SMED30005367

Overview
NameSMED30005367
Smed IDSMED30005367
Length (bp)3670
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005367 (SMED30005367) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005367 (SMED30005367) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005367 (SMED30005367) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005367 (SMED30005367) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005367

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005367h1SMcG0016999 dd_Smed_v4_8816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005367h1SMcG0016999 dd_Smed_v4_8816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005367h1SMcG0016999 dd_Smed_v4_8816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005367h1SMcG0016999 dd_Smed_v4_8816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005367h1SMcG0016999 dd_Smed_v4_8816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005367h1SMcG0016999 Contig38105uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005367h1SMcG0016999 Contig38105newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30005367 vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 338/890 (37.98%), Postives = 526/890 (59.10%), Query Frame = -2
Query:  421 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+  + + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 331/857 (38.62%), Postives = 514/857 (59.98%), Query Frame = -2
Query:  421 QELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2955
            +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+  + + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   15 EELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 841          
BLAST of SMED30005367 vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 327/855 (38.25%), Postives = 505/855 (59.06%), Query Frame = -2
Query:  526 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+  + + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDSG--LLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 844          
BLAST of SMED30005367 vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 327/855 (38.25%), Postives = 505/855 (59.06%), Query Frame = -2
Query:  526 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+  + + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDSG--LLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGCPE-EESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 844          
BLAST of SMED30005367 vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 320/822 (38.93%), Postives = 493/822 (59.98%), Query Frame = -2
Query:  526 QELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2955
            +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+  + + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   15 EELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDSG--LLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 806          
BLAST of SMED30005367 vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 436.032 bits (1120), Expect = 4.158e-136
Identity = 265/781 (33.93%), Postives = 436/781 (55.83%), Query Frame = -2
Query:  532 ACELLEKKVIAIIGPTDS----VAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL-------NKFEQQVVLKKIEFDVNEKYLMKDLKSK-NYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKTLIY---AALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISI--RQLNNRSFFESFNTWN-KTNRMGIPKA---KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFEL 2808
             C  L     AII P        AA  ++SI     +P + +    L P  R  S +L+PH ++ +  +  F K  K + +V+++ + ++L++ TD++       + F  Q+V  K   D   +  +K +K+K +    +++IP      F++ A   +M    Y Y+  + D+  ++++++      NIT+  +  +  +  +D            +++  HK+ I      +   T+I  D+LRLL +       M SI +     C S  +W  G          P+  ++G+   +    +G R N+ + +  R L+    F+ F  W+ +T R+   +A       + L LE   + L+++  ++ PFV+     +NG       ++ G+CI +L KIA    F +T+++V D  YG    +E   KW+G+VG L    ADLAV+SLTI+Y R  VIDFT P+M+LGISI++KKP  ++ + F F+ PLS  VW    ASY  VS  +++I +++PYE +         +   N+F++ NS WFT+ + MQQG ++ P+A STR++ G+WWFF LI+ISSYTANLAA LT  RM  PIENA+DL+ Q KI YG +  G+T +FF +S + TY++M++ M+ +P +FV+S+KEGI RVK+++YA+++ES+  EY  +RDC+LM++GGL+D KGYGIGLP+GS YR+ IS +ILRLQ+  E+  L+  +W+  D    CE P++           +GG+F++L  G+ +  ++ IFEL
Sbjct:   75 VCNCLILGASAIILPEQYDGHLAAAAIVQSIADNTNVPCVSLH---LSPPTRP-STHLHPHLNAKSLAVAAFIKREKWKDVVVVFEEPDELLEITDMITAGHFDPDSFSSQLVRLKHGDDYGNE--LKHIKNKLDRYRIVINIPLQKALHFLEQAANMSMCGVLYHYVVMDMDLVTVDIDSIRGIEDCNITSFGVHDVNSEYIED-----------IRQEIVHKSSIRLPKKGVPYTTSIWIDTLRLLIRS------MKSIQIWDEPRCGS--SWKSGSDIKKRFFENPLAGISGD---LHWAPSGERSNYTLHVYRRTLS----FQKFAEWSSRTRRIASSEAVVIANSSEKLTLE--GKHLKISVYLEAPFVMI---TSNG-------SYEGYCIDLLHKIANILKFTYTIQKVRDNAYGS---KESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVKSSDYAYLMESSMLEYAVERDCELMQIGGLIDQKGYGIGLPKGSPYRELISTAILRLQEKTELTELKEKWWK--DKSVVCEQPKRKDQDDG---ESIGGIFIILVVGLVLTAVLVIFEL 803          
BLAST of SMED30005367 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 396.356 bits (1017), Expect = 5.715e-121
Identity = 258/771 (33.46%), Postives = 413/771 (53.57%), Query Frame = -2
Query:  535 IESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIKEI-IVIIYMKSEDLIKFTDLLNKFEQ---------QVVLKKIEFDVNE-----KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLL-----NLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLS---STLSCNSKTNWAPGISFLNSIKSIPIKS-LTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFN-----TWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPK--EVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQK----NPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFE 2739
            I+S+   F IP L +   SL+         L P   +     ++F  +++    ++ Y    DL   + L+ +++Q          + ++++  + ++     KY+   LK  N +    +I        ++ A   NM    + Y+FTN D+ LL     N+   +F+   NIT L LV       K+  M++ Q                 ALT+E   +            S+ RM  +  +   S++ C+S   W+ G      I+ + +++ LTG+   +    NG RD+         N  F +  N      WN  +R    + + D+   + ++    LRV   ++ PFVI              + + GFCI +L ++ +   FN+T+ EV+D  YG ++ E G  +W G++GAL  H+ADL++S++TITY R  V+DFT PFM+LGISI+  + + +  +  L++FL PLS+ VW  ++ SY  VS+ + ++ + +PYEWYN     +    N +   N+F +LNS WFT+G+ MQQG D++P+A +TR+IA +WW FT IIISSYTA LAAFLTV RM+ PIE+ +DL+ Q KI YG +K G+T  FF +S +  Y++M+  M + +P VFV S++EGI RVK+  YA+++ES+  EYY +RDC+L  +GGLLDSKGYGI LP+GS  RD +S ++L+LQ+   +EAL+  +WR       C  P    +T+S   N + G+F +L  G+ +  L+A  E
Sbjct:  105 IKSMCHYFNIPCLSLQSTSLRDSVSDFVTLLGPSRGAGARATSEFLDSMRWTGFLLAYQHGSDLEDLSPLM-QYKQIVDTGGRRIHIKIRRLPNNTDDYEPFLKYVKTRLKQTNIIIHSNNITV--LYNLLQQARGLNMAEPPFSYVFTNTDLSLLEDFLNNMYGASFH--CNITGLQLV-------KNDPMMKTQ----------------LALTSEAVYVVG---------MSIYRMRELGHAPRQSSIMCDSHDIWSDGRIMNEGIRKLKLRNQLTGD---VQFKSNGERDDIMYHGVGRINSQFVKLGNWSEKRGWNFDSRYA-NRWEFDIDPDSEDLEGLHLRVVVYLEEPFVIK----------TGENQYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYG-IEDESG--RWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRREGPSCGPPPSEKATNSKPQN-IFGIFYVLLTGLIVAFLLACGE 820          
BLAST of SMED30005367 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 397.897 bits (1021), Expect = 9.294e-121
Identity = 258/768 (33.59%), Postives = 409/768 (53.26%), Query Frame = -2
Query:  535 IESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIKEI-IVIIYMKSEDLIKFTDLLNKFEQ---------QVVLKKIEFDVNE-----KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLL-----NLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKS-LTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFN-----TWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPK--EVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQK----NPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFE 2739
            I+S+   F IP L +   SL+         L P   +     ++F  +++    ++ Y    DL   + L+ +++Q          + ++++  + ++     KY+   LK  N +    +I        ++ A   NM    + Y+FTN D+ LL     N+   +F+   NIT L LV       K+  M++ Q                 ALT+E   +        +      R SSI       C+S   W+ G      I+ + +++ LTG+   +    NG RD+         N  F +  N      WN  +R    + + D+   + ++    LRV   ++ PFVI              + + GFCI +L ++ +   FN+T+ EV+D  YG ++ E G  +W G++GAL  H+ADL++S++TITY R  V+DFT PFM+LGISI+  + + +  +  L++FL PLS+ VW  ++ SY  VS+ + ++ + +PYEWYN     +    N +   N+F +LNS WFT+G+ MQQG D++P+A +TR+IA +WW FT IIISSYTA LAAFLTV RM+ PIE+ +DL+ Q KI YG +K G+T  FF +S +  Y++M+  M + +P VFV S++EGI RVK+  YA+++ES+  EYY +RDC+L  +GGLLDSKGYGI LP+GS  RD +S ++L+LQ+   +EAL+  +WR       C  P    +T+S   N + G+F +L  G+ +  L+A  E
Sbjct:  105 IKSMCHYFNIPCLSLQSTSLRDSVSDFVTLLGPSRGAGARATSEFLDSMRWTGFLLAYQHGSDLEDLSPLM-QYKQIVDTGGRRIHIKIRRLPNNTDDYEPFLKYVKTRLKQTNIIIHSNNITV--LYNLLQQARGLNMAEPPFSYVFTNTDLSLLEDFLNNMYGASFH--CNITGLQLV-------KNDPMMKTQ----------------LALTSEAVYVVGMSIYRMRELGHAPRQSSI------MCDSHDIWSDGRIMNEGIRKLKLRNQLTGD---VQFKSNGERDDIMYHGVGRINSQFVKLGNWSEKRGWNFDSRYA-NRWEFDIDPDSEDLEGLHLRVVVYLEEPFVIK----------TGENQYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYG-IEDESG--RWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRREGPSCGPPPSEKATNSKPQN-IFGIFYVLLTGLIVAFLLACGE 820          
BLAST of SMED30005367 vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 387.882 bits (995), Expect = 2.490e-117
Identity = 269/878 (30.64%), Postives = 452/878 (51.48%), Query Frame = -2
Query:  388 IIMKIKEYDSFEASEKACELLEK-KVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDVNEKYLMK------DLKSKNYLH---------FIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDR-SMVEFQRHIATKEKEKHKTLIYAAL-TTETAIIYDSLRLLAKGFASLARMSSIN-LSSTLSCNSKTN---WAPGISFLNSIKSIPIKSLTG-----NSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWN-----KTNRMGIPKAKTDLKDLNLEISKQV---LRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEW-YNSSPC--------------QKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKT----TICIEAKEILRMNIRSCYRSSNKPPVDDSSNGSSP 2856
            +I  I   D ++A +KAC++LEK  ++A++G + +    ++E I     IPFL  +   L+    K  I+ +P    +   + D F + +   IV++Y   E + +   LL   E+   ++     V++   MK      +L+    LH          +VD+   +   F+  +    +    + +L TN ++  +++E   +N A  I+   +      + +D  +   F+ HI   EK   KT     L   E    +D++   A  F  L+    +N +  TL   S  N   +  G S +++I    +  L+G     N +P+       + NF + I+ L      +    W        N  G  KA+      N+++S ++    RVTTI++ P+V+ LK++   +   S   + GFCI +L +++++ GF +T+  V+D KYG  + + G   W G++G ++  +A++AV+ LT+ Y R   +DFT PF++LGISI+YK P  ++ +LFSFL+PLS  +W  +  S I+V+  ++ +  +TPYEW  N S C              Q+ P   SN ++  N++W+ + T ++ G D  P+A STR++ G WW F L+IIS+YTANLAA LTV+R  +PI+N +DL+ Q  I YG ++GG+T  FF++S +A + KM++YM ++  VFV SN +G+ER  + NYA+++EST+ EY TQ++C+L ++GG+L SKGYGI L + S + D IS  IL   K   IE  +  +WR         A        +L +  V G+F+ L  GI +  +V IFEL ++    +K +       +  E +  L MN  S +RS  K    +S+    P
Sbjct:   62 VIEYIDVLDHYDAIKKACKMLEKDHIVALLGGSHAALNAQLERITDDLDIPFL-TAIDDLRTDMGKSKIDFWPR-PQLFEAVVDMFTHWRWNRIVLVYEGDERIRRLEQLLES-EEYASIRFYLIKVHDGDYMKAARQVKELEECRLLHKKDCSEFSRLLVDMNPEHTYTFLLASLQMGLIELKHWFLLTNMELSTMDMELFRYNHARFISPYPVDSTFLTENRDAFNFSHFKEHIT--EKWAMKTDNSRNLKMMEAVFTFDAVYAFANVFNELSSHMQMNDVPQTLCRKSSRNSRKYQHGRSLIDNIVHNDLHGLSGDLRRLNGHPL-------KSNFSMRIQLLGYSGRLDDIGFWEPATNVHVNMSGDSKAQLQR---NVQVSDELKPHFRVTTIMERPYVM-LKKNHYELDANSK--FEGFCIDLLAELSKDLGFTYTIHAVKDGKYG--NDKYGNGSWDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLSLGISILYKVPDDQQPDLFSFLNPLSWQIWTAIATSIITVTLGMYFVANVTPYEWNLNFSCCTAHEPHPAAAFATNQEAPIVMSNNYSFWNTVWYVLSTMLKGGCDFGPRAVSTRLLGGTWWVFYLVIISAYTANLAAVLTVSRPYIPIKNLDDLANQTTISYGTIRGGSTMQFFQESRIAAHVKMWQYM-KDKDVFVTSNGKGVERALSMNYAYLMESTSLEYETQQNCNLTQIGGVLGSKGYGIALAKKSEWTDRISRQILLYAKRGIIEMKKTKWWRSKGAACASTASAVKHDRFALSMYNVAGLFITLGVGIVLAAIVVIFELIHRCHHIAKKEGKPFLEELLYELRFALNMNSLSDHRSRQKMSTCNSNGNGKP 918          
BLAST of SMED30005367 vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 365.155 bits (936), Expect = 1.028e-108
Identity = 213/521 (40.88%), Postives = 309/521 (59.31%), Query Frame = -2
Query:  526 GISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQL--NNRSFFESFN--TW--------NKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRD----ANGITPKSPDAWAGFCIQILKKIAEE-RGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRN-PSVFVKSNKEGIERVKN--TNYAFILESTTNEYY-TQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2025
            G++F N        +LTGN   I  D  G R NF +SI  L  N ++ F S     W        N+T      K++ D KD       QV+ +T ++  PFV+ +KR+    AN    +  + + GFCI +LK +A++   FN+ ++        + D       W G++G L+S +A   V+SLTI  +RERV+DF+ PFM  GISI+ KKP  +E  +FSF+ PLS  +W Y+I +YI VS V+F++ R +PYEW      +     S N F++ N +WFT+  FMQQG DI+P++ S RI +  WWFFT+II+SSYTANLAAFLT+ +M  PIE+ EDL+KQ KI YG   GG+T +FF+ S +  Y++M++YM    P VFV S  EGIERV++    YAF+LE+T NEY  T++ CD M+VG  L+S GYGI  P GS ++D I+ +IL LQ+  E++ L   +W  YD  +         S++SL +++V G+F +L  G+ I +L A+ E  Y
Sbjct:  379 GVAFRNMKIGHKEGTLTGN---IEFDRFGNRKNFDVSIVDLVSNTKATFNSKEVLAWRQGVGFFSNRTVAQHSRKSQNDHKD------NQVIVLTNLV-APFVM-IKRECLEMANLTECQGNNKFEGFCIDLLKLLADKIEEFNYEIKLGTKAGSKQAD-----GSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFMTTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYEWRVEETSRGGFTIS-NDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGGSTASFFKYSSVQIYQRMWRYMESQVPPVFVASYAEGIERVRSHKGRYAFLLEATANEYENTRKPCDTMKVGANLNSIGYGIATPFGSDWKDHINLAILALQERGELKKLENKWW--YDRGQCDAGITVDGSSASLNLSKVAGIFYILMGGMVISMLAALGEFLY 880          
BLAST of SMED30005367 vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 548.51 bits (1412), Expect = 1.827e-178
Identity = 297/835 (35.57%), Postives = 481/835 (57.60%), Query Frame = -2
Query:  526 LNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLLNKFEQQ---VVLKKIEFDVNEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKT---DLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVK--NTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPC--EAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            + IG +F   ++ QELAF++ ++  N         +  +P       I +I  +DSF A ++ C LL   V AI GP  S  A  ++SI     IP L+ +    +  +    +NLYPH ++++    D  ++   +   IIY  ++ +++  +LL         + ++++    + + L+K +K+    H ++D       + +K A    M + Y+ YL T+ D+  +NL+   +    NIT   L+        ++ + +  R  +  EK   ++     + +ETA++YD++ L AK    L     I++   +SC+ ++ W  G S +N +K + +K LT   N I  D  G+R +F + I +L          TWN T   GI   +T     +++   +  + L VTTI+  P+ +   R  + I     D + G+ + ++ +I++  GFN+ ++ V D  YG L+   G  +W G++  L+  +ADLA++ LTIT++RE+ +DFTTPFMNLG+SI+Y+KP  +   LFSFLSPLS+ VW Y+  +Y+ VS +LF++ + TPYEW   +    + E   ++F +LN MWF IG+ MQQG D +PKA STR++AG+WWFFTLI+ISSYTANLAAFLTV RM+ PIE+AEDL+KQ +I YGA+KGG+T  FF  S ++TY++M+ +M +  PSVF  SN EG+ERV     +YAF++EST+ EY T+R+C+L +VGG+LD+K YGI  P  S YR AI+  IL+LQ+  ++  L+  +W++      C  E  + S++ + LG+  VGGVFV+L  G+ +  ++A+ E  +
Sbjct:   30 IKIGGLFHPADDHQELAFRQAVDRIN-------ADRSILPRSKLVAQIERISPFDSFHAGKRVCGLLNIGVAAIFGPQSSHTASHVQSICDNMEIPHLE-NRWDYRLRRESCLVNLYPHPNTLSKAYVDIVRHWGWKTFTIIYENNDGIVRLQELLKAHGMTPFPITVRQLSDSGDYRPLLKQIKNSAEAHIVLDCSTERIHEVLKQAQQIGMMSDYHSYLVTSLDLHTVNLDEFRYG-GTNITGFRLI-------NEKIVSDVVRQWSIDEKGLLRSANLTTVRSETALMYDAVHLFAKALHDLDTSQQIDIHP-ISCDGQSTWQHGFSLINYMKIVEMKGLT---NVIKFDHQGFRTDFMLDIVELTPAGI-RKIGTWNSTLPDGINFTRTFSQKQQEIEANLKNKTLVVTTILSNPYCM---RKESAIPLSGNDQFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTG--EWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEW--PAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNCELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEFVW 836          
BLAST of SMED30005367 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 534.643 bits (1376), Expect = 1.440e-172
Identity = 331/885 (37.40%), Postives = 494/885 (55.82%), Query Frame = -2
Query:  379 LNIGAIFTNGNEDQ--ELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIKEI-IVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDVNEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKTL--IYAA--LTTETAIIYDSLRLLAKGFASLARMSSINLS-STLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKS--ASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCY--RSSNKPPVDDSSNGSSPITY 2994
            + +GAIFT    +   E AFK  I   N       K+K  +P     Y I  +   DSF  ++K C  LE  V AI GPTD++ A  ++SI   + IP ++   + L+   ++ SINLYP ++ +T    D    +    + IIY +   L        + + ++ +++   D + + +++ ++ K     IVD    +   F ++     M    Y Y+FT +D++  +LE+  +N+  NIT   LV ++ +++ +         I   +K +H  L  I  +  + TE+A+++DS+   A G   L   +  N     LSC S   W  GIS  N I +     LTG    +     G R+ F++ I +L      +    W+  + + I    T   D N  I+   L V T  + P+V+ +K D N         + GFCI +LK IA + GF + +E V D  YG    E     W G+V  L+  +ADLAV+S+TI Y RE VIDFT PFMNLGI I++K P  +   LFSF++PL++ +W YV+A+YI VSF LFV+ R +PYEW N  PC K  +   N+F+I NS WF  GTF++QG  + PKATSTRI+ G W+FF LIIISSYTANLAAFLTV RM  PIE+A DL++Q +I YG ++GG+T TFF  S +  Y+KM++YM NR  +VFVK+ ++GI+RV   +YAF++EST  +Y  QRDC+L ++GGLLDSKGYGI  P+GS +RD IS +IL LQ+   I+ L   +W+  +    C   +KS  +  ++LG+  +GGVFV+L  G+A+ ++VAIFE  + + K    +  ++C E  E LR  +  C+  +S ++P      N SS  TY
Sbjct:   43 IRVGAIFTEDERESSIESAFKYAIYRIN-------KEKTLLPNTQLVYDIEYVPRDDSFRTTKKVCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIE-GRIDLEYNSKEFSINLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMYIRQASPD-SYRQVLRAIRQKEIYKIIVDTNPSHIKSFFRSILQLQMNDHRYHYMFTTFDLETYDLEDFRYNSV-NITAFRLVDVDSKRYLEV--------INQMQKLQHNGLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSDQTWNDGISLYNQINAAITDGLTGTVQFV----EGRRNIFKLDILKLKQEKI-QKVGYWHPDDGVNISDP-TAFYDSN--IANITLVVMTREERPYVM-VKEDKN---LTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETN--SWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWK--NTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWNSRKNLNTENQSLCSEMAEELRFAMH-CHGSKSRHRPRKRSCLNCSSVPTY 892          
BLAST of SMED30005367 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 534.643 bits (1376), Expect = 1.440e-172
Identity = 331/885 (37.40%), Postives = 494/885 (55.82%), Query Frame = -2
Query:  379 LNIGAIFTNGNEDQ--ELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIKEI-IVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDVNEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKTL--IYAA--LTTETAIIYDSLRLLAKGFASLARMSSINLS-STLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKS--ASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCY--RSSNKPPVDDSSNGSSPITY 2994
            + +GAIFT    +   E AFK  I   N       K+K  +P     Y I  +   DSF  ++K C  LE  V AI GPTD++ A  ++SI   + IP ++   + L+   ++ SINLYP ++ +T    D    +    + IIY +   L        + + ++ +++   D + + +++ ++ K     IVD    +   F ++     M    Y Y+FT +D++  +LE+  +N+  NIT   LV ++ +++ +         I   +K +H  L  I  +  + TE+A+++DS+   A G   L   +  N     LSC S   W  GIS  N I +     LTG    +     G R+ F++ I +L      +    W+  + + I    T   D N  I+   L V T  + P+V+ +K D N         + GFCI +LK IA + GF + +E V D  YG    E     W G+V  L+  +ADLAV+S+TI Y RE VIDFT PFMNLGI I++K P  +   LFSF++PL++ +W YV+A+YI VSF LFV+ R +PYEW N  PC K  +   N+F+I NS WF  GTF++QG  + PKATSTRI+ G W+FF LIIISSYTANLAAFLTV RM  PIE+A DL++Q +I YG ++GG+T TFF  S +  Y+KM++YM NR  +VFVK+ ++GI+RV   +YAF++EST  +Y  QRDC+L ++GGLLDSKGYGI  P+GS +RD IS +IL LQ+   I+ L   +W+  +    C   +KS  +  ++LG+  +GGVFV+L  G+A+ ++VAIFE  + + K    +  ++C E  E LR  +  C+  +S ++P      N SS  TY
Sbjct:   43 IRVGAIFTEDERESSIESAFKYAIYRIN-------KEKTLLPNTQLVYDIEYVPRDDSFRTTKKVCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIE-GRIDLEYNSKEFSINLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMYIRQASPD-SYRQVLRAIRQKEIYKIIVDTNPSHIKSFFRSILQLQMNDHRYHYMFTTFDLETYDLEDFRYNSV-NITAFRLVDVDSKRYLEV--------INQMQKLQHNGLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSDQTWNDGISLYNQINAAITDGLTGTVQFV----EGRRNIFKLDILKLKQEKI-QKVGYWHPDDGVNISDP-TAFYDSN--IANITLVVMTREERPYVM-VKEDKN---LTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETN--SWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWK--NTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWNSRKNLNTENQSLCSEMAEELRFAMH-CHGSKSRHRPRKRSCLNCSSVPTY 892          
BLAST of SMED30005367 vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 520.39 bits (1339), Expect = 3.324e-167
Identity = 312/833 (37.45%), Postives = 462/833 (55.46%), Query Frame = -2
Query:  526 LNIGAIFTN--GNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIKEI-IVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDVNEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIED----QKFKDRSMVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGI--PKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            + IGAIF+N  G  + ELAF+  I   N         K  +P     Y +  +  +DSFE  +K C+L+   V A+  PTDSV A  I SI     IP +  S           SIN+YP    +     D  + +      I++ K   +I    L   F  +V ++++  D     L  + K K   + I+D      +  +K      M    Y YLFT++D++  +LE+  +N   NIT+  LV   D    Q  KD  +  +  HI  K            L +E A+++DS+ + A G  +L +  S+ L + +SC  + +W  G+S +N + ++  K LTG   PI   ++G R  F++ + +L   S  +    W     + I  P    D   +N+      L V TI++ P+V+       G      + + GFC+ IL+ I+ E GF++ ++ V D+KYG  D E G  +W G+V  L+ +KADLAV S+TITY RE VIDFT PFMNLGISI++K P  +   LFSF++PL++ +W YV+ +Y  VS  ++++G+L+P EW   + C        N+F++ +S WFTIGTFMQQ  DI P+A STRII+  W FF+LII++SYTANLAAFLT  RM  PIENAEDL+ Q +I YG +  G+T TFF  S + TYKK+++ M N+ PS F  + ++GI+RV   NYAF++EST  +Y  QRDC+L ++GGLLD+KGYGI  P+GS +RD IS +IL LQ+  +I+ L   +W+  D     +   K +  +SLG+  +GGVFV+L  GI +  +VA FE +Y
Sbjct:   23 VRIGAIFSNQPGMYNSELAFRYAIHRLN-------MDKSLLPETTVDYYVEYVNRFDSFETVQKVCKLIRVGVQAVFSPTDSVLATHINSICDALDIPNIGRSA-------HDFSINVYPSKQLVNYAFNDVIQYLNWTRFGILHEKENGIINLHQLSRSFHGEVHMRQVSRDSYVSAL-NEFKGKEIHNIIIDTNSNGISILLKNILQQQMNEYKYHYLFTSFDLETYDLEDFKYN-FVNITSFRLVDTADVGVKQILKDIGL--YSHHIFKKPYLNLHIKKSTILESEPALMFDSVYVFAIGLQTLEQSHSLTLLN-ISCEEENSWDGGLSLINYLNAVEWKGLTG---PIQF-KDGQRVQFKLDLIKLKQHSIVK-VGEWTPHGHLNITEPSMFFDAGSMNV-----TLVVITILETPYVMM----HYGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETG--EWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEFWY 820          
BLAST of SMED30005367 vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 513.842 bits (1322), Expect = 8.554e-165
Identity = 311/833 (37.33%), Postives = 461/833 (55.34%), Query Frame = -2
Query:  526 LNIGAIFTN--GNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIKEI-IVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDVNEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIED----QKFKDRSMVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGI--PKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            + IGAIF+N  G  + ELAF+  I   N         K  +P     Y +  +  +DSFE  +K C+L+   V A+  PTDSV A  I SI     IP +  S           SIN+YP    +     D  + +      I++ K   +I    L   F  +V ++++  D     L  + K K   + I+D      +  +K      M    Y YLFT++D++  +LE+  +N   NIT+  LV   D    Q  KD  +  +  HI  K            L +E A+++DS+ + A G  +L +  S+ L + +SC  + +W  G+S +N + ++  K LTG   PI   ++G R  F++ + +L   S  +    W     + I  P    D   +N+      L V TI++ P+V+       G      + + GFC+ IL+ I+ E GF++ ++ V D+KYG  D E G  +W G+V  L+ + ADLAV S+TITY RE VIDFT PFMNLGISI++K P  +   LFSF++PL++ +W YV+ +Y  VS  ++++G+L+P EW   + C        N+F++ +S WFTIGTFMQQ  DI P+A STRII+  W FF+LII++SYTANLAAFLT  RM  PIENAEDL+ Q +I YG +  G+T TFF  S + TYKK+++ M N+ PS F  + ++GI+RV   NYAF++EST  +Y  QRDC+L ++GGLLD+KGYGI  P+GS +RD IS +IL LQ+  +I+ L   +W+  D     +   K +  +SLG+  +GGVFV+L  GI +  +VA FE +Y
Sbjct:   23 VRIGAIFSNQPGMYNSELAFRYAIHRLN-------MDKSLLPETTVDYYVEYVNRFDSFETVQKVCKLIRVGVQAVFSPTDSVLATHINSICDALDIPNIGRSA-------HDFSINVYPSKQLVNYAFNDVIQYLNWTRFGILHEKENGIINLHQLSRSFHGEVHMRQVSRDSYVSAL-NEFKGKEIHNIIIDTNSNGISILLKNILQQQMNEYKYHYLFTSFDLETYDLEDFKYN-FVNITSFRLVDTADVGVKQILKDIGL--YSHHIFKKPYLNLHIKKSTILESEPALMFDSVYVFAIGLQTLEQSHSLTLLN-ISCEEENSWDGGLSLINYLNAVEWKGLTG---PIQF-KDGQRVQFKLDLIKLKQHSIVK-VGEWTPHGHLNITEPSMFFDAGSMNV-----TLVVITILETPYVMM----HYGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETG--EWNGMVAQLMKY-ADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEFWY 819          
BLAST of SMED30005367 vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 324/873 (37.11%), Postives = 511/873 (58.53%), Query Frame = -2
Query:  421 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPK-AKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    +NLYP +SS++  I D     K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+  IK      LTG  N      NG R +F + +  L      E   TW+  + + + +  K    ++   +S + L V+TI++ P+V+  K D         D + G+C+ +L+++A   GF + +  VED +YG  D   G  +W G+V  L+ HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YG V+ G+T TFF+K+ ++TY KM+++M +R  SV VKS +EGIERV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E++   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ + ++++K + C    + LR++++   R  +KP
Sbjct:   36 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIHDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDSFYVNLYPDFSSLSRAILDLVHFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCGHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENSQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSPQITV----SSLQCNRHKPWRFGNRFMTLIKEAHWDGLTGRIN--FNRTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTENQKGKTANVTDSLSNRSLVVSTILEEPYVMFKKSDK---PLYGNDRFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSG--QWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEENKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLEKRSFCSAMVDELRVSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 324/873 (37.11%), Postives = 511/873 (58.53%), Query Frame = -2
Query:  421 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPK-AKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    +NLYP +SS++  I D     K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+  IK      LTG  N      NG R +F + +  L      E   TW+  + + + +  K    ++   +S + L V+TI++ P+V+  K D         D + G+C+ +L+++A   GF + +  VED +YG  D   G  +W G+V  L+ HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YG V+ G+T TFF+K+ ++TY KM+++M +R  SV VKS +EGIERV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E++   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ + ++++K + C    + LR++++   R  +KP
Sbjct:   36 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIHDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDSFYVNLYPDFSSLSRAILDLVHFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCGHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENSQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSPQITV----SSLQCNRHKPWRFGNRFMTLIKEAHWDGLTGRIN--FNRTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTENQKGKTANVTDSLSNRSLVVSTILEEPYVMFKKSDK---PLYGNDRFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSG--QWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEENKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLEKRSFCSAMVDELRVSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. Ensembl Zebrafish
Match: LO018303.1 (glutamate receptor ionotropic, kainate 3 [Source:NCBI gene;Acc:100334689])

HSP 1 Score: 546.969 bits (1408), Expect = 3.724e-176
Identity = 315/865 (36.42%), Postives = 501/865 (57.92%), Query Frame = -2
Query:  526 IIILYQLIFVLNLSHSDTKVQNLNIGAIF--TNGN----EDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSI--NLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFD-VNEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNS--NPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3060
            I++L+ +     + H       + IG IF  T+G       +ELAFK  +   N       + +  +P     Y I +I  YDSFEAS KAC+ L   V+AI GP+ S +++ ++SI     +P + +      P+  + +   NLYP YSS++  I D  + +K +   ++Y  S  LI+  +L+   +++  ++ ++++  D V+ + L+K++K       I D  +   AQ +K A    M T+YY Y+FT  D+  +NLE   F    N+T   ++ +++ +    S+VE    +R I  K       L+   +TT+ A+ YD++ +++  +    +M+     ++L C+    W  G  F++ IK      LTG    N  T    G R +F + I  L      +    W+ +  + I +  + +  ++   +S + L +TTI++ P+V+  K D   +     D + GFCI +LK++A   GF++ +  V D KYG  D +    +W G++  L+ H+ADLAV+ LTIT+ RE+ IDF+ PF+N GISI+Y+KP       FSFL+P++  +W Y++ +Y+ VS VLFVI R +PYEWY++ PC    +   N F +LNS WF +G+ MQQG ++MPKA STRII G+WWFFTLIIISSYTANLAAFLTV RM+ P+++A+DL+KQ KI YG VK GAT +FF+KS ++T++KM+ +M +R  + FVKS ++GI+RV  ++YA ++ESTT EY T+R+C+L +VGG++DSKGYGIG P+GS YRD I+ +IL + +   +  L+  +W        C   E+   T  +GI  +GG+F++L  G+ + + VAI E  Y
Sbjct:   15 IVVLFWIQSSFGMPHV------IRIGGIFEQTDGPVALVSSEELAFKFAVNNIN-------RNRTLLPNTTLTYDIQRINIYDSFEASRKACDQLSLGVVAIFGPSHSSSSNAVQSICNALEVPHIQVR-WKHHPMDNRDTFYANLYPDYSSLSYAILDLVQFLKWKTATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPMDTVDTRPLLKEMKRSREFRIIFDCSHTMAAQILKQAQMMGMMTEYYHYIFTTLDLMAINLEPYRF-CGVNMTGFRILNVDNPQVA--SIVEKWSLERQIPPKPDSG---LLEGIMTTDAALTYDAVHIVSVSYQHAPQMTV----NSLQCHRHKPWRFGGRFMSFIKESHWDGLTGRLCFNRTT----GLRTDFDLDIVSLKEDGL-QKVGKWSASGGLNITEVPRQNGMNITDSLSNRSLVITTILEEPYVMLKKSDKALV---GNDRFEGFCIDLLKELASILGFSYEIHLVPDGKYGFQDDKG---QWNGMIRELMEHRADLAVAPLTITFMREKAIDFSKPFLNTGISILYRKPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSRQSTSFVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKITIAILGILEDGRLHMLKEKWWS----GSSCLEDER-YETGPMGIQNLGGIFIVLASGLVLSVFVAIGEFIY 839          
BLAST of SMED30005367 vs. Ensembl Zebrafish
Match: grik1b (glutamate receptor, ionotropic, kainate 1b [Source:ZFIN;Acc:ZDB-GENE-070821-1])

HSP 1 Score: 542.732 bits (1397), Expect = 6.235e-176
Identity = 324/852 (38.03%), Postives = 495/852 (58.10%), Query Frame = -2
Query:  526 QNLNIGAIF-TNGNED---QELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLS--INLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKT-LIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSF------------FESFNTWNKTNRMGIPKAKTDLKDLNL--EISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3000
            Q L IG IF T  NE    +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS +AC+ L   V A+ GP+ S +   ++SI     +P +  +      +  K S  INLYP Y+SI+  + D  +  K + + ++Y  +  LI+  +L+   +++  ++ ++++     + + L+K++K       I D  Y   A  +K      M T+YY + FT  D+  L+LE   + +  N+T   L+ I++ +    S+VE       +   K +T L    +TTE A++YD++ ++A   A+  R S I +SS L C+    W  G  F++  K      LTG    I    +G R +F + I  L                 ++    WN    + +  +  D K+ N+   ++ + L VTTI++ P+V+  K D         D + G+C+ +LK+++   GF++ V+ V D KYG   +++G  +W G+V  LI H ADLAV+ LTITY RE+VIDF+ PFM LGISI+Y KP      +FSFL+PLS  +W YV+ + + VS VLFVI R TPYEWYN  PC  + +   N F ++NS+WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM+ PI++A+DL+KQ KI YGAV+ G+T TFF+KS ++TY+KM+ +M +R  +  VK+N+EGI+RV  T+YA ++EST+ EY +QR+C+L ++GGL+DSKGYG+G P GS YRD ++ +IL+LQ+  ++  ++  +WR       C   E S   S+LG+  +GG+F++L  G+ + + VAI E  Y
Sbjct:   35 QVLRIGGIFETLENEPISVEELAFKFAVTNIN-------RNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAAVFGPSHSSSVSAVQSICNALEVPHIQ-TRWKHPSVDNKDSFYINLYPDYASISRAVLDIVQFYKWKAVTVVYEDATGLIRLQELIKAPSRYSIKIKIRQLPTGSKDARPLLKEMKKGKEFCVIFDCSYQTAADVLKQLLSMGMMTEYYHFFFTTLDLYSLDLEPFRY-SGVNMTGFRLLNIDNPQVA--SVVEKWSMERLQAPPKPETGLQDGMMTTEAALMYDAVYMVA---AASQRASQITVSS-LQCHRHKPWRFGSRFISMFKEAQWNGLTGQI--IINKTDGLRKDFDLDIISLKEDGLEKPLESGRFNKVWKKIGVWNSNTGLNLTDSNKD-KNTNVTDSMANRTLIVTTILENPYVMYKKSDK---PLYGNDRFEGYCLDLLKELSNILGFSYEVKLVTDGKYGA-QNDKG--EWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREGIQRVLTTDYALLMESTSIEYISQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWR----GNGC-PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFIY 857          
BLAST of SMED30005367 vs. Ensembl Zebrafish
Match: grik1b (glutamate receptor, ionotropic, kainate 1b [Source:ZFIN;Acc:ZDB-GENE-070821-1])

HSP 1 Score: 538.11 bits (1385), Expect = 1.166e-174
Identity = 315/833 (37.82%), Postives = 486/833 (58.34%), Query Frame = -2
Query:  526 QELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLS--INLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKT-LIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSF------------FESFNTWNKTNRMGIPKAKTDLKDLNL--EISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2955
            +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS +AC+ L   V A+ GP+ S +   ++SI     +P +  +      +  K S  INLYP Y+SI+  + D  +  K + + ++Y  +  LI+  +L+   +++  ++ ++++     + + L+K++K       I D  Y   A  +K      M T+YY + FT  D+  L+LE   + +  N+T   L+ I++ +    S+VE       +   K +T L    +TTE A++YD++ ++A   A+  R S I +SS L C+    W  G  F++  K      LTG    I    +G R +F + I  L                 ++    WN    + +  +  D K+ N+   ++ + L VTTI++ P+V+  K D         D + G+C+ +LK+++   GF++ V+ V D KYG   +++G  +W G+V  LI H ADLAV+ LTITY RE+VIDF+ PFM LGISI+Y KP      +FSFL+PLS  +W YV+ + + VS VLFVI R TPYEWYN  PC  + +   N F ++NS+WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM+ PI++A+DL+KQ KI YGAV+ G+T TFF+KS ++TY+KM+ +M +R  +  VK+N+EGI+RV  T+YA ++EST+ EY +QR+C+L ++GGL+DSKGYG+G P GS YRD ++ +IL+LQ+  ++  ++  +WR       C   E S   S+LG+  +GG+F++L  G+ + + VAI E  Y
Sbjct:   15 EELAFKFAVTNIN-------RNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAAVFGPSHSSSVSAVQSICNALEVPHIQ-TRWKHPSVDNKDSFYINLYPDYASISRAVLDIVQFYKWKAVTVVYEDATGLIRLQELIKAPSRYSIKIKIRQLPTGSKDARPLLKEMKKGKEFCVIFDCSYQTAADVLKQLLSMGMMTEYYHFFFTTLDLYSLDLEPFRY-SGVNMTGFRLLNIDNPQVA--SVVEKWSMERLQAPPKPETGLQDGMMTTEAALMYDAVYMVA---AASQRASQITVSS-LQCHRHKPWRFGSRFISMFKEAQWNGLTGQI--IINKTDGLRKDFDLDIISLKEDGLEKPLESGRFNKVWKKIGVWNSNTGLNLTDSNKD-KNTNVTDSMANRTLIVTTILENPYVMYKKSDK---PLYGNDRFEGYCLDLLKELSNILGFSYEVKLVTDGKYGA-QNDKG--EWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREGIQRVLTTDYALLMESTSIEYISQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWR----GNGC-PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFIY 818          
BLAST of SMED30005367 vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 347/909 (38.17%), Postives = 530/909 (58.31%), Query Frame = -2
Query:  421 LMNSLWIIILYQLIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKT-------NRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDA-WAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMN-RNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3078
            L NS +   L  +  ++ + ++      L  G IF    +     +ELAF+  +   N       + +  +P     Y   +I  YDSFEAS KACE L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + I Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++ IE+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ T       N+ G P   TD       +S + L VTTI++ P+V+  K D     P    A + G+CI +L+K+++  GF + V  VED KYG  D  +   +W G+V  L+ HKADLAV+ L ITY RE+VIDFT PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS + TY+KM+ +MN R+ SV VK+N+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+   +  ++  +WR     +     E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:    8 LTNSFFRCTLRFVACMVWIGYTQGTTHVLRFGGIFEYVESGPFGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQRINLYDSFEASRKACEQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTIAYDDSTGLIRLQELIKAPSRYNLRLKIRQLPIDTKDAKPLLKEMKRGKEFHVIFDCSHDMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNIENSQV--LSIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGARFISLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPTSGLNMTENQKGKPANITD------SLSNRSLIVTTILEEPYVMFKKSDK----PLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKD--DTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNGCPE-----EESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 340/864 (39.35%), Postives = 514/864 (59.49%), Query Frame = -2
Query:  421 QELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKT-------NRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDA-WAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMN-RNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2955
            +ELAF+  +   N       + +  +P     Y   +I  YDSFEAS KACE L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + I Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++ IE+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ T       N+ G P   TD       +S + L VTTI++ P+V+  K D     P    A + G+CI +L+K+++  GF + V  VED KYG  D  +   +W G+V  L+ HKADLAV+ L ITY RE+VIDFT PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS + TY+KM+ +MN R+ SV VK+N+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+   +  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   31 EELAFRFAVNTIN-------RNRTLLPNTTLTYDTQRINLYDSFEASRKACEQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTIAYDDSTGLIRLQELIKAPSRYNLRLKIRQLPIDTKDAKPLLKEMKRGKEFHVIFDCSHDMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNIENSQV--LSIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGARFISLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPTSGLNMTENQKGKPANITD------SLSNRSLIVTTILEEPYVMFKKSDK----PLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKD--DTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 857          
BLAST of SMED30005367 vs. Ensembl Xenopus
Match: ugt2a1 (UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus [Source:Xenbase;Acc:XB-GENE-954008])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 332/859 (38.65%), Postives = 513/859 (59.72%), Query Frame = -2
Query:  421 EDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLS--INLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPK-AKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPK-SPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2961
            E+Q   F   I   N  L         +P     Y I +I  YDSFEA+ KAC+ L   V+AI GP+ S +++ ++SI     +P + +      P+  + S  +NLYP Y+S++  I D  + +K     ++Y  S  LI+  +L+    ++  ++ ++++  +  + + L+K++K       I D  +   AQ ++ A    M T+YY Y+FT  D+  L+LE   + +  N+T   ++ +++      S+V+    +RH AT + E    L+   +TT+ A+ YD++ +++  +    +M+     ++L C+    W  G  F+N IK    + LTG    +    +G R +F + I  L      E   TWN ++ + I + A+    +++  ++ + L VTT+++ P+V+  + D    TP    D + GFCI +LKKIAE  GF++ +  VED KYG  D E+G  +W GLV  LI HKADLAV+ LTIT+ RE+VIDF+ PFM LGISI+Y+K       +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWY++ PC    +   N F +LNS WF +G  MQQG ++MPKA STRII G+WWFFTLIIISSYTANLAAFLTV RM   I++A+DL+KQ KI YGAV  GAT  FF+KS ++T++KM+ +M+  PS  VKSN+EGI+RV + +YA ++EST  EY TQR+C+L ++GGL+DSKGYGIG P GS YRD IS +IL+LQ++ EI  ++  +WR     +     EK+   S+LGI  +GG+F++L  G+ + ++VA+ E  YK  K ++ ++ + C    + +R+++    R  +KP
Sbjct:   28 EEQAFRFSASIINRNRTL---------LPNTTLTYDIQRINLYDSFEANRKACDQLALGVVAIFGPSHSSSSNAVQSICNALEVPHIQVR-WKHHPLDNRDSFYVNLYPDYASLSHAILDLVQFLKWRSATVVYDDSTGLIRLQELIMAPARYNIRLKIRQLPPESEDARPLLKEMKRGREFRIIFDCSHTMAAQILRQAMAMGMMTEYYHYIFTTLDLYALDLEPYRY-SGVNLTGFRILNVDNPYVS--SIVDKWSMERHQATPKPES--GLLDGIMTTDAALTYDAVHIVSVCYQRAPQMTV----NSLQCHRHKAWRFGSRFMNFIKEAQWEGLTGRI--VFNKTSGLRTDFDLDIISLKEDGL-EKVGTWNPSDGLNITETARGRGPNISESLTNRTLIVTTVLEEPYVMFKRSD----TPLFGKDRFEGFCIDLLKKIAEILGFDYDIRLVEDAKYGSQD-EKG--QWNGLVKELIDHKADLAVAPLTITHVREKVIDFSKPFMTLGISILYRKANGTAPSVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGTDVVENNFTLLNSFWFAVGALMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESAIDSADDLAKQTKIEYGAVVDGATMNFFKKSHISTFEKMWAFMSSRPSALVKSNEEGIQRVLSADYALLMESTAIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDRISIAILQLQEADEIHKMKERWWRSGGCPE-----EKNKEASALGIQNMGGIFIVLAGGLILSVVVAMAEFVYKLRKTAEREQRSFCSTMADEIRLSLTCQRRVKHKP 852          
BLAST of SMED30005367 vs. Ensembl Xenopus
Match: ugt2a1 (UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus [Source:Xenbase;Acc:XB-GENE-954008])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 341/908 (37.56%), Postives = 528/908 (58.15%), Query Frame = -2
Query:  421 SLWIIIL----YQLIFVLNLSHSDTKVQNLNIGAIFTN---------GNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLS--INLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPK-AKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPK-SPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3069
            SLW ++L        ++  L         + IG IF +           E+Q   F   I   N  L         +P     Y I +I  YDSFEA+ KAC+ L   V+AI GP+ S +++ ++SI     +P + +      P+  + S  +NLYP Y+S++  I D  + +K     ++Y  S  LI+  +L+    ++  ++ ++++  +  + + L+K++K       I D  +   AQ ++ A    M T+YY Y+FT  D+  L+LE   + +  N+T   ++ +++      S+V+    +RH AT + E    L+   +TT+ A+ YD++ +++  +    +M+     ++L C+    W  G  F+N IK    + LTG    +    +G R +F + I  L      E   TWN ++ + I + A+    +++  ++ + L VTT+++ P+V+  + D    TP    D + GFCI +LKKIAE  GF++ +  VED KYG  D E+G  +W GLV  LI HKADLAV+ LTIT+ RE+VIDF+ PFM LGISI+Y+K       +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWY++ PC    +   N F +LNS WF +G  MQQG ++MPKA STRII G+WWFFTLIIISSYTANLAAFLTV RM   I++A+DL+KQ KI YGAV  GAT  FF+KS ++T++KM+ +M+  PS  VKSN+EGI+RV + +YA ++EST  EY TQR+C+L ++GGL+DSKGYGIG P GS YRD IS +IL+LQ++ EI  ++  +WR     +     EK+   S+LGI  +GG+F++L  G+ + ++VA+ E  YK  K ++ ++ + C    + +R+++    R  +KP
Sbjct:    7 SLWRMVLQYWAVWFCYIFWLQSCQGMPHVIRIGGIFEHLEGPTGQLVSAEEQAFRFSASIINRNRTL---------LPNTTLTYDIQRINLYDSFEANRKACDQLALGVVAIFGPSHSSSSNAVQSICNALEVPHIQVR-WKHHPLDNRDSFYVNLYPDYASLSHAILDLVQFLKWRSATVVYDDSTGLIRLQELIMAPARYNIRLKIRQLPPESEDARPLLKEMKRGREFRIIFDCSHTMAAQILRQAMAMGMMTEYYHYIFTTLDLYALDLEPYRY-SGVNLTGFRILNVDNPYVS--SIVDKWSMERHQATPKPES--GLLDGIMTTDAALTYDAVHIVSVCYQRAPQMTV----NSLQCHRHKAWRFGSRFMNFIKEAQWEGLTGRI--VFNKTSGLRTDFDLDIISLKEDGL-EKVGTWNPSDGLNITETARGRGPNISESLTNRTLIVTTVLEEPYVMFKRSD----TPLFGKDRFEGFCIDLLKKIAEILGFDYDIRLVEDAKYGSQD-EKG--QWNGLVKELIDHKADLAVAPLTITHVREKVIDFSKPFMTLGISILYRKANGTAPSVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGTDVVENNFTLLNSFWFAVGALMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESAIDSADDLAKQTKIEYGAVVDGATMNFFKKSHISTFEKMWAFMSSRPSALVKSNEEGIQRVLSADYALLMESTAIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDRISIAILQLQEADEIHKMKERWWRSGGCPE-----EKNKEASALGIQNMGGIFIVLAGGLILSVVVAMAEFVYKLRKTAEREQRSFCSTMADEIRLSLTCQRRVKHKP 880          
BLAST of SMED30005367 vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 340/864 (39.35%), Postives = 514/864 (59.49%), Query Frame = -2
Query:  421 QELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKT-------NRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDA-WAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMN-RNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2955
            +ELAF+  +   N       + +  +P     Y   +I  YDSFEAS KACE L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + I Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++ IE+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ T       N+ G P   TD       +S + L VTTI++ P+V+  K D     P    A + G+CI +L+K+++  GF + V  VED KYG  D  +   +W G+V  L+ HKADLAV+ L ITY RE+VIDFT PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS + TY+KM+ +MN R+ SV VK+N+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+   +  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   31 EELAFRFAVNTIN-------RNRTLLPNTTLTYDTQRINLYDSFEASRKACEQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTIAYDDSTGLIRLQELIKAPSRYNLRLKIRQLPIDTKDAKPLLKEMKRGKEFHVIFDCSHDMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNIENSQV--LSIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGARFISLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPTSGLNMTENQKGKPANITD------SLSNRSLIVTTILEEPYVMFKKSDK----PLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKD--DTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 857          
BLAST of SMED30005367 vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 338/890 (37.98%), Postives = 527/890 (59.21%), Query Frame = -2
Query:  421 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ ++ + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 338/890 (37.98%), Postives = 527/890 (59.21%), Query Frame = -2
Query:  421 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ ++ + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 327/855 (38.25%), Postives = 506/855 (59.18%), Query Frame = -2
Query:  526 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ ++ + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDSG--LLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 844          
BLAST of SMED30005367 vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 327/855 (38.25%), Postives = 506/855 (59.18%), Query Frame = -2
Query:  526 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ ++ + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDSG--LLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGCPE-EESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 844          
BLAST of SMED30005367 vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 327/855 (38.25%), Postives = 506/855 (59.18%), Query Frame = -2
Query:  526 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ ++ + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDSG--LLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGCPE-EESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 844          
BLAST of SMED30005367 vs. UniProt/SwissProt
Match: sp|P39087|GRIK2_MOUSE (Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 338/890 (37.98%), Postives = 527/890 (59.21%), Query Frame = -2
Query:  421 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+ ++ + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. UniProt/SwissProt
Match: sp|P42260|GRIK2_RAT (Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 338/890 (37.98%), Postives = 526/890 (59.10%), Query Frame = -2
Query:  421 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+  + + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. UniProt/SwissProt
Match: sp|Q13002|GRIK2_HUMAN (Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens OX=9606 GN=GRIK2 PE=1 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 338/890 (37.98%), Postives = 526/890 (59.10%), Query Frame = -2
Query:  421 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+  + + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. UniProt/SwissProt
Match: sp|Q38PU3|GRIK2_MACFA (Glutamate receptor ionotropic, kainate 2 OS=Macaca fascicularis OX=9541 GN=GRIK2 PE=2 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 337/890 (37.87%), Postives = 525/890 (58.99%), Query Frame = -2
Query:  421 LIFVLNLSHSDTKVQNLNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 3042
            L+ +L + +S      L  G IF    +     +ELAF+  +   N       + +  +P     Y   KI  YDSFEAS+KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D  +  K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ +++       +M+     S+L CN    W  G  F++ IK    + LTG    IT ++ NG R +F + +  L      E   TW+  + + + ++ K    ++   +S + L VTTI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG  D   G  +W G+V  LI HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W YV+ + + VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  M+QG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAV+ GAT TFF+KS ++TY KM+ +M +R  SV VKSN+EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSKGYG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ K ++++K + C    E LRM+++   R  +KP
Sbjct:   20 LLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTIN-------RNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENTQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTV----SSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGR---ITFNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANG--QWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMRQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKP 879          
BLAST of SMED30005367 vs. UniProt/SwissProt
Match: sp|P42264|GRIK3_RAT (Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 324/872 (37.16%), Postives = 516/872 (59.17%), Query Frame = -2
Query:  421 LNIGAIF--TNGNEDQEL-AFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRK--LSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPK-AKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2994
            + IG IF   +G   Q + A +     + NI+    + +  +P     Y I +I  +DSFEA++KAC+ L   V+AI GP+     + ++SI     +P + +      P+  K    +NLYP Y+S++  I D  +++K     ++Y  S  LI+  +L+   +++  ++ ++++  D ++ + L+K++K       I D  +   AQ +K A    M T+YY ++FT  D+  L+LE   + +  N+T   ++ +++      ++VE    +R  A    E    L+   + T+ A++YD++ +++  +   ++M+     ++L C+    W  G  F+N IK    + LTG    +    +G R +F + I  L      E    W+  + + I + AK    ++   ++ + L VTT+++ PFV+  K D    T    D + G+CI +LK++A   GF++ +  VED KYG  D +    +W G+V  LI HKADLAV+ LTIT+ RE+ IDF+ PFM LG+SI+Y+KP      +FSFL+PLS  +W YV+ +Y+ VS VLFVI R +PYEWY++ PC    E   N F +LNS WF +G+ MQQG ++MPKA STRII G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YGAVK GAT TFF+KS ++T++KM+ +M+  PS  VK+N+EGI+R    +YA ++ESTT EY TQR+C+L ++GGL+DSKGYGIG P GS YRD I+ +IL+LQ+  ++  ++  +WR     +     E++   S+LGI ++GG+F++L  G+ + +LVA+ E  YK  K ++ ++ + C    + +R ++    R  +KP
Sbjct:   36 IRIGGIFEYADGPNAQVMNAEEHAFRFSANIIN---RNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLR-WKHHPLDNKDTFYVNLYPDYASLSHAILDLVQSLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRY-SGVNLTGFRILNVDNAHVS--AIVEKWSMERLQAAPRAES--GLLDGVMMTDAALLYDAVHIVSVCYQRASQMTV----NSLQCHRHKPWRFGGRFMNFIKEAQWEGLTGRI--VFNKTSGLRTDFDLDIISLKEDGL-EKVGVWSPADGLNITEVAKGRGPNVTDSLTNRSLIVTTLLEEPFVMFRKSDR---TLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKG---QWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRTLTADYALLMESTTIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKEKWWRGSGCPE-----EENKEASALGIQKIGGIFIVLAAGLVLSVLVAVGEFIYKLRKTAEREQRSFCSTVADEIRFSLTCQRRLKHKP 880          
BLAST of SMED30005367 vs. TrEMBL
Match: A0A5K4ES97 (Putative glutamate receptor, kainate OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 391/855 (45.73%), Postives = 559/855 (65.38%), Query Frame = -2
Query:  532 IILYQLIFVLNLSHSDTKVQNLNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK--EIIVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDV---NEKYLMKDLK-SKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALV-PI-EDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALT-TETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLK-DLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKS--PDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCE-APEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFEL 3057
            II  QL  + + ++  T+   L IGA+    +  QE+ FKK I+ AN +L +          F    II  I   DSFEA+ KAC+L+E++VIAI GP+   A+  ++++  QFGIP L +         R  ++N++PHY +    + D+ +  +  + + +IY + E L+KF  LL  F+Q ++L+K  +DV   N+KY++K  K ++ +  FIVDIP+W   +F+  A+ YNMT+QYY Y+FT+WD+QL++ +       ANITT  ++ P+ ED  +   ++++  R  A ++K   ++     ++ T +A++YD L LLA G  S +R ++I     LSC+    W PG++ +N IK++   S  G + P   D +GWR N  + I +L+ R+ F+ +  WN    + + K  +  K +   E+  +VLR+TT  + P+++   +   G  PKS  P  W GFCI +L  I+E+  F +T+  V D  YG +   +GV  W G+V  L + +ADLAV S TITYDRERVIDFTTPFM LGISIIYK+P  KE  LFSFL+PLS PVWGY++A+ I VS VLFV+ R +PYEW    PC  + +   N FN+ NS+WFT G+ MQ+G DI+P ATSTRIIAG WWFFTLI+ISSYTANLAAFLTVARM  PIENAEDL+KQ KI YG+++GG+T  FFE+S+ +TYK+M+++M+    + + +  E I+RVK   YAF+LEST NEYYTQRDC+LM+VGGLLDSKGYGIGLPEGS+YRD ISE+IL+LQKSQ +E L+ Y+WR++DI+KPC+ +P KS+  +SLG+ +VGG FVML  G+ + LLV + E 
Sbjct:    8 IIFIQLSCIYSQTYESTQ---LIIGALIKKDDVAQEICFKKSIQAANKLLQQHDSTNHR---FQLIPIIETIDGDDSFEATRKACQLIERQVIAIYGPSTPYASSAVQALCNQFGIPHLQID-WGYHQTSRGYALNVHPHYLAFGQALYDYVQKAEYWDTVAVIYSREESLLKFDYLLRTFDQPLILRK--WDVSNDNQKYVIKQFKITQTHFRFIVDIPFWEIQEFLTLANAYNMTSQYYSYVFTDWDVQLVDPKAFESVQGANITTFTILHPMNEDSGYGVAALLDEIRVTALQDKRFTRSSTSRRISPTHSALLYDGLSLLAMGVLSSSRSTNILPPVGLSCSVNRVWNPGLTLINDIKAVHPTSFRGLTGPFQFDGHGWRSNAHLIILELS-RNGFQEYGHWNMDKGLVVTKNFSLTKQEYQSELKGKVLRITTQEEKPYMMYKGKTLPG-QPKSTDPKDWEGFCISLLNYISEDLQFTYTINLVPDSTYGNMKIVDGVETWDGMVQELRTRRADLAVGSFTITYDRERVIDFTTPFMYLGISIIYKRPEDKESHLFSFLTPLSPPVWGYILAALIMVSLVLFVVARFSPYEWKVKHPCIVDSDVVENNFNVSNSLWFTFGSLMQKGSDILPHATSTRIIAGFWWFFTLIVISSYTANLAAFLTVARMVAPIENAEDLAKQTKIKYGSIQGGSTTAFFEESNFSTYKRMWQFMSSQKGLLMNNTVEAIKRVKREEYAFLLESTMNEYYTQRDCELMQVGGLLDSKGYGIGLPEGSKYRDPISETILKLQKSQVLEQLKFYWWRKHDIEKPCDTSPTKSSDANSLGVEKVGGCFVMLLIGMVVSLLVGLLEF 851          
BLAST of SMED30005367 vs. TrEMBL
Match: A0A4Z2DUZ1 (Glutamate receptor ionotropic, kainate 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_004199 PE=3 SV=1)

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 390/855 (45.61%), Postives = 559/855 (65.38%), Query Frame = -2
Query:  532 IILYQLIFVLNLSHSDTKVQNLNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK--EIIVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDV---NEKYLMKDLK-SKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALV-PI-EDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALT-TETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLK-DLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKS--PDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCE-APEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFEL 3057
            II  QL  + + ++  T+   L IGA+    +  QE+ FKK I+ AN +L +          F    II  I   DSFEA+ KAC+L+E++VIAI GP+   A+  ++++  QFGIP L +         R  ++N++PHY +    + D+ +  +  + + +IY + E L+KF  LL  F+Q ++L+K  +DV   N+KY++K  K ++ +  FIVD+P+W   +F+  A+ YNMT+QYY Y+FT+WD+QL++ +       ANITT  ++ P+ ED  +   ++++  R  A ++K   ++     ++ T +A++YD L LLA G  S +R ++I     LSC+    W PG++ +N IK++   S  G + P   D +GWR N  + I +L+ R+ F+ +  WN    + + K  +  K +   E+  +VLR+TT  + P+++   +   G  PKS  P  W GFCI +L  I+E+  F +T+  V D  YG +   +GV  W G+V  L + +ADLAV S TITYDRERVIDFTTPFM LGISIIYK+P  KE  LFSFL+PLS PVWGY++A+ I VS VLFV+ R +PYEW    PC  + +   N FN+ NS+WFT G+ MQ+G DI+P ATSTRIIAG WWFFTLI+ISSYTANLAAFLTVARM  PIENAEDL+KQ KI YG+++GG+T  FFE+S+ +TYK+M+++M+    + + +  E I+RVK   YAF+LEST NEYYTQRDC+LM+VGGLLDSKGYGIGLPEGS+YRD ISE+IL+LQKSQ +E L+ Y+WR++DI+KPC+ +P KS+  +SLG+ +VGG FVML  G+ + LLV + E 
Sbjct:    8 IIFIQLSCICSQTYESTQ---LIIGALIEKDDVAQEICFKKSIQAANKLLQQHDSTNHR---FQLIPIIETIDGDDSFEATRKACQLVERQVIAIYGPSTPHASSAVQALCNQFGIPHLQID-WGYHQTSRGYALNIHPHYLAFGQALYDYVQKAEYWDTVAVIYSREESLLKFDYLLRTFDQPLMLRK--WDVSNDNQKYVIKQFKITQTHFRFIVDLPFWEVQEFLALANAYNMTSQYYSYVFTDWDVQLVDPKAFESVQGANITTFTILHPMNEDSGYGVAALLDDIRVTALQDKRFTRSSTSRRISPTHSALLYDGLSLLAMGVLSSSRSTNILPPVGLSCSVNRVWNPGLTLINDIKAVHPTSFRGLTGPFQFDGHGWRSNVHLIILELS-RNGFQEYGYWNMDKGLVVTKNFSLTKQEYQSELKGKVLRITTQEEKPYMMYKGKTLPG-QPKSTDPKDWEGFCISLLNYISEDLQFTYTINLVPDSTYGNMKIVDGVETWDGMVQELRTRRADLAVGSFTITYDRERVIDFTTPFMYLGISIIYKRPEDKESHLFSFLTPLSPPVWGYILAALIMVSLVLFVVARFSPYEWKVKHPCNVDSDVVENNFNVSNSLWFTFGSLMQKGSDILPHATSTRIIAGFWWFFTLIVISSYTANLAAFLTVARMVAPIENAEDLAKQTKIKYGSIQGGSTTAFFEESNFSTYKRMWQFMSSQKGLLMNNTLEAIQRVKREEYAFLLESTMNEYYTQRDCELMQVGGLLDSKGYGIGLPEGSKYRDPISETILKLQKSQVLEQLKFYWWRKHDIEKPCDTSPTKSSDANSLGVEKVGGCFVMLLIGMVVSLLVGLLEF 851          
BLAST of SMED30005367 vs. TrEMBL
Match: A0A4E0RCU8 (Glutamate receptor ionotropic kainate 3 OS=Fasciola hepatica OX=6192 GN=D915_005100 PE=3 SV=1)

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 388/864 (44.91%), Postives = 549/864 (63.54%), Query Frame = -2
Query:  526 WIIILYQLIFVLNLSHSDTKVQN-----LNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDV---NEKYLMKDLK--SKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALV-PI-EDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALT-TETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTD-LKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKS--PDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPE-KSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3063
            WI I++ ++F L   HS  ++++     L++GAI    +  QE+ FKK ++EAN +L    K + N    +   ++  I   DSFEAS+KAC LLE++V+AI GPT   A D ++S+  QFGIP L +     Q I    ++N++PHY +    + D+ +  +   + +IY + E+L+K+  L+   +  V ++K  +DV   N +Y++K      + Y HFIVDIP+W   +F+     YNMTTQ+Y Y+FT+WDIQL++ E      AANITT++++ P+ ED+ +   ++++  R  A +++   ++     ++ T +A++YD L LLA G  S +R S +   S L+C++  +W PGI+ +N IK+I  ++  G +     D  GWR +   +I +    S F  +  WN    + I K  +  ++++  E+  +VLR+TT+ + P+++ +     G  PKS  P  W GFCI +L  I+ +  F++T+  V D  YG     +G   W G+V  L  HKADLAV S TITYDR+RVIDFTTPFM LGISIIY++P  KE  LFSFL PLS PVWGY++A+ I VS VLFV+ R +PYEW N  PC        N FN+LNS+WFT G+ MQ+G DI+P ATSTRIIAG WWFFTLI+ISSYTANLAAFLTVARM  PIEN EDLSKQ KI YG ++GG+T  FF  S    Y++MY++M     + + S  + I+RVK   YAF+LEST NEYY QRDCDLM+VGGLLDSKGYGIGLP GS+YRD ISE+IL+LQK Q +E  R ++W Q+DI   C+A   KS+ TSSLG+ +VGG FVML  G+ + LLV++ E  Y
Sbjct:    6 WITIIF-VLFDLLFKHSHAQIRSYETIELSVGAIIDKNDVAQEICFKKSVQEANKLLQ---KHEPNRRRVHLVPLVETIDGDDSFEASQKACRLLERQVVAIYGPTTPNAVDTVQSLTTQFGIPHLQIDWGFRQKIH-GFALNVHPHYLAYGQALYDYVRAAEWPSVALIYYREENLLKYDYLIRTMDTSVRIRK--WDVASDNHRYVIKQFSKMQQQYAHFIVDIPFWEIQEFLSLIQTYNMTTQFYRYIFTDWDIQLVDPEAFRAVGAANITTISILEPLAEDKGYGIGALLDDVRMAALQDERFTRSSTSRRISPTYSALLYDGLSLLAMGILSSSRTSDLLPPSGLTCSASRSWNPGINLINDIKAIKPENFRGLTGTFQFDGYGWRSDVNFTILEFA-MSEFRKYGHWNLETGLTITKNFSHTMQEIQSELRGKVLRITTMEEKPYMMYIGNTPPG-KPKSTDPKDWQGFCIDLLNYISRDLNFSYTINLVPDSTYGNSKIIDGEEVWDGMVKELSLHKADLAVGSFTITYDRDRVIDFTTPFMYLGISIIYRRPEDKESHLFSFLQPLSAPVWGYILAATIMVSLVLFVVARFSPYEWKNKHPCNAKSNVIENNFNVLNSLWFTFGSLMQKGSDILPHATSTRIIAGFWWFFTLIVISSYTANLAAFLTVARMVSPIENVEDLSKQTKIKYGTIQGGSTEAFFAHSKFPIYERMYQFMTSQKGLLMNSTSQAIKRVKREEYAFLLESTMNEYYRQRDCDLMQVGGLLDSKGYGIGLPSGSKYRDPISETILKLQKQQILENRRHFWWGQHDIKVRCDASTGKSSDTSSLGMEKVGGCFVMLLIGMGMSLLVSLLEFIY 860          
BLAST of SMED30005367 vs. TrEMBL
Match: A0A3R7FCV2 (Glutamate receptor ionotropic (Fragment) OS=Clonorchis sinensis OX=79923 GN=Grik3 PE=3 SV=1)

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 391/856 (45.68%), Postives = 541/856 (63.20%), Query Frame = -2
Query:  526 WIIILYQLIFVLNLSHSDTKVQNLNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK--EIIVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEF-DVNEKYLMKDLKS-KNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALV-PIEDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALT-TETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKS--PDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPE-KSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3063
            WI I   L+F         +   L +GAI    +  QE  F+K ++EAN +L     ++  +       +I  I   DSF+AS KAC LLE++VIAI GPT   A D ++S+  QF IP L +     Q   R  ++N++PHY +    + D+ +  +  E I +IY + E L+K+  LL  F+Q V+L+K E  + N KY++K  K+ +    FIVDIP+W   +F+  A  YNMT+QYY Y+FT+WDIQL++ +       ANITT +++ P  D+ +  R++++  R  A  ++   ++     ++ T++A++YD L LLA G  S AR S I   + L+C+S   W+PGIS +N IK+I  ++  G +     D +GWR N  + I +     F   F  WN    + + K     L+++  E+  +VLR+TT  + P+V+  +   N   PKS  P  W GFCI +L +I +E  F +T+  V D  YG     +G   W G+V  L + KADLAV S TITYDR+RVIDFTTPFM LGISIIYK+   K   LFSFL PLS PVWGY++A+ I VS VLFV+ R +PYEW  + PC  N     N+FNILNS+WFT G  MQ+G D++P ATSTRIIAG WWFFTLI+ISSYTANLAAFLTVARM  PIENAEDL+KQ KI YG ++GG+T  FFE++   TYK+M+++M+    V + S +E I RVK   YA+ILEST NEYYT+RDC+LM+VGGLLDSKGYGIGLPEGS+YRD ISE+IL+LQ SQ I+ L+  +W++ DI+  C+A + K + T+SLG+ +VGG FVML  G+   L+V++FE  Y
Sbjct:    7 WISITVLLMFQTIGRTQAFESTELAVGAIIEKNDVAQEFCFRKSVQEANKLLQRHDSQRRGI---QLVPVIETIDGDDSFDASRKACRLLERQVIAIFGPTTPTAVDSVQSLANQFEIPHLQIDWGYRQST-RGFALNVHPHYLAYGQALYDYVRKAEYWESIALIYYEEESLLKYDYLLRNFDQPVMLRKWEVANDNHKYVIKQFKTMQTNFRFIVDIPFWEVEEFLFLAKKYNMTSQYYSYVFTDWDIQLVDSQAFNVVEGANITTFSILRPTGDEGYGIRALLDDVRLSAIHDERFVRSSTPKRISATQSALLYDGLSLLALGLLSRARTSDIAPPTDLTCSSSRGWSPGISLMNDIKAIQPENFMGLTGTFQFDGHGWRSNMDLHILEYMPDGF-RQFGYWNMDEGLVVTKNFSRTLQEMQSELKGKVLRITTKEEKPYVM-YQGSVNPGEPKSTDPKHWRGFCIDLLNEIGKELNFTYTINLVPDSTYGNAKIIDGEEVWDGMVQELRTRKADLAVGSFTITYDRDRVIDFTTPFMYLGISIIYKRIEDKRSHLFSFLQPLSAPVWGYILAATIMVSLVLFVVARFSPYEWKINHPCNVNSNIVENKFNILNSIWFTFGALMQKGSDVVPHATSTRIIAGFWWFFTLIVISSYTANLAAFLTVARMESPIENAEDLAKQTKIKYGTIQGGSTAAFFEQTKFPTYKRMWQFMSSQKGVMMNSTEEAIRRVKREEYAYILESTMNEYYTKRDCELMQVGGLLDSKGYGIGLPEGSKYRDPISETILKLQHSQTIDKLKFRWWQEMDINVSCDAKQTKKSDTTSLGVEKVGGCFVMLLIGMGASLIVSLFEFLY 856          
BLAST of SMED30005367 vs. TrEMBL
Match: A0A074ZP09 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_04393 PE=3 SV=1)

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 387/834 (46.40%), Postives = 536/834 (64.27%), Query Frame = -2
Query:  526 LNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK--EIIVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEF-DVNEKYLMKDLKS-KNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALV-PIEDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALT-TETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPK--AKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKS--PDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPE-KSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            L +GAI    +  QE  F+K ++EAN +L     ++  +       +I  I   DSF+AS KAC LLE++VIAI GPT   A D ++S+  QF IP L +     Q   R  ++N++PHY +    + D+ +  +  E I +IY + E L+K+  LL  F+Q V+L+K E  + N KY++K  K+ +    FIVDIP+W   +F+  A  YNMT+QYY Y+FT+WDIQL++ +       ANITT +++ P  D+ +  R++++  R  A  ++   ++     ++ T++A++YD L LLA G  S AR S I   + L+C+S   W+PGIS +N IK+I  ++  G +     D +GWR N  + I +     F   F  WN    + + K  ++T L+++  E+  +VLR+TT  + P+V+       G  PKS  P  W GFCI +L +I +E  F +T+  V D  YG     +G   W G+V  L + KADLAV S TITYDR+RVIDFTTPFM LGISIIYK+   K   LFSFL PLS PVWGY++A+ I VS VLFV+ R +PYEW  + PC  N     N+FNILNS+WFT G  MQ+G D++P ATSTRIIAG WWFFTLI+ISSYTANLAAFLTVARM  PIENAEDL+KQ KI YG ++GG+T  FFE++   TYK+M+++M+    V + S +E I RVK   YA+ILEST NEYYT+RDC+LM+VGGLLDSKGYGIGLPEGS+YRD ISE+IL+LQ SQ I+ L+  +W++ DI+  C+A + K + T+SLG+ +VGG FVML  G+   L+V++FE  Y
Sbjct:  454 LAVGAIIEKNDVAQEFCFRKSVQEANKLLQRHDSQRRGI---QLVPVIETIDGDDSFDASRKACRLLERQVIAIYGPTTPTAVDSVQSLANQFEIPHLQIDWGYRQST-RGFALNVHPHYLAYGQALYDYVRKAEYWESIALIYYEEESLLKYDYLLRNFDQPVMLRKWEVANDNHKYVIKQFKTMQTNFRFIVDIPFWEVEEFLFLAKKYNMTSQYYSYVFTDWDIQLVDSQAFNVVEGANITTFSILRPTGDEGYGIRALLDDVRLSAIHDERFVRSSTPKRISATQSALLYDGLSLLALGLLSRARTSDIAPPTDLTCSSSRGWSPGISLMNDIKAIQPENFVGLTGTFQFDGHGWRSNMDLHILEYMPDGF-RQFGYWNMDEGLVVTKNFSRT-LQEMQSELKGKVLRITTKEEKPYVMYQGSVVPG-EPKSTDPKHWRGFCIDLLNEIGKELNFTYTINLVPDSTYGNAKIIDGEEVWDGMVQELRTRKADLAVGSFTITYDRDRVIDFTTPFMYLGISIIYKRIEDKRSHLFSFLQPLSAPVWGYILAATIMVSLVLFVVARFSPYEWKINHPCNVNSNVVENKFNILNSIWFTFGALMQKGSDVVPHATSTRIIAGFWWFFTLIVISSYTANLAAFLTVARMESPIENAEDLAKQTKIKYGTIQGGSTVAFFEQTKFPTYKRMWQFMSSQKGVMMNSTEEAIRRVKREEYAYILESTMNEYYTKRDCELMQVGGLLDSKGYGIGLPEGSKYRDPISETILKLQHSQTIDKLKFRWWQEMDINVSCDAKQTKKSDTTSLGVEKVGGCFVMLLIGMGASLIVSLFEFLY 1280          

HSP 2 Score: 176.022 bits (445), Expect = 1.280e-40
Identity = 98/241 (40.66%), Postives = 141/241 (58.51%), Query Frame = -2
Query:  289 MYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPE-KSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNI-------RSCYRSSNKPPVDDSSNGSSPITYPVASMEEYNR----------HLGLDEEDSRNQPSQSLNKA 957
            M+++M+    V + S ++ I RVK   YAFILEST NEYYTQRDC+L++VGGLLDSKGYGIGLPEGS+YRD ISE+IL+LQ SQ I  L+  +W++ DI+  C+A + K + TSSL +++V G FVML  G+   L+V++FE  Y A+++    K T+  EA    R +        R    S+  PP      G+    + +++   Y             L +D+     +PS  L+K 
Sbjct:    1 MWQFMSSQKGVLMNSTEDAIRRVKREEYAFILESTMNEYYTQRDCELIQVGGLLDSKGYGIGLPEGSKYRDPISETILKLQHSQTIHKLKFRWWQEMDINVTCDAKQNKVSDTSSLDVDKVSGCFVMLLIGMGAALIVSLFEFIYDAYERMPNTKRTLHEEAARAFRFSTSCASFRSRMAEESTKLPPPPSMGCGAGGDKFSLSAALAYAPCLPAPELPPLQLQVDDAPENKRPSGELSKC 241          
BLAST of SMED30005367 vs. Ensembl Cavefish
Match: ENSAMXT00000004586.2 (glutamate receptor ionotropic, kainate 2-like [Source:NCBI gene;Acc:103044887])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 326/873 (37.34%), Postives = 512/873 (58.65%), Query Frame = -2
Query:  421 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMN-RNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS KACE L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D     + + + ++Y  S  LI+  +L+   +++  ++ ++++  +  + K L+KD+K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N+T   ++  E  +    S+VE    +R  A  + +    L+   +TT+ A+++D++ ++A       +++     S+L CN    W  G  F++ IK      LTG    +    NG R  F + +  L      E   TW   N + + +  K+ + ++   +S + LRV TI++ P+V+  K D         D + G+C+ +L+++A   GF + ++ VED KYG L  EE   +W G+V  L+ HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KIPYG V+ G+T  FF+K+ ++TY KM+++MN R  SV VKS +EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR     +     E+S   S+LG+  +GG+F++L  G+ + + VA+ E+ YK+ K ++++K + C    + L ++++   R   KP
Sbjct:   38 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINVFDSFEASRKACEQLSLGVAAIFGPSHSSSANAVQSISNALGVPHIQTRWKHQVSDNRDSYYVSLYPDFSSLSRAILDLVHFFRWDSVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPAETKDAKPLLKDMKKSKEFHVIFDCSHEMAAWILKQALSMGMMTEYYHYIFTTLDLFALDMEPYRY-SGVNMTGFRILNTESPQVS--SIVEKWSMERLQAPPKPDS--GLLDGFMTTDAALMFDAVHVVAVAVQQSQQITV----SSLQCNRHKPWRFGGRFMSLIKEASWDGLTGRV--LFNKTNGLRTEFDLDVISLKEDGL-EKIGTWEPVNGLNMTEHHKSKMTNVTNSLSNKSLRVATILEEPYVMFKKSDKPLC---GNDRFEGYCVDLLRELASILGFRYEIQLVEDGKYGAL--EESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDMVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGSTMAFFKKTKISTYDKMWEFMNSRRQSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPE-----EESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEVLYKSKKNAQMEKRSFCSAMVDELTVSLKCQRRLKQKP 881          
BLAST of SMED30005367 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 325/873 (37.23%), Postives = 513/873 (58.76%), Query Frame = -2
Query:  421 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D     K  ++ ++Y  S  LI+  +L+   +++  ++ ++++  +  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N++   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+  IK      LTG  N      NG R +F + +  L      E   TW+  + + + ++ K  + ++   ++ + L V+TI++ P+V+  K D         D + GFCI +L+++A   GF + V  VED KYG    EE   +W GLV  L+ HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YG V+ G+T TFF+K+ ++TY KM+++M +R  SV VKS +EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR     +     E+S   S+LG+  +GG+F++L  G+ + + VA+ E  YK+ + ++++K + C    E LR++++   R  +KP
Sbjct:   37 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIHDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDSYYVSLYPDFSSLSRAILDLVHFFKWRMVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPAETKDAKPLLKEMKRGKEFHVIFDCGHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMSGFRILNTENSQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSPQITV----SSLQCNRHKPWRFGNRFMTLIKEAHWDGLTGRIN--FNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPVSGLNMSESQKGKMANVTDSLTNRTLFVSTILEEPYVMFKKSDK---PLHGNDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGA--QEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPE-----EESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLEKRSFCSAMVEELRVSLKCQRRLKHKP 880          
BLAST of SMED30005367 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 554.673 bits (1428), Expect = 1.399e-180
Identity = 317/838 (37.83%), Postives = 492/838 (58.71%), Query Frame = -2
Query:  526 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D     K  ++ ++Y  S  LI+  +L+   +++  ++ ++++  +  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N++   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+  IK      LTG  N      NG R +F + +  L      E   TW+  + + + ++ K  + ++   ++ + L V+TI++ P+V+  K D         D + GFCI +L+++A   GF + V  VED KYG    EE   +W GLV  L+ HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YG V+ G+T TFF+K+ ++TY KM+++M +R  SV VKS +EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   37 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIHDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDSYYVSLYPDFSSLSRAILDLVHFFKWRMVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPAETKDAKPLLKEMKRGKEFHVIFDCGHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMSGFRILNTENSQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSPQITV----SSLQCNRHKPWRFGNRFMTLIKEAHWDGLTGRIN--FNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPVSGLNMSESQKGKMANVTDSLTNRTLFVSTILEEPYVMFKKSDK---PLHGNDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGA--QEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 845          
BLAST of SMED30005367 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 553.903 bits (1426), Expect = 1.919e-180
Identity = 317/838 (37.83%), Postives = 492/838 (58.71%), Query Frame = -2
Query:  526 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D     K  ++ ++Y  S  LI+  +L+   +++  ++ ++++  +  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N++   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+  IK      LTG  N      NG R +F + +  L      E   TW+  + + + ++ K  + ++   ++ + L V+TI++ P+V+  K D         D + GFCI +L+++A   GF + V  VED KYG    EE   +W GLV  L+ HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YG V+ G+T TFF+K+ ++TY KM+++M +R  SV VKS +EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   37 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIHDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDSYYVSLYPDFSSLSRAILDLVHFFKWRMVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPAETKDAKPLLKEMKRGKEFHVIFDCGHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMSGFRILNTENSQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSPQITV----SSLQCNRHKPWRFGNRFMTLIKEAHWDGLTGRIN--FNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPVSGLNMSESQKGKMANVTDSLTNRTLFVSTILEEPYVMFKKSDK---PLHGNDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGA--QEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 845          
BLAST of SMED30005367 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 553.518 bits (1425), Expect = 3.706e-179
Identity = 316/838 (37.71%), Postives = 492/838 (58.71%), Query Frame = -2
Query:  526 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++LYP +SS++  I D     K  ++ ++Y  S  LI+  +L+   +++  ++ ++++  +  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   + +  N++   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+  IK      LTG  N      NG R +F + +  L      E   TW+  + + + ++ K  + ++   ++ + L V+TI++ P+V+  K D         D + GFCI +L+++A   GF + V  VED KYG    EE   +W GLV  L+ HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KI YG V+ G+T TFF+K+ ++TY KM+++M +R  SV VKS +EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR     +     E+S   S+LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   37 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIHDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDSYYVSLYPDFSSLSRAILDLVHFFKWRMVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPAETKDAKPLLKEMKRGKEFHVIFDCGHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRY-SGVNMSGFRILNTENSQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSPQITV----SSLQCNRHKPWRFGNRFMTLIKEAHWDGLTGRIN--FNKTNGLRTDFDLDVISLKEEGL-EKIGTWDPVSGLNMSESQKGKMANVTDSLTNRTLFVSTILEEPYVMFKKSDK---PLHGNDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGA--QEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPE-----EESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 845          
BLAST of SMED30005367 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 379.793 bits (974), Expect = 3.205e-122
Identity = 176/329 (53.50%), Postives = 241/329 (73.25%), Query Frame = -2
Query:  565 SHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGI 1551
            +HKADLAV+ LTI Y RE+ IDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI +A+DL+KQ +I YGAV+ G+T TFF+KS ++TY+KM+ +M+   +  +K+N+EGI+RV  T+YA ++EST  EY TQR+C+L ++GGL+D+KGYGIG P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E S   S+LG+  +GG+F++L  G+
Sbjct:    7 NHKADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCNLTQIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEDSNEASALGVQNIGGIFIVLAAGL 330          
BLAST of SMED30005367 vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 357.836 bits (917), Expect = 3.084e-111
Identity = 191/450 (42.44%), Postives = 276/450 (61.33%), Query Frame = -2
Query:  526 VTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSS--------------------------NRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNT--NYAFILESTTNEYYTQRD-CDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSAS-TSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 1782
            VTTI+D P+ + LK++      +  D + G+C+ + ++IA    F +    V D  YG  + +  V  W G+VG L+  +AD+A++ LTI+  RE VIDF+ PFM+LGISI+ KKP   +  + SFL PL+  +W  +I +YI VS VLF++ R +PYEW         P  +                           N F I NS+WF++G FMQQG +I P++ S RI+ G+WWFFTLIIISSYTANLAAFLTV RM  PIE+A+DL+KQ +I YG +  G+T  FF++S +  Y+KM+ +M +  P VFV++N +G+ RV+ +   YA++LESTTNEY  QR  CD M+VGG LDSKGYGI  P+GS  RDA++ ++L+L +   ++ L+  +W  YD  +       S   TS+L ++ V GVF +L  G+ + +LVA+ E  Y
Sbjct:   35 VTTILDAPYFM-LKKNHEQF--EGNDKYEGYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKV--WNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWW--YDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCY 477          
BLAST of SMED30005367 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 240.35 bits (612), Expect = 2.515e-73
Identity = 107/188 (56.91%), Postives = 146/188 (77.66%), Query Frame = -2
Query:  760 LTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEG 1320
             +PYEW N  PC  + +   N F +LNS+WF +G  MQQG ++MP+A STRI+ G+WWFFTLI+ISSYTANLAAFLTV RM  PI +A+DL+KQ KI YGAV+ G+T TFF+KS ++TY+KM+ +M +R+ +  VK+N+EGI R   T++A ++ESTT E+ TQR C+L ++GGL+DSKGYG+G+P G
Sbjct:    1 FSPYEWKNPHPCNPDSDVLENNFTMLNSLWFGVGALMQQGSELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRHQTALVKNNEEGIHRALTTDFAMLMESTTIEHVTQRYCNLTQIGGLIDSKGYGVGMPLG 188          
BLAST of SMED30005367 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 2.680e-41
Identity = 94/322 (29.19%), Postives = 155/322 (48.14%), Query Frame = -2
Query:  526 IDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 1491
            +  + P +  G  II K     E  +F FL PL+  +W  ++++   +S VLFV+  L P EWY+ +  +         FN++NS WF     ++QG D +P + + +II   WW F L++ S+YTANLAAFLT A     I + +DL++Q+   YG   G     F   S    Y  +++++ R+    V S K+G+E+ +   Y FI E++      +  CDL+            +  P GSR    +S ++  L+ S ++  L R ++ Q    + C      ++   + + +  GVF  L  GIA G  V   E  +
Sbjct:    4 LALSPPILENGYHIIMKGKEVNEPRIFQFLEPLNTLLWISMLSACAGISVVLFVLSLLHPDEWYHLAKRKLVSREQGQSFNLVNSFWFVFSAMVKQGSDPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLT-AEGQTSIRSLKDLTRQMDARYGTYSGYRIVGFLNSSARDPYMTVWRHI-RDNRTMVASPKKGLEQAEKAGYIFIGEASAVFTAKKDHCDLIISDRRFFRHRLALPFPPGSRLAAEVSRAVTELEDSGQLAELERQWFAQE--GQECVG---LSNEHQIEMKDFKGVFYFLMMGIAAGCGVCFVECLW 318          
BLAST of SMED30005367 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 1.951e-38
Identity = 116/415 (27.95%), Postives = 200/415 (48.19%), Query Frame = -2
Query:  526 TPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFV-LFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIM-PKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLS-KQVKIP--------YGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNY-AFILESTTNEYYTQRD--CDLMRVGG--LLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 1722
            +P       GFCI ILKK+++   F + +  V + K+G      GV  W G++G +++ +A +AV SLTI  +R  V+DF+ PF+  GIS++  + +   V   +FL P S  VW  +    + VS + +F+    +P  +       K  EF    F I  S+W          + +  P+ T+++ +  +W FF +I ++SYTANLAAF+        I+    LS K+ + P        +G V  G+T    E++    Y +M+ YM++      KS ++ +  +K     AFI ++    Y   +D  C L+ +G   +  + GYGI L + SR++ AI  ++L+     E++ L   +     +   C        +S L I+ + GVF ML   + +  +V + E F+
Sbjct:  389 SPYVKKCCKGFCIDILKKLSKTVKFTYDLYLVTNGKHGS--KINGV--WNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPR-SNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGK--EFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDY---IDQVSGLSDKKFQSPLEHSPPFRFGTVPNGST----ERNIRNNYLQMHGYMSK---FHQKSVEDALMSLKAGKLDAFIYDAAVLNYMAGKDEGCRLVTIGSGKVFVATGYGIALQKSSRWKRAIDLALLQFIGDGEMDELEMIW-----LTGICHGERNDVMSSQLDIDNMAGVFYMLLVAMGLSFIVFVCEHFF 781          
BLAST of SMED30005367 vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 251.906 bits (642), Expect = 6.594e-70
Identity = 164/526 (31.18%), Postives = 276/526 (52.47%), Query Frame = -2
Query:  526 GISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSF-FESFNTWN---------------KTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSS--PCQKNPEFS----SNRFNILNSMWFTIGTFMQQGID-IMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEY--YTQRDCD-LMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2025
            G + L+ I  +   + TG  N +  D N  R    ++   +N R+F F+    WN                + R+ +P   T +      +  + L+V TI + PF+ + +   NG   ++     G+CI++L+K++E   F F V  V D  +G  D      +W G+V  +++ +ADLAV+SLTI+ +R++VIDFT P+M+LG++++ K    +E   F+ L P    +W  +  + I V F L++    +P+ +Y      C    E       +  +++ ++W T+  ++ Q  D + P ++S RI   ++WF  LI++S+YTANLAAFLT+ R   PI + +DL++Q  I YG V       FFE + + ++  M++YM R    FV ++ EGIE+V N NYAFI +S   E+  + Q  C  L+  G +    GYG GL + S Y   +S +IL+L+ +  +E L R + +    DK  EA EK+ S + L   ++ GVF++L  GI +  +V + E  +
Sbjct:  362 GATLLDYISQV---NTTGVMNQLGFDSN--RSPVDVAFDVVNLRAFGFQKVGYWNVEEGLHLDNKKEIVWPSGRVYVPTDSTHI------LENRTLKVVTIAEAPFIFA-QTQTNG-QGETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQD--PVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTMWQYM-RYHHTFVNNSAEGIEKVMNENYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKAN--DKCAEAAEKAKSENQLTFEDLSGVFIVLIAGIGVSCVVLVLEWIW 869          
BLAST of SMED30005367 vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 238.81 bits (608), Expect = 1.507e-69
Identity = 135/414 (32.61%), Postives = 236/414 (57.00%), Query Frame = -2
Query:  535 DPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVAR-MNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRD-CDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPC-EAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFE 1767
            D PF++ +K +A+ +  K  D + GF   +++ ++ +  F + +   ++  YG     EG  +W GL+G L+  +AD+A+  +TIT +RE VIDF+ PF++  I++I ++P  +EV LF+FL P    +W   +     VS +++ + R +P  +   +  +K+ E   + F++ NS+WF + + +QQG D  P++TS R++A  +W FTLI+IS+YTANLAA+ T  R +   I + EDL  Q  + YG  +GG+ +TFF +S +  Y  M++ M ++   FV   + G+ + +   +A++ +  + +YY  R  C+ M V  LLD+K Y + +   S + + IS +IL L++  EIE  R  +W   D    C   P   +S   L ++ + GVF++L  G  I L++ + E
Sbjct:    8 DEPFMM-IKPNASLL--KGNDRYRGFSKDLMELLSRKLNFRYEICISKESSYG--SKVEG--QWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGY--KTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQM-KSQETFVNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWW---DDSSECPTGPSTDSSPQRLELHSLAGVFIILGGGATISLVLLLVE 408          
BLAST of SMED30005367 vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 216.468 bits (550), Expect = 7.501e-58
Identity = 167/576 (28.99%), Postives = 273/576 (47.40%), Query Frame = -2
Query:  529 LTTETAIIYDSLRLLAKGFASLARMSS--INLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDL---------KDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYK-KPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSN------RFNILNSMWFTIGTFMQQGIDI-MPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRD-CDLMRVGGLLDSK-----GYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDK-PC----EAPE---KSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELF 2157
            LT     + DS+ ++AK   +  +      + ++ L CN      P IS +   K I      G    ++  ++G+  N  I I  +    F +    WN  + + +   KT +         +D    ++ + +RV +    PF + +     G    S D + G  I +L +++E   FN+T+    D + G  +   G   W G++  LI  +ADLAV  +TIT  R +VIDFT PFM  GI ++   + +PK    F FL P    +W  +  + + +  V ++   ++P+ +Y       N     +        + LNS+W +   ++ QG D   P + S R    +WWF   I+ ++YTAN+AAFLT  RM  PI   EDLS Q +I YG V+   T  FF+ S +  Y+ M++YM    S+        IER     YAFI ++   EY  ++  C  +++ G  D++      YG  LP+ S Y + +S  IL+L +S     + +    ++ I++ PC    EA E   KS+ TS +GIN + GVF+ +  GIAIG ++ + E F
Sbjct:  249 LTPVVGRVIDSVLVIAKAIQNAVQAGDQVTSGNAGLFCNLTRRNPPSISGITLNKYIQKVQTAGFMGFLSFSQDGFLANPSIDIINVKENEF-DKVGEWNTKDGLMMDSDKTVVWMSGGPGTPRDSENVLADRTIRVVSFKGSPFTMPV-----GNVSSSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTG--NWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKP--YFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSL-QPDTYTAIERTLKGKYAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQS----GIAKTMIEEWMIERTPCAPLDEAEEQDAKSSDTSKMGINNMLGVFIFMVAGIAIGGVLLLLEWF 809          
BLAST of SMED30005367 vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 212.231 bits (539), Expect = 1.519e-56
Identity = 165/558 (29.57%), Postives = 261/558 (46.77%), Query Frame = -2
Query:  580 TETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNR-----------SFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANG--------------ITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEG--VPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGI-DIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDL-----SKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNY-AFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVM 2151
            +E + + D+  + A    +LA       + T SC     W+ G    N++ ++ +    G + PI  + +G R N   ++ +L NR             +E  N     N   I     +     + +S   LRV T++  PFV       +G               T    D  +GFC+ +L ++ E+  F ++V   ED  YG L    G    +W G+VG +I  KADL V++LTI  +R   I+F+ PF   G++I+ KK   +   L SFL P  + +W  V+ S   V+ +L+++ R +P+  +  +  +K         N+ ++MWF+ G  +  GI +  P++ S R++  +W  F +II++SYTANLAAFL + R    +   +D      SKQ    Y  V   +   +F +        MY +M       VK+ KEGIE+VKN    AFI +S    Y   +DC L   G L    GYGIG+P+GS + +AIS +IL   +S  +E L   +    D  K C     S +T  LG+  + GVF+M
Sbjct:  272 SEISQLKDATVISATALQNLANAGKTLTTPTASCRETQQWSSGQELFNALVNVSLPR--GTTGPIAFNSDGDRKN---AVYRLMNRRQSSSDAVDVVGLYE--NGHVSINESIIWPGNLNTTPTGVFLSNH-LRVVTLVGEPFVYVKPIPTSGRCSDLDTNTAKHVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKK-NEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKE----ETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQ--FIYATVANSSVDAYFRRQ--VELSSMYTFME---GYNVKTAKEGIEKVKNGELKAFIWDSPVLYYEASKDCTLTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEELETTW---IDASK-CNTENTSPAT--LGLQHMLGVFIM 803          
BLAST of SMED30005367 vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 196.823 bits (499), Expect = 2.525e-56
Identity = 106/297 (35.69%), Postives = 169/297 (56.90%), Query Frame = -2
Query:  535 LFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRD-CDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTS--SLGINEVGGVFVMLFFGIAIGLLVAIFE 1416
            LF+FL P    +W        +V+ +++++ R +PY +   +  +   E   + F++ NS+WF  G+ +QQG D  P++ S R++A  +W FTLI+IS+YTANLAAF T       I + EDL  Q    YG  +GG+ ++FFEKS +  YKKM+  M+   + FVK   EG+ R + T +A++ +  + +YY QR  C+ M V  LLD+K Y +GL   S + D IS +IL+L++  E+E +R  +W   D    C   +   S    SL ++ + GVF++L  G  I L++ + E
Sbjct:    1 LFAFLMPFQKDLWACCCLVVGAVTILMWILDRFSPYGF--RAEAKNTGEGEGDEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGGSLFSFFEKSKVRIYKKMFGKMS-TLNTFVKGTDEGVNRSRTTPFAYLTDQPSLDYYNQRKPCNTMLVKNLLDAKSYALGLQRNSEWTDGISVAILQLREEGEVERIRYKWW---DAMSECNLKDAVVSNQPMSLELHHLAGVFIILGGGAGISLVILLME 291          
BLAST of SMED30005367 vs. Ensembl Medaka
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:101173029])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 324/873 (37.11%), Postives = 514/873 (58.88%), Query Frame = -2
Query:  421 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS-PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKA-KTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMN-RNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +       +   +    ++L+P +SS++  I D     K   + ++Y  S  LI+  +L+   +++  ++ ++++  +  + K L+K++K     H I D  +   A  +K A    M T+YY Y+FT  D+  L++E   F +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+N IK      LTG    +    NG R +F + +  L      E   TW+  + + + +  K+   ++   ++ + LRV+TI++ P+V+  K D         D + G+CI +L++++   GF + +  VED KYG LD   G  +W G+V  L+ HKADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFL+PLS  +W Y++ + + VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ KIPYG V+ GAT TFF+K+ ++TY KM+++MN R  SV VK+ +EGI+RV  ++YAF++ESTT E+ TQR+C+L ++GGL+DS+ YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   S+LG+  +GG+F++L  G+ + + VA+ E+ YK+ + ++++K + C    + LR++++   R   KP
Sbjct:   39 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIFDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDSYYVSLFPDFSSLSRAILDLVHFFKWRTVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPTETKDAKPLLKEMKKAKEFHVIFDCGHEMAAWILKQALAMGMMTEYYHYIFTTLDLFALDMEPYRF-SGVNMTGFRILNTENSQVS--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSQQITV----SSLQCNRHKPWRFGGRFINLIKEAHWDGLTGRV--LFNKSNGLRTDFDLDVISLKEEGL-EKIGTWDPPSGLNMTETHKSKTSNITDSLANKSLRVSTILEEPYVMFKKSDK---PLYGNDRFEGYCIDLLRELSGILGFRYELRLVEDGKYGALDESTG--QWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLACLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGATMTFFKKTKISTYDKMWEFMNSRRQSVMVKNVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSRAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEVLYKSKQNAQLEKRSFCSAMMDELRVSLKCQRRLKQKP 882          
BLAST of SMED30005367 vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 551.592 bits (1420), Expect = 5.144e-179
Identity = 325/877 (37.06%), Postives = 516/877 (58.84%), Query Frame = -2
Query:  421 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKL-SINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIP---KAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITP-KSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKP 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  YDSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +           R +  ++LYP +SS++  I D     K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY ++FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+  IK      LTG    I+ ++ NG R +F + +  L      E    W+ ++ + +    K KT   +++  +S + L V+TI++ P+V+  K D    TP    D + G+CI +L+++A   GF + V  VED KYG  D   G  +W G+V  L+ H+ADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFLSPLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ K+ YG V+ G+T +FF+K+ ++TY KM+++M +R  SV V S ++GI RV  ++YAF+ ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   ++LG+  +GG+F++L  G+ + + VA+ E  YK+ + ++++K + C    + LR++++  +R  +KP
Sbjct:   35 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIYDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDVFYVSLYPDFSSLSRAILDLVHFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPPDYKDAKPLLKEMKRGKEFHIIFDCGHEMAAGILKQALSMGMMTEYYHFIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENSQVA--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSQQITV----SSLQCNRHKPWRFGNRFMALIKEAHWDGLTGR---ISFNKSNGLRTDFDLDVISLKEEGL-EKIGIWDPSSGLNMTDNQKGKT--INVSDSLSNRSLIVSTILEEPYVMFRKSD----TPLYGNDRFEGYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSG--QWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSDYAFLTESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEANALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQSAQLEKRSFCKTVVDELRVSLKCQHRLKHKP 878          
BLAST of SMED30005367 vs. Ensembl Medaka
Match: grik1b (glutamate ionotropic receptor kainate type subunit 1 [Source:NCBI gene;Acc:101173645])

HSP 1 Score: 547.354 bits (1409), Expect = 5.516e-178
Identity = 321/845 (37.99%), Postives = 496/845 (58.70%), Query Frame = -2
Query:  526 TKVQNLNIGAIF-TNGNED---QELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLS--INLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHKT---LIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLK-DLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 3009
            T  Q L IG IF T  NE    +ELAFK  +   N       + +  +P     Y I +I  +DSFEAS +AC+ L   V A+ GP+ S +   ++SI     +P +  +      +  K S  INL+P Y+S++  + D  +  K + + ++Y  +  LI+  +L+   +++  ++ ++++     + + L+K++K       I D  Y      +K      M T+YY Y FT  D+  L+LE   + +  N+T   L+ ++D K    S+V  +R    + +   K    ++   +TTE A++YD++ ++A   A+  R S I +SS L C+    W  G  F+N +K      LTG    I +++ +G R  F + +  L      E    WN    + + +   D   ++   ++ + L VTTI++ P+V+  K D         D + G+C+ +LK+++   GF++ V+ V D KYG   +++G  +W G+V  LI H ADLAV+ LTITY RE+VIDF+ PFM LGISI+Y KP      +FSFL+PLS  +W YV+ + + VS VLFVI R TPYEWYN  PC  + +   N F ++NS+WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM+ PI++A+DL+KQ KI YGAV+ G+T TFF+KS ++TY+KM+ +M +R  +  VK+N+EGI+RV  T+YA ++EST+ EY +QR+C+L ++GGL+DSKGYG+G P GS YRD ++ +IL+LQ+  ++  ++  +WR       C   E S   S+LG+  +GG+F++L  G+ + + VAI E  Y
Sbjct:   21 TSGQVLRIGGIFETLENEPISVEELAFKFAVTNIN-------RNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVGAVFGPSHSSSVSAVQSICNALEVPHIQ-TRWKHPSVDNKDSFYINLHPEYASLSRAVLDIVQFYKWKAVTVVYEDATGLIRLQELIKAPSRYSIKIKIRQLPSGTKDARPLLKEMKKGKEFFVIFDCSYQTTTDVLKQILSMGMMTEYYHYFFTTLDLFSLDLEPYRY-SGVNMTGFRLLNVDDPKV---SLV-LERWAMERLQAPSKVETGMMEGMMTTEAALMYDAVYMVA---AASQRTSQITVSS-LQCHRHKPWRFGSRFINLLKDTQWSGLTGQ---ILINKTDGLRKEFDLDVISLKEDGL-EKIGVWNSQMGLNLTETSRDSSTNITDSMANRTLVVTTILENPYVMYKKSDK---PLYGNDRFEGYCLDLLKELSNILGFSYEVKLVSDGKYGA-QNDKG--EWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREGIQRVLTTDYALLMESTSIEYISQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWR----GNGC-PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFIY 833          
BLAST of SMED30005367 vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 541.576 bits (1394), Expect = 2.005e-175
Identity = 316/841 (37.57%), Postives = 493/841 (58.62%), Query Frame = -2
Query:  526 LNIGAIF----TNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKL-SINLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDE-NGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLE--ISKQVLRVTTIIDPPFVISLKRDANGITP-KSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYM-NRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            L  G IF    +  +  +ELAFK  +   N       + +  +P     Y I +I  YDSFEAS KAC+ L   V AI GP+ S +A+ ++SI    G+P +           R +  ++LYP +SS++  I D     K + + ++Y  S  LI+  +L+   +++  ++ ++++  D  + K L+K++K     H I D  +   A  +K A    M T+YY ++FT  D+  L++E   + +  N+T   ++  E+ +    S++E    +R  A  + +    L+   +TT+ A++YD++ ++A       +++     S+L CN    W  G  F+  IK      LTG    I+ ++ NG R +F + +  L      E    W+ ++ + +   +   K +N+   +S + L V+TI++ P+V+  K D    TP    D + G+CI +L+++A   GF + V  VED KYG  D   G  +W G+V  L+ H+ADLAV+ L ITY RE+VIDF+ PFM LGISI+Y+KP      +FSFLSPLS  +W Y++ +Y+ VS VLFVI R +PYEWYN  PC  + +   N F +LNS WF +G  MQQG ++MPKA STRI+ G+WWFFTLIIISSYTANLAAFLTV RM  PI++A+DL+KQ K+ YG V+ G+T +FF+K+ ++TY KM+++M +R  SV V S ++GI RV  ++YAF+ ESTT E+ TQR+C+L ++GGL+DSK YG+G P GS YRD I+ +IL+LQ+  ++  ++  +WR       C   E+S   ++LG+  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   35 LRFGGIFESIESGPSGAEELAFKFALNTIN-------RNRTLLPNTTLTYDIQRINIYDSFEASRKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTKWKHQVSDNRDVFYVSLYPDFSSLSRAILDLVHFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNIRLKIRQLPPDYKDAKPLLKEMKRGKEFHIIFDCGHEMAAGILKQALSMGMMTEYYHFIFTTLDLFALDVEPYRY-SGVNMTGFRILNTENSQVA--SIIEKWSMERLQAPPKPDS--GLLDGFMTTDAALMYDAVHVVAVAVQQSQQITV----SSLQCNRHKPWRFGNRFMALIKEAHWDGLTGR---ISFNKSNGLRTDFDLDVISLKEEGL-EKIGIWDPSSGLNMTDNQKG-KTINVSDSLSNRSLIVSTILEEPYVMFRKSD----TPLYGNDRFEGYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSG--QWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSDYAFLTESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR----GNGC-PEEESKEANALGVQNIGGIFIVLAAGLVLSVFVAVGEFLY 843          
BLAST of SMED30005367 vs. Ensembl Medaka
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:NCBI gene;Acc:101170790])

HSP 1 Score: 539.65 bits (1389), Expect = 2.755e-174
Identity = 311/844 (36.85%), Postives = 489/844 (57.94%), Query Frame = -2
Query:  526 LNIGAIF--TNGN----EDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSI--NLYPHYSSITTCITDFFKNIK-EIIVIIYMKSEDLIKFTDLL---NKFEQQVVLKKIEFDVNE-KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVE---FQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTG--NSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNL--EISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNP-SVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY 2994
            + IG IF  T+G       +ELAFK  +   N       + +  +P     Y I +I  YDSFEAS KAC+ L   V+AI GP+ S +++ ++SI     +P + +      P+  + S   NLYP YSS++  I D  + +K +   ++Y  S  LI+  +L+   +++  ++ ++++  D  + + L+K++K       I D  +   AQ +K A    M T+YY Y+FT  D+  +NLE   F    N+T   ++ +++ +    S+VE    +R I  K       L+   +TT+ A+ YD++ +++  +    +M+     ++L C+    W  G  F++ IK      LTG  + N  T    G R +F + I  L      E    W+ +  + I +     K +N+   ++ + L +TTI++ P+V+  K D   +     D + GFCI +LK++A   GF + +  V D KYG  D +    +W G++  LI H+ADLAV+ LTITY RE+ IDF+ PFM++GISI+Y+KP       FSFL+P++  +W Y++ +Y+ VS VLFVI R +PYEWY++ PC    +   N F +LNS WF + + MQQG ++MPKA STRII G+WWFFTLIIISSYTANLAAFLTV RM+ P+++A+D++KQ KI YG +K GAT +FF+KS ++T++KM+ +M+  P +  VKS ++GI+RV  ++YA I ESTT +Y T+R+C+L +VGG++DSKGYGIG P GS YRD I+ +IL + +   +  L+  +W        C   E+   T  +GI  +GG+F++L  G+ + + VA+ E  Y
Sbjct:   36 IRIGGIFEQTDGPVSLVSAEELAFKFAVNNIN-------RNRTLLPNTTLTYDIQRINIYDSFEASRKACDQLSLGVVAIFGPSHSSSSNAVQSICNALEVPHIQVR-WKHHPMDNRDSFYANLYPDYSSLSYAILDLVQYLKWKTATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPLDTEDTRPLLKEMKRGREFRIIFDCSHHMAAQILKQAQTMGMMTEYYHYIFTTLDLMAINLEPYRF-CGVNMTGFRILNVDNPQVA--SIVEKWSMERQIPPKPDSG---LLEGIMTTDAALTYDAVHIVSVSYQHAPQMTV----NSLQCHRHKPWRFGGRFMSYIKESHWDGLTGRLSFNKTT----GLRTDFDLDIVSLKEDGL-EKVGKWSASGGLNITEVPKR-KGINITDSLANRSLVITTILEEPYVMLKKSDRALV---GNDRFEGFCIDLLKELAGLLGFTYEIRLVPDGKYGSQDDKG---QWNGMIRELIEHRADLAVAPLTITYTREKFIDFSKPFMSMGISILYRKPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVSSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDTPVDSADDIAKQTKIEYGVIKDGATMSFFKKSRVSTFEKMWAFMSSRPRTSLVKSIEDGIQRVLKSDYALITESTTIDYITRRNCNLTQVGGIIDSKGYGIGTPIGSPYRDKITIAILSILEDGRLHMLKEKWWS----GSSC-LDEERRETGPMGIQNLGGLFIVLASGLVLSVFVAMAEFIY 844          
BLAST of SMED30005367 vs. Planmine SMEST
Match: SMESG000062485.1 (SMESG000062485.1)

