1 Contig1352GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30005382SMESG000030078.1 dd_Smed_v4_6110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005382SMESG000030078.1 dd_Smed_v4_6110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q05918|IPHP_NOSCO (Tyrosine-protein phosphatase OS=Nostoc commune OX=1178 GN=iphP PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.566e-13
Identity = 45/144 (31.25%), Postives = 66/144 (45.83%), Query Frame = 3
Query:  531 SLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSA---------MVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNI 935
            SLGE Y   L   Q  FKQ+F  +    +  ++  C+ GKDRTGI+  LLL L G    +I+  Y  S   L+    +     +      E    P+              +LA L  +YG  E YLKS G++E +I+Q+K  +
Sbjct:  147 SLGEAYVQWLGHSQPQFKQVFQRIAAQQDGAVLFHCTAGKDRTGIIAGLLLDLAGVPKAEIVHNYAISAHYLEGQPKDSDERADHGAGQAEPGDRPQDGGHGRYRAGQHGAVLAALHSQYGGAEGYLKSIGVSEQEIQQLKVRL 290          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5DE24|OCA1_PICGU (Putative tyrosine-protein phosphatase OCA1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) OX=294746 GN=OCA1 PE=3 SV=2)

HSP 1 Score: 51.6026 bits (122), Expect = 1.321e-6
Identity = 19/57 (33.33%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  570 QKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEG 740
            +   K+    + D +N+PM++CC  G+ RTG V+  L +L GW+   + +EY +  G
Sbjct:   94 ETTIKKALELICDRNNYPMLVCCGMGRHRTGTVIGCLRRLQGWNLASVSEEYRRFTG 150          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. TrEMBL
Match: V9L682 (TYR_PHOSPHATASE_2 domain-containing protein OS=Callorhinchus milii OX=7868 GN=LOC103182731 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 4.800e-24
Identity = 80/300 (26.67%), Postives = 136/300 (45.33%), Query Frame = 3
Query:  105 IMELPPCNFRPVFSIHRASAGTNLYRSNAIDDGTVKSAKWLRETIGINSYVDLREGNEFHPMSKLGDYFIQTKLNK-----------PIKNPPGNF------GRRYHVGFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFK-GAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIMK*KF 950
            IM + P N   +  +   S   N+YRS + D  + +  + L+E +GI   +DLR   E    S  G   I     +             K   G        G R  + F T  Y   LL   +   Q  +L+F+ +   ++  +  Q+Y     L+   + + Y  L+D  Q V   I   +++P N P +I C+ GKDRTG+  AL+   VGW  ++II++YT S   +  + +++ + +  K G  E+   + +  +  +L H+   YG+V +YL S G      E++K NI++ K 
Sbjct:   10 IMAIQPQNIPNLRQL--CSGFANIYRSASPDHASEEEVRVLKELLGIRLIIDLRSSEELQDSSHGGRKPIDISYERLKVTEEEMEDTKRKGTTGKLLSGEAQGVRCVLSFATKKYKARLLT-TMSACQKVLLMFMALIDRVFHTWLSQRYLTTRVLNPRGVKQQYTDLVDTSQTVIFTILKLLSEPRNVPALIHCTAGKDRTGVTAALIQLAVGWPKKNIIEDYTASTQGIKPIYEKLHTLYCKKMGFTEDLLLSSKEYIKAVLEHVDNTYGSVNDYLTSFGFGPDDQEKLKRNILRSKI 306          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. TrEMBL
Match: A0A507FTF4 (TYR_PHOSPHATASE_2 domain-containing protein OS=Chytriomyces confervae OX=246404 GN=CcCBS67573_g00324 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 5.275e-24
Identity = 80/277 (28.88%), Postives = 136/277 (49.10%), Query Frame = 3
Query:  114 LPPCNFRPVFSIHRASAGTNLYRSNAIDDGTVKSAKWLRETIGINSYVDLREGNEFHPMSKLGDYFIQTKLNKPIKNPPGNFGRRYHV-GFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKG-AGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIM 938
            +P   F    ++    +   ++RS A    +++SA  L ET+ I S +DLR      P  K  D   +T  +KP +    +    ++V G +  S  W  +   L +   F   + + + +  +     K GG        L  FY  LLD+    F +IF  +T+  +FP++I CS GKDRTGI+ AL+ +L+G  D DI+K+Y  S   L+S++  +    +  G    E+      AM+  L HL  +YG V +YL+S G++  + + ++TN++
Sbjct:    1 MPSAGFEATLNLRPVGSSKRVFRS-AKPGTSLESATELDETLRIASIIDLR-----GPWEKKKDRIPET--DKPAQQLRLSVDLSHNVIGAVLRSLSWRCICVTLYYALTFR--WTMAKRIAVQGSFLNKPGG--------LTRFYIVLLDNHGDEFNRIFRFLTEKSHFPVLIHCSAGKDRTGILSALIHRLMGTPDADILKDYLLSNKGLESVQTLLEKEVDKMGMCVNEFAGCKEEAMIGFLDHLDTRYGGVHSYLESIGVSRAEQDLVRTNLL 259          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. TrEMBL
Match: A0A2P6N9Z3 (Putative tyrosine protein phosphatase 6 OS=Planoprotostelium fungivorum OX=1890364 GN=PROFUN_11514 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.047e-21
Identity = 85/342 (24.85%), Postives = 150/342 (43.86%), Query Frame = 3
Query:   45 LIQIFSWPSDQSANQILNR*IMELPPCNFRPVFSIHRASAGTNL------YRSNAIDDGTVKSAKWLRETIGINSYVDLR---EGNEFH------------PMSKLGDYFIQTKLNK-----------PIKNPPGNFGRR-YHVGFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIMK*KFKNIIQFN 971
            L ++F  P D+ A +I    +      NFR V   +   +G ++      +RS  +DD T +  + L +   I S +DLR   EG++ H             M+K+  + +  +  K            + N  G   R  YH+ F   +Y  N     L F   F ++  +++ +  +  A Q  G +  +    L       +D C     +    M+  DN+P+++ C+ GKDRTG+V A  L + G  DE II +Y +S+  LD  ++ +       G   E+  AP   M   L +++E+YGT+E+YL   G  E   + ++  ++K +  ++   N
Sbjct:  119 LPELFLRPEDRPAAEIFQNIV------NFRDVGLNYNKDSGKDVLHEKIFFRSGRLDDATTRDVELLLKKYDIRSVIDLRAETEGSDGHHTPFFPTTVFDGNMAKMAAHGLAPQPKKQHRISTKKEVLTLPNDQGAAKRSTYHINFAGTNYRINSAWRPLSFKNKFKVVSAMVRGV--KQEAVQIVG-KTIIEPYGLFGLNRDFIDFCGMEICEALKVMSVKDNYPLLVHCTQGKDRTGLVCAFALAVCGASDEHIIMDYHRSQKGLDLQRETMVEEMRKNGLSSEFSDAPWEVMRQTLRYVREEYGTIESYLDKHGFTEKYRQSLRRCLLKNENADVATSN 451          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. TrEMBL
Match: A0A177C1B2 (TYR_PHOSPHATASE_2 domain-containing protein OS=Paraphaeosphaeria sporulosa OX=1460663 GN=CC84DRAFT_1129499 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.554e-21
Identity = 78/263 (29.66%), Postives = 129/263 (49.05%), Query Frame = 3
Query:  174 LYRSNAIDDGTVKSAKWLRETIGINSYVDLREGNEFHPMSKLGDYFIQTK---------LNKPIKNPPGNFGRRYHVGFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNI 935
            LYR    DD T +  + L E   + S +DLR   E    ++  D  I+           + +P+K P   +   Y + F   S+   +LI KL + + F L++L+     YR  A +      ++  + L     + +D C    KQ+F  +   +N+P+++ C+ GKDRTG++V LLL L+  D+  I K+Y  S   L++ + E     +  G  E++   P   + T+ AH++EKYG VE YL S GI   Q+ +IK  +
Sbjct:   35 LYRGARPDDATNEDRRRLVEEYKLKSIIDLRTKTEHIEQAQKRDAKIKASAAVPQSNDAIAEPLKIPGVAY---YEINFNGSSFS-RMLISKLSWTEFFKLVWLMATG--YRKDAIKILAP--HMEEMGLVGLAIASVDVCTSEVKQVFDVLAKEENWPVLVHCTQGKDRTGLIVMLLLFLLEVDEAAIEKDYLLSGPELEAERAERVKEIQSIGLSEQFALCPPDVVSTVHAHVQEKYGGVEAYLLSTGITTEQVARIKRTL 289          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. TrEMBL
Match: A0A178E177 (TYR_PHOSPHATASE_2 domain-containing protein OS=Pyrenochaeta sp. DS3sAY3a OX=765867 GN=IQ07DRAFT_569472 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.423e-21
Identity = 78/259 (30.12%), Postives = 129/259 (49.81%), Query Frame = 3
Query:  177 YRSNAIDDGTVKSAKWLRETIGINSYVDLREGNEFHPMSKLGDYFIQT-----KLNKPIKNPPGNFGRRYHVGFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIM 938
            YRS  +D+ + +  + L    G+ S +DLR   E    ++  D  I++     + N  +  P    G RYH      S    +L+ K  +++ F LI L++    YR  A +      ++  + L     S LD C+   KQ+F    D +N+P+++ C+ GKDRTG+VV L+L L+G D + I ++Y  SE  L S K+E        G  E++   P      +  HL+EKYG VE YL+  G++  ++E +K  ++
Sbjct:   35 YRSARLDEASFQDRQRLTRDYGVKSIIDLRTKTEHIEQAQKRDKKIKSSAAVPQTNNDVAEPLKIAGIRYHEINFNGSAFSRMLLSKTSWSEFFWLIGLMV--CGYRLDAIKILAP--HMEEMGLAGLATSSLDVCKLEVKQVFDAFADEENWPVLVHCTQGKDRTGLVVMLVLFLLGVDQQTIDEDYRLSEAELASEKEERMKEIRSIGLSEQFAVCPPGLAKRVHLHLEEKYGGVEKYLEQVGVSRDKLESVKGRML 289          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Yeast
Match: OCA1 (Putative protein tyrosine phosphatase; required for cell cycle arrest in response to oxidative damage of DNA [Source:SGD;Acc:S000005043])

HSP 1 Score: 48.9062 bits (115), Expect = 2.626e-7
Identity = 16/52 (30.77%), Postives = 33/52 (63.46%), Query Frame = 3
Query:  588 IFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGN 743
            +  T+   +N+P+++CC  G+ RTG V+  L +++GW+   + +EY +  G+
Sbjct:  152 VLQTIVTQENYPLLVCCGMGRHRTGTVIGCLRRIMGWNLASVSEEYRRFTGS 203          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000030078.1 (SMESG000030078.1)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 277/278 (99.64%), Postives = 278/278 (100.00%), Query Frame = 3
Query:  108 MELPPCNFRPVFSIHRASAGTNLYRSNAIDDGTVKSAKWLRETIGINSYVDLREGNEFHPMSKLGDYFIQTKLNKPIKNPPGNFGRRYHVGFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIMK 941
            MELPPCNFRPVFSIHRASAGTNLYRSNAIDDGTVKSAKWLRETIGINSYVDLREGNEFHPMSKLGDYFIQTKLNKPIKNPPGNFGRRYH+GFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIMK
Sbjct:    1 MELPPCNFRPVFSIHRASAGTNLYRSNAIDDGTVKSAKWLRETIGINSYVDLREGNEFHPMSKLGDYFIQTKLNKPIKNPPGNFGRRYHMGFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIMK 278          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000055801.1 (SMESG000055801.1)

HSP 1 Score: 160.229 bits (404), Expect = 3.472e-47
Identity = 98/289 (33.91%), Postives = 142/289 (49.13%), Query Frame = 3
Query:  108 MELPPCNFRPVFSIHRASAGTNLYRSNAIDDGTVKSAKWLRETIGINSYVDLREGNEFHPMSKLGDYF----------IQTKLNK--PIKNPPGNFGRRYHVGFITVSYHWNLLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASLLDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIM 938
            M LPPCNFRP+    R    + +YRSN+IDDG + S +WL   + I   +DLR   EFHP S+L   +           Q  L+K   IK      G R HVGF                                   +Y  +  Q      ++ +FY  L+D+ + V K IF+ M +  NFP++I CS+GKDRTG+V A++L LVG D   II EY KS+  L  +++ +    + K    E+   P  A+   + +LK KYG  + YLK CG+ E  IE+I++N++
Sbjct:    1 MNLPPCNFRPIIPSDRFHCSSMIYRSNSIDDGKLDSVQWLFNEVKIKLILDLRNEIEFHPNSQLDQCYQLIDFDEINEFQQNLDKYDSIK------GYRCHVGF-----------------------------------SYGNFNSQ----FGTVEDFYLHLIDNNKHVMKSIFSFMGNSKNFPILITCSYGKDRTGVVSAMVLDLVGCDQSTIIDEYLKSDALLKPVQERLNQIVKEKNINPEFAKCPIGAIQQFVIYLKTKYGGTKGYLKECGLTELDIEKIRSNLL 244          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000055800.1 (SMESG000055800.1)

HSP 1 Score: 107.071 bits (266), Expect = 1.571e-28
Identity = 51/113 (45.13%), Postives = 72/113 (63.72%), Query Frame = 3
Query:  600 MTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIM 938
            M D  NFPMII C++GKDRTG+V A+ ++L G  D+ II EY++S+  L  +++++ S   F    +E+  +   AM   L +LK KYG  E YLK CG+   QIE+IK NIM
Sbjct:    1 MADESNFPMIIACNYGKDRTGVVAAIAMELTGCSDQLIISEYSQSQNLLKPMQEKLNSEMNFYQIRQEFIQSSPKAMEMFLHYLKNKYGGSEGYLKFCGVTNEQIEKIKNNIM 113          
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000055800.1 (SMESG000055800.1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.314e-24
Identity = 46/105 (43.81%), Postives = 67/105 (63.81%), Query Frame = 3
Query:  624 MIICCSFGKDRTGIVVALLLKLVGWDDEDIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKEKYGTVENYLKSCGINEGQIEQIKTNIM 938
            MII C++GKDRTG+V A+ ++L G  D+ II EY++S+  L  +++++ S   F    +E+  +   AM   L +LK KYG  E YLK CG+   QIE+IK NIM
Sbjct:    1 MIIACNYGKDRTGVVAAIAMELTGCSDQLIISEYSQSQNLLKPMQEKLNSEMNFYQIRQEFIQSSPKAMEMFLHYLKNKYGGSEGYLKFCGVTNEQIEKIKNNIM 105          
The following BLAST results are available for this feature:
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q05918|IPHP_NOSCO1.566e-1331.25Tyrosine-protein phosphatase OS=Nostoc commune OX=... [more]
sp|A5DE24|OCA1_PICGU1.321e-633.33Putative tyrosine-protein phosphatase OCA1 OS=Meye... [more]
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9L6824.800e-2426.67TYR_PHOSPHATASE_2 domain-containing protein OS=Cal... [more]
A0A507FTF45.275e-2428.88TYR_PHOSPHATASE_2 domain-containing protein OS=Chy... [more]
A0A2P6N9Z31.047e-2124.85Putative tyrosine protein phosphatase 6 OS=Planopr... [more]
A0A177C1B21.554e-2129.66TYR_PHOSPHATASE_2 domain-containing protein OS=Par... [more]
A0A178E1772.423e-2130.12TYR_PHOSPHATASE_2 domain-containing protein OS=Pyr... [more]
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
OCA12.626e-730.77Putative protein tyrosine phosphatase; required fo... [more]
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TYR_PHOSPHATASE_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000030078.10.000e+099.64SMESG000030078.1[more]
SMESG000055801.13.472e-4733.91SMESG000055801.1[more]
SMESG000055800.11.571e-2845.13SMESG000055800.1[more]
SMESG000055800.16.314e-2443.81SMESG000055800.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005382 ID=SMED30005382|Name=TYR_PHOSPHATASE_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=993bp
AGAAATTTGAGTCAATCAAAGTCATCCGATTGTCATTCCAAAGTCTAATT
CAGATTTTCTCATGGCCCAGTGATCAAAGTGCAAATCAAATATTGAATCG
ATAAATTATGGAGCTTCCACCGTGCAATTTTAGACCAGTATTTTCTATTC
ACAGAGCGAGTGCTGGGACGAATTTATACCGTTCAAATGCGATTGATGAC
GGCACTGTGAAATCGGCAAAATGGCTGCGTGAAACGATCGGAATAAATTC
CTATGTTGATTTAAGAGAGGGAAATGAATTTCACCCGATGAGTAAATTGG
GCGATTATTTCATTCAAACCAAACTCAACAAACCAATAAAAAATCCTCCC
GGAAATTTCGGCCGTAGATACCACGTGGGATTCATAACGGTCTCATATCA
TTGGAACTTGCTGATCCATAAACTGAAATTCAATCAGATCTTTGTGCTCA
TTTTTCTACTTATCCAGCATTTGATTTACCGGGATTACGCATACCAGAAA
TACGGCGGCCAATGTTACCTCAGCACTCTGAGTTTGGGAGAGTTTTATGC
CTCCCTATTGGACGACTGCCAAAAAGTTTTCAAACAAATCTTTACAACAA
TGACAGATCCGGATAATTTTCCAATGATTATTTGCTGCAGTTTCGGAAAA
GACAGAACGGGAATCGTTGTGGCTTTATTATTGAAATTGGTCGGATGGGA
CGATGAAGACATAATAAAGGAATATACCAAAAGTGAAGGAAACCTGGATT
CTCTGAAAGATGAAATACGGAGCTTTTTCGAATTTAAAGGGGCTGGTGAA
GAGTATTGTCACGCCCCTCGCTCTGCAATGGTTACTATGCTGGCGCATTT
GAAAGAAAAGTATGGCACCGTGGAGAACTACTTAAAAAGTTGCGGTATCA
ATGAAGGTCAAATCGAGCAGATTAAAACAAATATCATGAAGTAGAAGTTT
AAAAATATAATTCAGTTTAATTGAGATAGTATTTAGATTGCAG
back to top

protein sequence of SMED30005382-orf-1

>SMED30005382-orf-1 ID=SMED30005382-orf-1|Name=SMED30005382-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
MELPPCNFRPVFSIHRASAGTNLYRSNAIDDGTVKSAKWLRETIGINSYV
DLREGNEFHPMSKLGDYFIQTKLNKPIKNPPGNFGRRYHVGFITVSYHWN
LLIHKLKFNQIFVLIFLLIQHLIYRDYAYQKYGGQCYLSTLSLGEFYASL
LDDCQKVFKQIFTTMTDPDNFPMIICCSFGKDRTGIVVALLLKLVGWDDE
DIIKEYTKSEGNLDSLKDEIRSFFEFKGAGEEYCHAPRSAMVTMLAHLKE
KYGTVENYLKSCGINEGQIEQIKTNIMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
GO:0008150biological_process
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0016791phosphatase activity
GO:0004725protein tyrosine phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026893Tyr/Ser_Pase_IphP-type
IPR029021Prot-tyrosine_phosphatase-like
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026893Tyrosine/serine-protein phosphatase IphP-typePFAMPF13350Y_phosphatase3coord: 22..277
e-value: 1.5E-36
score: 126.5
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 5..277
e-value: 8.5E-39
score: 135.8
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 7..276
NoneNo IPR availablePANTHERPTHR31126:SF1PTP/DSP-LIKEcoord: 7..276
NoneNo IPR availablePANTHERPTHR31126FAMILY NOT NAMEDcoord: 7..276
NoneNo IPR availableCDDcd18538PFA-DSP_unkcoord: 152..208
e-value: 2.18745E-11
score: 58.5351