Adenylate kinase 9-like protein

Overview
NameAdenylate kinase 9-like protein
Smed IDSMED30005363
Length (bp)603
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenylate kinase 9-like protein (SMED30005363) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenylate kinase 9-like protein (SMED30005363) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005363

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005363SMESG000001945.1 Contig2573newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005363SMESG000001945.1 Contig2573uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenylate kinase 9-like protein vs. TrEMBL
Match: A0A4Y2I6B1 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_158155_1 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.057e-24
Identity = 55/128 (42.97%), Postives = 83/128 (64.84%), Query Frame = 2
Query:    5 KLPPNLQVLHV-FFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDPQIKKENQFVQLFSKFFDIALQDALELMAIQEDKEFLIDQR-GGR*GCMNGID 382
            KLP N QVL V F++LH + KL+IR+S+       ++FWEKASIP++A    +EKI  ++  W+NL  +  R+ + Q + E  F+   +  FDIA  +ALE++ I+ED++ L+ QR  GR GC+ GID
Sbjct:   26 KLPSNRQVLSVLFYNLH-EVKLSIRKSANLVVRECLIFWEKASIPTRATPHCVEKIMKMYNHWRNLQKSACRRSETQEENERNFISDLNYLFDIAHANALEIIKIEEDRKLLLSQRESGRRGCLMGID 152          
BLAST of Adenylate kinase 9-like protein vs. TrEMBL
Match: A0A4Y2ID55 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_195305_1 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.488e-24
Identity = 56/128 (43.75%), Postives = 82/128 (64.06%), Query Frame = 2
Query:    5 KLPPNLQVLHV-FFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDPQIKKENQFVQLFSKFFDIALQDALELMAIQEDKEFLIDQR-GGR*GCMNGID 382
            KLP N QVL V F++LH + KL+IRES+       ++FWEKA IP++A    +EKI  ++  W NL  +  R+ + Q + E  F+   +  FDIA  +ALE++ I+ED++FL+ QR  GR GC+ GID
Sbjct:   26 KLPSNRQVLSVLFYNLH-EVKLSIRESANLVVRECLIFWEKARIPTRATPHCVEKIMKMYNYWSNLQKSACRRSETQEENERNFISDLNNLFDIAHANALEIIKIEEDRKFLLSQREPGRRGCLMGID 152          
BLAST of Adenylate kinase 9-like protein vs. TrEMBL
Match: A0A4Y2X8N8 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_118887_1 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.521e-24
Identity = 55/129 (42.64%), Postives = 82/129 (63.57%), Query Frame = 2
Query:    2 SKLPPNLQVLHV-FFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDPQIKKENQFVQLFSKFFDIALQDALELMAIQEDKEFLIDQR-GGR*GCMNGID 382
             KLP N QVL V F++LH + KL+IRES+       ++FWEKA IP++A    +EKI  ++  W+NL  +  R+ +   + E  F+   +  FDIA  +ALE++ I+ED++FL+ QR  GR GC+ GID
Sbjct:   25 CKLPSNRQVLSVLFYNLH-EVKLSIRESANLVVRECLIFWEKARIPTRATPHCVEKIMKMYNYWRNLQKSACRRSEKPEENERNFISDLNNLFDIAHANALEIIKIEEDRKFLLSQREPGRRGCLMGID 152          
BLAST of Adenylate kinase 9-like protein vs. TrEMBL
Match: A0A4Y2D7X6 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_247602_1 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.058e-24
Identity = 55/128 (42.97%), Postives = 83/128 (64.84%), Query Frame = 2
Query:    5 KLPPNLQVLHV-FFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDPQIKKENQFVQLFSKFFDIALQDALELMAIQEDKEFLIDQR-GGR*GCMNGID 382
            KLP N QVL V F++LH + KL+IRES++  A   ++FWEKA IP++A    +EKI  ++  W+NL  +  R+ + Q + E  F+   +  FDIA  +ALE++ I+ED++ L+ QR  G  GC+ GID
Sbjct:   26 KLPSNRQVLSVIFYNLH-EVKLSIRESASLVARECLIFWEKARIPTRATHHCVEKIMKMYNNWRNLQKSACRRSETQEENERNFISDLNNLFDIAHANALEIIKIEEDRKLLLSQRESGWTGCLMGID 152          
BLAST of Adenylate kinase 9-like protein vs. TrEMBL
Match: A0A4Y2RBQ4 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_3992_1 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.669e-24
Identity = 54/128 (42.19%), Postives = 84/128 (65.62%), Query Frame = 2
Query:    5 KLPPNLQVLHV-FFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDPQIKKENQFVQLFSKFFDIALQDALELMAIQEDKEFLIDQRG-GR*GCMNGID 382
            KLP N QVL V F++LH + KL+IRES+T      ++FW+KA IP++A    +E+I  ++  W+NL  +  R+ + Q + E  F+   +  FDIA  +A E++ I+ED++F++ QRG GR GC+ GID
Sbjct:   26 KLPSNRQVLSVLFYNLH-EVKLSIRESATLVVRECLIFWDKARIPTRATPHGVEEIMKMYNHWRNLQKSACRRSETQEENERNFISDLNNLFDIAHANAFEIIKIEEDRKFVLSQRGPGRRGCLMGID 152          
BLAST of Adenylate kinase 9-like protein vs. Planmine SMEST
Match: SMESG000028508.1 (SMESG000028508.1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.288e-21
Identity = 55/127 (43.31%), Postives = 72/127 (56.69%), Query Frame = 2
Query:    5 KLPPNLQVLHVFFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDPQIKKENQFVQLFSKFFDIALQDALELMAIQEDKEFLIDQR-GGR*GCMNGID 382
            KLP  LQVL +F H H ++  TIR +ST   E    FW+KA IP++A      K+E+ F  W+ L  N  RK + Q  KE  F       FDIA  DA + + I+ED++FLI QR  GR G M G+D
Sbjct:  510 KLPSLLQVLGLFLHEHKENGKTIRVASTIAIESTAKFWQKARIPTRAVHHCQAKLESEFDAWRLLKKNASRKAETQKAKEAAFCSRLDDLFDIAHADAHKNIKIEEDRKFLIAQREKGRRGSMLGLD 636          
BLAST of Adenylate kinase 9-like protein vs. Planmine SMEST
Match: SMESG000064988.1 (SMESG000064988.1)