HSP 1 Score: 1464.13 bits (3789), Expect = 0.000e+0
Identity = 716/716 (100.00%), Postives = 716/716 (100.00%), Query Frame = -2
Query:   79 MVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKPPVDDSSNGSSPITYPVASMEEYNRHLGLDEEDSRNQPSQSLNKAFNNLPYDFAIRPSSPIYHLPPATKIQPLNIHPMQSNNHKMIFQDSHISTNPLSSVDTSSNCQVRMKKVAC 2226
            MVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYKAWKKSKIKKTTICIEAKEILRMNIRSCYRSSNKPPVDDSSNGSSPITYPVASMEEYNRHLGLDEEDSRNQPSQSLNKAFNNLPYDFAIRPSSPIYHLPPATKIQPLNIHPMQSNNHKMIFQDSHISTNPLSSVDTSSNCQVRMKKVAC
Sbjct:    1 MVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYKAWKKSKIKKTTICIEAKEILRMNIRSCYRSSNKPPVDDSSNGSSPITYPVASMEEYNRHLGLDEEDSRNQPSQSLNKAFNNLPYDFAIRPSSPIYHLPPATKIQPLNIHPMQSNNHKMIFQDSHISTNPLSSVDTSSNCQVRMKKVAC 716          
BLAST of SMED30005367 vs. Planmine SMEST
Match: SMESG000005199.1 (SMESG000005199.1)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 330/870 (37.93%), Postives = 518/870 (59.54%), Query Frame = -2
Query:  529 IIILYQLIFVLNLSHSDTKVQN---LNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMK--IKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQR-KLSINLYPHYSSITTCITDFFKNIK--EIIVIIYMKSEDLIKFTDLLNKFEQQVVLKK-IEFDV--NEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQ------RHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQV--LRVTTIIDPPFVISLKRDANGIT-PKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGEL----DHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTN--YAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELF 3060
            ++I   +IF L++    TK  +   LNIG I    ++         ++ AN  LA           FN+ + +    + + +SF A  K C L+   ++A+I P   V +  I S+ ++F IP L  S    + + R  + I L P+       I  +   ++    +++I+     ++KF  LLN+FE +  +++ +  D+  N+K L +  KSK Y +F+VDIPYW    F+  A  +NMT   + ++FT+WD  L+++     N   NITT +   I D    +R    ++        I   EK   K  I  A  ++ AI++D++  L KG   L +   + +   + C S   W  G S +N++ +   ++L G +  I  +EN  R N+ +SI +L    F +    WN    + +PK    ++   +EI   V  L+VTTII  PFV   + + +      + +AW GFCI +L++I  + G NFT+  V+D KYGE      + +G  KW G++G LI+ +A+LA++ +TI+Y+RE+V+DFTTPFM+LG+SI++ KP  +   LFSFLSP+S PVW Y+I++YI VSF++F I  +TPYEW    PC  N E   N+FN+LNS+WFT+G  M+QG++  P+A+STR+++G WWFFTLIIIS+YTANLAAFLTV ++ +PI++ EDL++Q  I YG +KGG ++TFFEK+ + TY+KM+K+M +N  VFV S ++G+ +V+N+N  YAF+LES  N++Y+QRDC LMR+G LLDSKGYGIG P GS  RD +++SIL+LQKSQ+I  L   +W + +I +PC++ E  +  + L + ++GG+F++L  G     +V+I EL+
Sbjct:    1 MLIFGFVIFFLSICPISTKELSKKLLNIGVILDASDDISRKVISLAVQNANKELAR----------FNYAFQVKTETLDDNNSFYAIRKGCNLIRHGLVAMISPIAEVPSRHISSLCSKFHIPHLVTSCRFPESLDRYPMDIQLTPNCDQYAKMIYQYITQVEIWRDMILIHSSDNCILKFEHLLNQFESRFKMRQWVHHDLKKNKKLLRELGKSKKYRYFLVDIPYWQITDFLIMASVHNMTDPQFSFIFTDWDASLVDIAAFKINNKVNITTFS---ITDHSIMERMTKTYENVEKLLESIVEMEKTSKKCDIEKAFMSKPAILFDTVNFLTKGIIRLLKSRPL-IVRPMKCKSNDTWRLGSSLINAMTAA--ENLYGITGKILFNENAQRKNYNLSIMELTENGF-QKGGFWNDDRFVVLPKR---IEPSVVEIGNIVRPLKVTTIISQPFVFYKEGEPDRQNYDTNMEAWNGFCIDLLREIGNDLGMNFTIHLVKDNKYGEAVENQTNPDGSEKWNGMIGELITKQAELAMAPMTISYEREKVVDFTTPFMSLGLSILFLKPKKEAPGLFSFLSPISFPVWVYIISAYIGVSFIIFFISHVTPYEWLQIHPCDDNSELD-NQFNLLNSLWFTVGALMRQGLEFCPQASSTRMVSGAWWFFTLIIISTYTANLAAFLTVEQLILPIKSVEDLAQQTNIKYGTLKGGTSFTFFEKALIPTYQKMFKFMKKNREVFVDSTEKGVNKVRNSNGKYAFLLESAMNDFYSQRDCSLMRIGDLLDSKGYGIGFPSGSPLRDHMTKSILKLQKSQKIANLIHKWWNEMNITEPCDSKESGSVPTELNVYQIGGIFILLVGGFIFAAIVSIIELY 849          
BLAST of SMED30005367 vs. Planmine SMEST
Match: SMESG000005192.1 (SMESG000005192.1)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 334/925 (36.11%), Postives = 528/925 (57.08%), Query Frame = -2
Query:  280 LNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFL-DMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIKEI--IVIIYMKSEDLIKFTDLLNKFEQQVVLKK-IEFDV--NEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVP---IEDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIP-IKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIP-KAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPK--SPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGEL-DHE---EGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTN--YAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKPPVDDSSNGSSPITYPVASMEEYNRHLGLD-EEDSRNQPSQSLNKAFNN 2994
            L IG IF   ++         ++ AN+ L            ++F+ +   + +  SF    KAC LL+  ++A+I P   + +  + S   +F IP L              ++I LYP+  +    I  +   I+    ++II+     ++K+  LLN+FE    +++ I  D+  N+++L K  KS+ + HF+VD+PYW    F+     +N+T   + ++FT+WD ++L+L     N   NIT  +L+    +   + + +++     +I    K   K+ I   L    AII DS+ +L +G   L ++  +  +  + C + T W  GIS  N+I S+  IK                   + +S+ +L    F +    WN  N +  P K+K+ + + N E+ K  LRVTTI+  PFV   K ++  I     S DAW GFCI +L +I  +   NF++  V+D KYG + D+E   +G  KW G++G LIS +ADL V+ +TI+Y+RE+V+DFTTPFM+LG+SI++  P  +   LFSFLSPLS  VW YVI++YI VS +++ I  +TPYEW    PC  N     N+FNILNS+WFT+   M+QG++  P+A+STR+++  WWFFTLIIIS+YTANLAAFLTV ++ +PI++ EDL  Q  I YG +KGGA+  FFE++ + TYKKM+KYM  NP V V+S +EG+++V  +N  YAF+LES  N+YY +R+C L+RVG +LDSKGYGIG P GS  RD +++SIL+LQKSQ++  L   +W +++I +PC+  EK +  ++L +++VGGVF++L  G     +V++ EL+    + +        I  ++ L+  +R  + SS+K P++         TY V + +   R L LD ++++ N PS   +   +N
Sbjct:   28 LTIGVIFEANDDVSRKVVSVAVQNANSQLMRY--------NYSFRIVTETVDDNGSFSVIRKACNLLQNGLVALIAPLSEIPSRHLSSFSNRFHIPHLVTKCQFPESSASYPMNIKLYPNCDAYANIIFQYITQIEAWGEMIIIHKSDNCIMKYEYLLNQFEYHFKMRQWIHGDLKKNKEFLRKLAKSRKHKHFLVDLPYWEIRDFLIMVSTHNLTGPAHSFIFTDWDARILDLSVFKINNKVNITAFSLINDSLVTSLRTRHKNLNSLMENIFESRKLSKKSFINTNLLAAPAIIIDSINVLMEGLIRLIKLQPV-FTQPMKCTTNTTWNQGISLFNAITSVDHIKQ------------------YNLSVMELTENGFMKK-GYWNGNNFVIFPPKSKSPVTETN-EVIKP-LRVTTIVSLPFVF-YKDNSPDIKEHDTSIDAWNGFCIDLLNEIGADLRLNFSIHLVKDNKYGTVVDNETNPDGSEKWNGMIGELISKEADLVVAPMTISYEREKVVDFTTPFMSLGLSILFLTPQKEAPGLFSFLSPLSPLVWVYVISAYIGVSLIIYFISHVTPYEWLQIHPCDDNGS-RQNQFNILNSLWFTVAALMRQGLEFCPQASSTRMVSSAWWFFTLIIISTYTANLAAFLTVEQIVLPIKSVEDLVNQKTIKYGTLKGGASEAFFERALIQTYKKMHKYMENNPDVMVRSTEEGVDKVLKSNGKYAFLLESAMNDYYKERECTLIRVGDMLDSKGYGIGFPTGSPLRDKMTKSILKLQKSQKLSNLIHKWWNEFNITEPCDTKEKGSIPTALDVHQVGGVFLLLGVGFIFASMVSVIELYVTYCEGTCKWNVPFHIYFQKELQFAVR--FMSSSKKPLN---------TYNVDN-KSRERLLILDYKQENYNAPSNRTSLHLHN 908          
BLAST of SMED30005367 vs. Planmine SMEST
Match: SMESG000005192.1 (SMESG000005192.1)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 334/925 (36.11%), Postives = 528/925 (57.08%), Query Frame = -2
Query:  280 LNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFL-DMSPVSLQPIQRKLSINLYPHYSSITTCITDFFKNIKEI--IVIIYMKSEDLIKFTDLLNKFEQQVVLKK-IEFDV--NEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVP---IEDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIP-IKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIP-KAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPK--SPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGEL-DHE---EGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTN--YAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKPPVDDSSNGSSPITYPVASMEEYNRHLGLD-EEDSRNQPSQSLNKAFNN 2994
            L IG IF   ++         ++ AN+ L            ++F+ +   + +  SF    KAC LL+  ++A+I P   + +  + S   +F IP L              ++I LYP+  +    I  +   I+    ++II+     ++K+  LLN+FE    +++ I  D+  N+++L K  KS+ + HF+VD+PYW    F+     +N+T   + ++FT+WD ++L+L     N   NIT  +L+    +   + + +++     +I    K   K+ I   L    AII DS+ +L +G   L ++  +  +  + C + T W  GIS  N+I S+  IK                   + +S+ +L    F +    WN  N +  P K+K+ + + N E+ K  LRVTTI+  PFV   K ++  I     S DAW GFCI +L +I  +   NF++  V+D KYG + D+E   +G  KW G++G LIS +ADL V+ +TI+Y+RE+V+DFTTPFM+LG+SI++  P  +   LFSFLSPLS  VW YVI++YI VS +++ I  +TPYEW    PC  N     N+FNILNS+WFT+   M+QG++  P+A+STR+++  WWFFTLIIIS+YTANLAAFLTV ++ +PI++ EDL  Q  I YG +KGGA+  FFE++ + TYKKM+KYM  NP V V+S +EG+++V  +N  YAF+LES  N+YY +R+C L+RVG +LDSKGYGIG P GS  RD +++SIL+LQKSQ++  L   +W +++I +PC+  EK +  ++L +++VGGVF++L  G     +V++ EL+    + +        I  ++ L+  +R  + SS+K P++         TY V + +   R L LD ++++ N PS   +   +N
Sbjct:   29 LTIGVIFEANDDVSRKVVSVAVQNANSQLMRY--------NYSFRIVTETVDDNGSFSVIRKACNLLQNGLVALIAPLSEIPSRHLSSFSNRFHIPHLVTKCQFPESSASYPMNIKLYPNCDAYANIIFQYITQIEAWGEMIIIHKSDNCIMKYEYLLNQFEYHFKMRQWIHGDLKKNKEFLRKLAKSRKHKHFLVDLPYWEIRDFLIMVSTHNLTGPAHSFIFTDWDARILDLSVFKINNKVNITAFSLINDSLVTSLRTRHKNLNSLMENIFESRKLSKKSFINTNLLAAPAIIIDSINVLMEGLIRLIKLQPV-FTQPMKCTTNTTWNQGISLFNAITSVDHIKQ------------------YNLSVMELTENGFMKK-GYWNGNNFVIFPPKSKSPVTETN-EVIKP-LRVTTIVSLPFVF-YKDNSPDIKEHDTSIDAWNGFCIDLLNEIGADLRLNFSIHLVKDNKYGTVVDNETNPDGSEKWNGMIGELISKEADLVVAPMTISYEREKVVDFTTPFMSLGLSILFLTPQKEAPGLFSFLSPLSPLVWVYVISAYIGVSLIIYFISHVTPYEWLQIHPCDDNGS-RQNQFNILNSLWFTVAALMRQGLEFCPQASSTRMVSSAWWFFTLIIISTYTANLAAFLTVEQIVLPIKSVEDLVNQKTIKYGTLKGGASEAFFERALIQTYKKMHKYMENNPDVMVRSTEEGVDKVLKSNGKYAFLLESAMNDYYKERECTLIRVGDMLDSKGYGIGFPTGSPLRDKMTKSILKLQKSQKLSNLIHKWWNEFNITEPCDTKEKGSIPTALDVHQVGGVFLLLGVGFIFASMVSVIELYVTYCEGTCKWNVPFHIYFQKELQFAVR--FMSSSKKPLN---------TYNVDN-KSRERLLILDYKQENYNAPSNRTSLHLHN 909          
BLAST of SMED30005367 vs. Planmine SMEST
Match: SMESG000005201.1 (SMESG000005201.1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 330/906 (36.42%), Postives = 512/906 (56.51%), Query Frame = -2
Query:  391 LIFVLNLSHSDTKVQNLNIGAIFTNGNEDQELAFKKGIEEANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIAIIGPTDSVAADEIESIYAQFGIPFLDMS---PVSLQPIQRKLSINLYPHYSSITTCITDFFKNIK--EIIVIIYMKSEDLIKFTDLLNKFEQQVVLKK-IEFDV--NEKYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDIQLLNLENVTFNTAANITTLALVP---IEDQKFKDRSMVEFQRHIATKEKEKHKTLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAPGISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESFNTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSP-----DAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGEL----DHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNT--NYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFYXXXXXXXXXKTTICIEAKEILRMNIRSCYRSSNKPPVDDSSNGSS 3042
            L+F+ +    ++  +NL IG I    ++         I++AN  LA+          +  +     ++E  SF    K C L+   ++A+I P   V +  I S+ ++F IP L  S   P SL   +  + I + P        I  +   ++    +++I+     ++KF  LLN+FE +  +++ +  D+  N++   +  KS+ Y +F+VDIPYW    F+  A  +NMT   + ++F++WD  L+++     N   NITT ++V    I   K     +      I   EK      I     +  AI++D++  L KG   + +    ++   L C+S T W  G S +N+I S   +++ G +  I  +E   R+N+ +S+  L    F ES   W + +++     K +     ++  KQ L+VTTII+ PFV        GI  ++      DAW GFCI +LK+I  + G NF++  V+D  +G +     + +G  KW+G++G LIS + DL V+ +TI+Y+RE+V+DFTTPFM+LG+SI++  P  +   LFSFLSP+S PVW YVI+ YI  S ++F I  +TPYEW  S PC        N+FN+LNS+WFT+G  ++QG++  P+A+STR+++G WWFFTLIIIS+YTANLAAFLTV ++ +PI++ EDL  Q KI YG ++GGA+  FFE + + TYKKM  +M +NP   V +  +G+ +V+N+   YAF+LES  N+YY QRDC L+RVG LLDSKGYGIG P GS  RD ++ESIL+LQKSQ+I  L   +W + ++ +PC+  +K +   SL +N+VGGVF +L  G      V+I EL+    +K    K   C   K+ L+  +R    SS KP   +++NG S
Sbjct:   10 LLFICSTESQESPKENLTIGVILNYNDDISRKVIGMAIQKANIELAKL--------NYALQVKTETLEENSSFFVIRKGCNLIRHGLVAMISPIAEVPSRHISSLCSKFHIPHLVTSCRFPESLD--KYPMDIQITPDCDQYAKIIYQYITQVEIWRDMILIHSSDNCILKFEHLLNQFESRFKMRQWVHHDLKKNKQLFWELSKSQKYRYFLVDIPYWQITDFLIMASVHNMTDPQFSFIFSDWDANLVDIAAFKINNKVNITTFSIVDHKLIAKTKDVQSDLKSLIDSIIKMEKSSKNADIETKFMSTPAILFDAISTLLKGIIHMLKTRPFSVKP-LKCSSNTIWNLGPSLVNAITSA--EAIQGFTGKIIFNEKSQRENYNLSVMGLTENGFEES-GRWVE-DQLITSIKKQEAVSTEVDKVKQPLKVTTIINLPFVFY----KEGIPNRNDYDTNIDAWNGFCIDLLKEIGSDLGLNFSIHLVKDGLFGTVIPNETYPDGSEKWSGMIGELISKEVDLVVAPMTISYEREKVVDFTTPFMSLGLSIMFLAPQKEAPGLFSFLSPISPPVWVYVISVYILTSLIIFFISHITPYEWMISHPCDDESS-KHNQFNLLNSLWFTVGALVRQGLEFCPQASSTRMVSGAWWFFTLIIISTYTANLAAFLTVEQLILPIKSVEDLVNQTKIKYGTLRGGASQAFFENALIYTYKKMDAFMKKNPDSMVATTDDGVAKVRNSKGKYAFLLESAMNDYYAQRDCKLIRVGDLLDSKGYGIGFPTGSPLRDKMTESILKLQKSQKIANLIHKWWNEINVTEPCDTKDKGSIPQSLNVNQVGGVFFLLGAGFIFAGFVSIIELYVDFREKKSQWKMPFCKFLKKELQFAMR-FMSSSKKPTRPNNNNGKS 894          
The following BLAST results are available for this feature:
BLAST of SMED30005367 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK20.000e+037.98glutamate ionotropic receptor kainate type subunit... [more]
GRIK20.000e+038.62glutamate ionotropic receptor kainate type subunit... [more]
GRIK20.000e+038.25glutamate ionotropic receptor kainate type subunit... [more]
GRIK20.000e+038.25glutamate ionotropic receptor kainate type subunit... [more]
GRIK20.000e+038.93glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of SMED30005367 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-34.158e-13633.93GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-45.715e-12133.46GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-49.294e-12133.59GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-52.490e-11730.64GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-11.028e-10840.88Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of SMED30005367 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KaiR1D1.827e-17835.57gene:FBgn0038837 transcript:FBtr0083987[more]
CG111551.440e-17237.40gene:FBgn0039927 transcript:FBtr0333701[more]
CG111551.440e-17237.40gene:FBgn0039927 transcript:FBtr0089195[more]
Ekar3.324e-16737.45gene:FBgn0039916 transcript:FBtr0110906[more]
Ekar8.554e-16537.33gene:FBgn0039916 transcript:FBtr0344874[more]
back to top
BLAST of SMED30005367 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK20.000e+037.11glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK20.000e+037.11glutamate receptor, ionotropic, kainate 2 [Source:... [more]
LO018303.13.724e-17636.42glutamate receptor ionotropic, kainate 3 [Source:N... [more]
grik1b6.235e-17638.03glutamate receptor, ionotropic, kainate 1b [Source... [more]
grik1b1.166e-17437.82glutamate receptor, ionotropic, kainate 1b [Source... [more]
back to top
BLAST of SMED30005367 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK20.000e+038.17glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK20.000e+039.35glutamate receptor, ionotropic, kainate 2 [Source:... [more]
ugt2a10.000e+038.65UDP glucuronosyltransferase 2 family, polypeptide ... [more]
ugt2a10.000e+037.56UDP glucuronosyltransferase 2 family, polypeptide ... [more]
GRIK20.000e+039.35glutamate receptor, ionotropic, kainate 2 [Source:... [more]
back to top
BLAST of SMED30005367 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik20.000e+037.98glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik20.000e+037.98glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik20.000e+038.25glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik20.000e+038.25glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik20.000e+038.25glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
back to top
BLAST of SMED30005367 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39087|GRIK2_MOUSE0.000e+037.98Glutamate receptor ionotropic, kainate 2 OS=Mus mu... [more]
sp|P42260|GRIK2_RAT0.000e+037.98Glutamate receptor ionotropic, kainate 2 OS=Rattus... [more]
sp|Q13002|GRIK2_HUMAN0.000e+037.98Glutamate receptor ionotropic, kainate 2 OS=Homo s... [more]
sp|Q38PU3|GRIK2_MACFA0.000e+037.87Glutamate receptor ionotropic, kainate 2 OS=Macaca... [more]
sp|P42264|GRIK3_RAT0.000e+037.16Glutamate receptor ionotropic, kainate 3 OS=Rattus... [more]
back to top
BLAST of SMED30005367 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4ES970.000e+045.73Putative glutamate receptor, kainate OS=Schistosom... [more]
A0A4Z2DUZ10.000e+045.61Glutamate receptor ionotropic, kainate 3 OS=Schist... [more]
A0A4E0RCU80.000e+044.91Glutamate receptor ionotropic kainate 3 OS=Fasciol... [more]
A0A3R7FCV20.000e+045.68Glutamate receptor ionotropic (Fragment) OS=Clonor... [more]
A0A074ZP091.280e-4046.40Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of SMED30005367 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000004586.20.000e+037.34glutamate receptor ionotropic, kainate 2-like [Sou... [more]
GRIK20.000e+037.23glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK21.399e-18037.83glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK21.919e-18037.83glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK23.706e-17937.71glutamate receptor ionotropic, kainate 2 [Source:N... [more]
back to top
BLAST of SMED30005367 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005084.13.205e-12253.50pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
gria1b3.084e-11142.44glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000002503.12.515e-7356.91pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
ENSPMAT00000007790.12.680e-4129.19pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
ENSPMAT00000010716.11.951e-3827.95pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
back to top
BLAST of SMED30005367 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005367 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302036.594e-7031.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412911.507e-6932.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466337.501e-5828.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355451.519e-5629.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412932.525e-5635.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30005367 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK20.000e+037.11glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK25.144e-17937.06glutamate ionotropic receptor kainate type subunit... [more]
grik1b5.516e-17837.99glutamate ionotropic receptor kainate type subunit... [more]
GRIK22.005e-17537.57glutamate ionotropic receptor kainate type subunit... [more]
GRIK32.755e-17436.85glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of SMED30005367 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062485.10.000e+0100.00SMESG000062485.1[more]
SMESG000005199.10.000e+037.93SMESG000005199.1[more]
SMESG000005192.10.000e+036.11SMESG000005192.1[more]
SMESG000005192.10.000e+036.11SMESG000005192.1[more]
SMESG000005201.10.000e+036.42SMESG000005201.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005367 ID=SMED30005367|Name=SMED30005367|organism=Schmidtea mediterranea sexual|type=transcript|length=3670bp
AAAAAAAAGTATAAATTTATTCTTAATGGATTTTTTTTACTAAAAATTAA
TAGGTATATAATGTGTTTGTCTAAATTAACAAGCCACTTTTTTCATTCTA
ACTTGACAATTGCTGCTTGTATCAACAGACGATAAAGGGTTCGTAGAAAT
GTGAGAGTCTTGAAAAATCATTTTATGATTATTCGATTGCATAGGATGTA
TATTTAGAGGCTGAATTTTAGTTGCTGGAGGCAAGTGATAAATAGGACTA
GATGGACGAATTGCAAAATCATATGGCAAATTATTAAAAGCCTTATTTAG
AGATTGACTGGGTTGATTGCGACTATCCTCTTCATCCAAACCCAAATGTC
GATTATATTCTTCCATCGAAGCAACTGGATAAGTAATTGGCGAGGAACCA
TTTGAAGAATCATCAACTGGAGGCTTATTCGAGCTCCGATAACAACTTCT
GATATTCATTCGAAGAATTTCTTTGGCTTCAATACAAATGGTTGTCTTTT
TGATTTTTGACTTCTTCCATGCCTTATAAAACAACTCAAATATTGCGACA
AGTAATCCAATTGCAATTCCGAAAAAAAGCATTACAAATACACCGCCAAC
TTCGTTAATTCCAAGAGAACTTGTGGAAGCTGATTTTTCAGGTGCTTCGC
AAGGTTTATCAATGTCGTATTGACGCCAATAATACCGACGTAACGCTTCG
ATTTCTTGAGATTTTTGAAGTCTTAATATAGATTCGGAAATCGCATCTCG
ATACCGCGACCCTTCTGGTAAACCTATTCCATACCCTTTAGAATCTAATA
ACCCACCAACACGCATCAAATCGCAGTCTCGTTGTGTATAATACTCATTA
GTAGTCGATTCCAAGATAAATGCATAATTAGTATTTTTAACTCTTTCAAT
ACCTTCTTTGTTGCTTTTAACGAAAACTGAAGGATTTCTGTTCATATATT
TGTACATCTTTTTATAAGTAGCAAGGTCAGATTTCTCAAAAAAGGTATAT
GTTGCACCACCTTTAACTGCGCCATATGGAATTTTCACTTGTTTGCTAAG
ATCTTCGGCATTCTCAATTGGGACATTCATTCTTGCAACTGTTAAAAATG
CAGCTAAATTTGCAGTATATGAGCTTATAATTATGAGAGTAAAGAACCAC
CACATCCCAGCAATAATTCTTGTTGAAGTCGCTTTTGGCATGATATCAAT
ACCTTGTTGCATAAATGTTCCAATTGTAAACCACATGCTGTTCAAAATGT
TAAACCTATTTGAACTAAATTCTGGATTTTTTTGACATGGACTGCTATTA
TACCATTCATAAGGCGTTAATCTTCCAATAACAAATAGCACAAAACTGAC
AGAAATATATGAAGCAATTACATAACCCCAGACAGGAACAGATAATGGGG
AAAGAAATGAAAATAGTTCAACTTCTTTTGGAGCAGGTTTTTTATAAATT
ATGCTGATTCCTAAATTCATAAATGGAGTGGTAAAATCTATTACTCTTTC
CCGATCATATGTAATAGTTAGAGAGGATACTGCCAGATCCGCTTTGTGAC
TTATTAAAGCTCCAACGAGTCCAGTCCATTTTGGAACTCCTTCTTCATGA
TCTAGTTCACCATATTTTTTATCTTCCACTTCTTCGACTGTAAAATTGAA
ACCTCGCTCTTCCGCGATTTTCTTTAAAATTTGAATACAAAATCCTGCCC
ATGCATCAGGGGATTTGGGAGTAATTCCATTAGCATCTCTTTTTAAACTA
ATGACAAAAGGCGGATCAATTATGGTTGTCACTCTAAGAACTTGTTTACT
AATTTCTAGATTGAGATCTTTGAGATCGGTTTTTGCTTTTGGTATTCCCA
TCCGATTTGTTTTATTCCATGTGTTAAAACTTTCAAAAAACGATCTATTG
TTTAGTTGGCGAATAGAGATTTGGAAATTATCTCTCCATCCATTTTCGTC
TACTGTTATGGGATTACTATTTCCTGTTAGGGACTTTATTGGAATTGATT
TAATAGAATTAAGAAAACTGATACCGGGAGCCCAATTAGTCTTGGAATTG
CATGAAAGAGTTGATGACAAATTAATTGAACTCATCCTTGCGAGACTCGC
AAATCCCTTAGCGAGTAATCGAAGACTGTCATAAATGATTGCAGTTTCGG
TAGTTAAAGCTGCATATATTAAAGTCTTATGTTTTTCTTTTTCTTTGGTT
GCAATGTGCCTTTGGAATTCTACCATTGATCTGTCTTTAAATTTTTGATC
CTCTATTGGAACAAGTGCCAGTGTTGTTATGTTTGCCGCAGTATTAAATG
TAACATTTTCTAAATTCAATAACTGAATATCCCAATTAGTAAATAAGTAT
TCATAATACTGAGTAGTCATGTTGTAATAATCAGCTGTTTTTATGAATTG
AGCAAAATTCCAGTATGGAATGTCGACGATAAAATGAAGATAATTTTTAG
ATTTGAGATCTTTCATTAAGTACTTTTCATTTACATCAAATTCAATCTTT
TTAAGGACCACTTGTTGTTCAAACTTGTTGAGCAAATCAGTAAACTTAAT
TAGATCTTCACTTTTCATGTAAATAATCACAATTATCTCTTTGATATTTT
TGAAAAAATCCGTTATACATGTTGTTATACTAGAGTAATGAGGATAGAGA
TTTATAGACAATTTTCTTTGAATAGGCTGTAACGATACTGGACTCATGTC
AAGGAAGGGTATACCAAACTGAGCATAAATTGACTCTATTTCATCAGCAG
CCACTGAATCAGTTGGCCCAATAATAGCTATCACTTTCTTTTCAAGTAAT
TCACATGCTTTTTCAGAAGCCTCAAAACTATCGTATTCTTTGATTTTCAT
AATAATATATTTAAAATTAAATGCTGGAACATTATCTTTCTTTTTAAATT
CTTCTGCTAAAATATTATTTGCTTCTTCAATTCCTTTCTTAAATGCTAAT
TCTTGGTCTTCATTACCGTTAGTAAAGATAGCTCCGATATTAAGATTCTG
GACTTTGGTGTCTGAATGAGAGAGATTAAGTACGAAGATCAGTTGATAAA
GTATTATTATCCACAAGGAATTCATGAGCAAAAAACGAATTTTGTAGAAA
TGTAATTTTCAAATTAAGTAAAGCACCAAAATAGACAGGTGAAATGTGTA
AAATATTTTGTTGTTGGGTGGAATTGGAAATTGTTTTAATTATTTTTCTC
CAATTGATTTATGAAAAAATAGACTAAGGGAGGACTAGATTGACTTGACT
TGAAACTATTAACATCTAAATTGACAGTTTGGGAGCAATGGAGCATGAAT
AGCTAGGTGTTATTTTCGGTAGCAGGAATTCTGTTGCATTTTTCACATCC
ATATTTTCCGTGTAAAAGACAAGTGCAACGAATGAATTGATGGGAGAGCT
ATTAGATTCTACTTGACTACTAATCAATTTGATTAAACTCGTTTCTATTG
GAAAATTAGATTGAACAGAATAATATACAACAGCCTTAGTGTCAATTCTG
ACGAAGAAACCTCTAAAGTAAAAATTTTCTTCAATCAAACGATAATTGTC
TGTATTTGTAAAGAGAGAGATATAGAGAGAGAAAGAAAGAGACAGAGAAA
GAGAGAGACAAACAGACAGACAGAAAATATTTATCATCAATGGAATTCAT
TTGGGTTAGAGAGAACGCAG
back to top

protein sequence of SMED30005367-orf-1

>SMED30005367-orf-1 ID=SMED30005367-orf-1|Name=SMED30005367-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MINIFCLSVCLSLSLSLSFSLYISLFTNTDNYRLIEENFYFRGFFVRIDT
KAVVYYSVQSNFPIETSLIKLISSQVESNSSPINSFVALVFYTENMDVKN
ATEFLLPKITPSYSCSIAPKLSI*
back to top

protein sequence of SMED30005367-orf-2

>SMED30005367-orf-2 ID=SMED30005367-orf-2|Name=SMED30005367-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1000bp
MNSLWIIILYQLIFVLNLSHSDTKVQNLNIGAIFTNGNEDQELAFKKGIE
EANNILAEEFKKKDNVPAFNFKYIIMKIKEYDSFEASEKACELLEKKVIA
IIGPTDSVAADEIESIYAQFGIPFLDMSPVSLQPIQRKLSINLYPHYSSI
TTCITDFFKNIKEIIVIIYMKSEDLIKFTDLLNKFEQQVVLKKIEFDVNE
KYLMKDLKSKNYLHFIVDIPYWNFAQFIKTADYYNMTTQYYEYLFTNWDI
QLLNLENVTFNTAANITTLALVPIEDQKFKDRSMVEFQRHIATKEKEKHK
TLIYAALTTETAIIYDSLRLLAKGFASLARMSSINLSSTLSCNSKTNWAP
GISFLNSIKSIPIKSLTGNSNPITVDENGWRDNFQISIRQLNNRSFFESF
NTWNKTNRMGIPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANG
ITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKW
TGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPK
EVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKN
PEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIII
SSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSD
LATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRD
CDLMRVGGLLDSKGYGIGLPEGSRYRDAISESILRLQKSQEIEALRRYYW
RQYDIDKPCEAPEKSASTSSLGINEVGGVFVMLFFGIAIGLLVAIFELFY
KAWKKSKIKKTTICIEAKEILRMNIRSCYRSSNKPPVDDSSNGSSPITYP
VASMEEYNRHLGLDEEDSRNQPSQSLNKAFNNLPYDFAIRPSSPIYHLPP
ATKIQPLNIHPMQSNNHKMIFQDSHISTNPLSSVDTSSNCQVRMKKVAC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: molecular function
TermDefinition
GO:0038023signaling receptor activity
GO:0015276ligand-gated ion channel activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR019594Glu/Gly-bd
IPR001320Iontro_rcpt
IPR001828ANF_lig-bd_rcpt
IPR028082Peripla_BP_I
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 637..664
score: 53.21
coord: 826..850
score: 33.2
coord: 565..590
score: 27.31
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 439..509
e-value: 4.2E-8
score: 42.9
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 429..547
e-value: 1.2E-35
score: 122.2
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 429..802
e-value: 5.5E-86
score: 301.7
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 563..837
e-value: 2.3E-49
score: 167.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 29..383
e-value: 4.5E-67
score: 228.9
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 457..819
e-value: 2.3E-134
score: 449.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 549..847
e-value: 2.3E-134
score: 449.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 146..404
e-value: 4.5E-67
score: 228.9
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 539..765
e-value: 2.3E-134
score: 449.7
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 74..859
NoneNo IPR availablePANTHERPTHR18966:SF370coord: 74..859
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.701
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 565..661
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 427..801
NoneNo IPR availableTMHMMTMhelixcoord: 641..663
NoneNo IPR availableTMHMMTMhelixcoord: 562..584
NoneNo IPR availableTMHMMTMhelixcoord: 828..850
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 58..393
e-value: 2.2E-26
score: 92.8
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 27..404