HSP 1 Score: 62.003 bits (149), Expect = 3.335e-11
Identity = 37/119 (31.09%), Postives = 61/119 (51.26%), Query Frame = 2
Query:   35 VFFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDPQIKKENQFVQLFSKFFDIALQDALELMAIQEDKEFLIDQRGGR*GCMNGIDRET 391
            V  H H + KLTI ES+ R  + ++ FW K+ I  +    +I+KI+ L   +  L  +R R        + ++     K FDI+  +  EL+  +ED+ FL  Q+  R GC+  +D +T
Sbjct:  147 VAHHYHRNQKLTIAESTQRVYDQLLPFWTKSRIQVRHKPHIIQKIKDLHCQYVGLVKHRSRNNSKDQLNQKEYNDKLDKLFDISHANCYELIKNEEDRMFLKLQQESRMGCIGSVDIKT 265          
BLAST of Adenylate kinase 9-like protein vs. Planmine SMEST
Match: SMESG000078047.1 (SMESG000078047.1)

HSP 1 Score: 50.447 bits (119), Expect = 3.966e-8
Identity = 27/105 (25.71%), Postives = 52/105 (49.52%), Query Frame = 2
Query:    2 SKLPPNLQVLHVFFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDPQIKKENQFVQLFSKFFDIALQDALELMAI 316
            ++LP    ++  F +   + KL + ES+ R  + ++ FW K+ IP +   ++I+KI+ L+     L  +R R        + ++     K FDI+   +LE  A+
Sbjct:    5 ARLPSGRDIMRNFVYYRRNQKLAVAESAQRVYDQLLQFWTKSRIPVRHKPQIIQKIKNLYCQHVGLVNHRSRNNSKDQLNQKEYNDKLDKLFDISCSKSLEWAAL 109          
BLAST of Adenylate kinase 9-like protein vs. Planmine SMEST
Match: SMESG000000162.1 (SMESG000000162.1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.009e-7
Identity = 36/119 (30.25%), Postives = 58/119 (48.74%), Query Frame = 2
Query:    5 KLPPNLQVLHVFFHLHIDSKLTIRESSTRTAELVILFWEKASIPSKA*SRVIEKIETLFTGWKNL*MNRLRKLDP-QIKKENQFVQLFSKFFDIALQDALELMAIQEDKEFLIDQRGGR 358
            +LP N   L   +     +K T+  + +  A+ V+ +W KA+IP+ A   V+ K+++L      +  ++ R+    QI  E  F        DIA  +      I ED++FLIDQRG R
Sbjct:   42 QLPTNGLALRRIYCEMKTNKATLAATFSTLADEVLSYWAKANIPTTAKPHVVAKLKSLHQDHATVSKHKQRQHSASQIGLETDFTLKMGHLLDIAHAEWEHKTFIPEDRQFLIDQRGPR 160          
The following BLAST results are available for this feature:
BLAST of Adenylate kinase 9-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2I6B11.057e-2442.97Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2ID551.488e-2443.75Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2X8N81.521e-2442.64Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2D7X62.058e-2442.97Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2RBQ43.669e-2442.19Uncharacterized protein OS=Araneus ventricosus OX=... [more]
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate kinase 9-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000028508.13.288e-2143.31SMESG000028508.1[more]
SMESG000064988.13.335e-1131.09SMESG000064988.1[more]
SMESG000078047.13.966e-825.71SMESG000078047.1[more]
SMESG000000162.11.009e-730.25SMESG000000162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005363 ID=SMED30005363|Name=Adenylate kinase 9-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=603bp
ATCCAAGTTGCCACCCAATCTCCAAGTTCTTCATGTTTTCTTTCATCTTC
ATATCGATTCAAAGCTCACAATCAGAGAAAGTTCTACGCGCACTGCAGAG
CTTGTTATTCTGTTCTGGGAAAAAGCATCTATTCCTTCTAAAGCTTAGAG
TCGTGTGATTGAAAAAATCGAAACTTTGTTCACTGGCTGGAAAAATCTTT
AGATGAACAGATTACGTAAGTTGGATCCACAAATCAAGAAAGAGAACCAA
TTCGTTCAGCTGTTTTCAAAATTCTTTGACATCGCACTTCAAGATGCACT
AGAGTTAATGGCAATCCAGGAAGATAAGGAATTTCTTATTGATCAGCGAG
GAGGTCGCTAAGGTTGTATGAATGGTATCGATAGGGAAACGATGAAGAAT
ACCAAAAAGAAAAAAAACTTCAATTTTATAAGATGAAGGCCATACATGAA
TAAGCGAATCCTCAACAAGCCACAAATGAAAAAATAGAATGCCACTAGAT
CTAGTGATTAAAGTGAAGTTTAAGAGCCATAAACAGGTTTCTCAGACCCT
CCTTCAAAACGAGCTAGAAAAACTTTCGTATCACCATTGCTTTCATCCGT
TCT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation