Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30005346
Length (bp)2760
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30005346) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30005346) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30005346) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30005346) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005346

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005346SMESG000080078.1 SMESG000052932.1 Contig937GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005346SMESG000021124.1 Contig937GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP4 (ubiquitin specific peptidase 4 [Source:HGNC Symbol;Acc:HGNC:12627])

HSP 1 Score: 453.751 bits (1166), Expect = 1.300e-144
Identity = 293/864 (33.91%), Postives = 438/864 (50.69%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQS-DGRVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSD-NKDEWIHLTM-----------RTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDC-------------------------------------IDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPI---KALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            + +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  +   DAGL  G+ + I+ Q+ D  W   ++ Q + +   +  N ++     +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D   +  + ++ V     V D  + +  L   +A   +   ++  +R  +++   +  N +   +++ VYE+ S+  +  E + L +            +     +G P+++SV K ++   SL   +  R+      P  ++   +  E   C                                      DP     +  K  P  K        +     D+ S     K L+ + R  L +DW  E +  +YD  + E  E H SM    +     + + +C+  F   E LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV          N      +YDL+AVSNH G +G GHYTA+A N ++  WY FDDS+ S  + D + TK AYVL Y
Sbjct:   25 RTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQ--DAGLYQGQVLVIEPQNEDGTWPR-QTLQSNGSGFSASYNCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRL-SGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVC---------NLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFY 873          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP4 (ubiquitin specific peptidase 4 [Source:HGNC Symbol;Acc:HGNC:12627])

HSP 1 Score: 444.891 bits (1143), Expect = 9.188e-141
Identity = 298/910 (32.75%), Postives = 441/910 (48.46%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTK----------------------LISGGNSRQSDG-------------------------RVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSD-NKDEWIHLTM-----------RTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDC-------------------------------------IDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPI---KALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            + +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  +   DAGL  G+ + I+ Q+ D  W     + +S T                       LI+ G+S  + G                          +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D   +  + ++ V     V D  + +  L   +A   +   ++  +R  +++   +  N +   +++ VYE+ S+  +  E + L +            +     +G P+++SV K ++   SL   +  R+      P  ++   +  E   C                                      DP     +  K  P  K        +     D+ S     K L+ + R  L +DW  E +  +YD  + E  E H SM    +     + + +C+  F   E LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV          N      +YDL+AVSNH G +G GHYTA+A N ++  WY FDDS+ S  + D + TK AYVL Y
Sbjct:   25 RTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQ--DAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRL-SGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVC---------NLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFY 920          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP4 (ubiquitin specific peptidase 4 [Source:HGNC Symbol;Acc:HGNC:12627])

HSP 1 Score: 343.199 bits (879), Expect = 4.116e-106
Identity = 208/593 (35.08%), Postives = 300/593 (50.59%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSD-NKDEWIHLTM-----------RTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDC-------------------------------------IDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPI---KALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHY 2371
            G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR+                   A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D   +  + ++ V     V D  + +  L   +A   +   ++  +R  +++   +  N +   +++ VYE+ S+  +  E + L +            +     +G P+++SV K ++   SL   +  R+      P  ++   +  E   C                                      DP     +  K  P  K        +     D+ S     K L+ + R  L +DW  E +  +YD  + E  E H SM    +     + + +C+  F   E LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV          N      +YDL+AVSNH G +G GHY
Sbjct:   57 GLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRV------------------VAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRL-SGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVC---------NLSARPYVYDLIAVSNHYGAMGVGHY 621          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP11 (ubiquitin specific peptidase 11 [Source:HGNC Symbol;Acc:HGNC:12609])

HSP 1 Score: 335.109 bits (858), Expect = 6.297e-100
Identity = 199/561 (35.47%), Postives = 312/561 (55.61%), Query Frame = 2
Query:  146 ELAKQKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIPKIPNSRLLNDNEVS----SDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAV--TKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDF---LDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEW--------IHLTMRTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            E  +++ L+  + WFL++K W+ +W   ++   ++++  P   N+  L  +E++      ++   DY L+P   W+++V  YG++      +R V+E+ N   VEV P++L +  +    K+ T +FS   ++  + + A  +F V   +  R+  K   G+ D +  D +I++ DA L  G+ I ++ +  D  W    S Q  V  + +  +    D + Q G+CGL NLGNTCFMNSA+QC+SNVP LT YF+   + ++LN  NPLGM G +AE Y  L++Q W       VP  FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++KK Y+E  D+  +P Q+ A+EAW+ HK RNDSVIV+ FHGL KST+VCPDC  VSVTFD F  LS+PL ++H ++  + F   D  +K  + +++V K   + D    L K   + PE     +   ++ ++R  ++Y  ++  + + D +++ VYE+       E         ++L  RT    Y         FG P++VSV ++   W  L N +  RL
Sbjct:   46 ESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRL-YDTHITVLDAALETGQLIIMETRKKDGTW---PSAQLHV--MNNNMSEEDEDFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPE----RMMVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRL 596          

HSP 2 Score: 160.229 bits (404), Expect = 1.574e-39
Identity = 83/211 (39.34%), Postives = 121/211 (57.35%), Query Frame = 2
Query: 1904 QTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMN--MQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLS 2527
            + H +  + +DW  E K+++YD  + E    H  +   M+  P+ ++ C+  F   E L   + WYC  CK  + ATKK DLW LP++LI+HLKRF    + R+K+DT VEFP+ DLD S+FV     ++    ++     YDL+AVSNH GG+  GHYT FA N     W+ FDD+  S +  + +++K AYVL Y  + V    R LLS
Sbjct:  693 EVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREKLDTLVEFPIRDLDFSEFVIQPQNESNPELYK-----YDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDV---ARRLLS 895          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP11 (ubiquitin specific peptidase 11 [Source:HGNC Symbol;Acc:HGNC:12609])

HSP 1 Score: 334.724 bits (857), Expect = 1.907e-99
Identity = 199/561 (35.47%), Postives = 312/561 (55.61%), Query Frame = 2
Query:  146 ELAKQKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIPKIPNSRLLNDNEVS----SDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAV--TKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDF---LDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEW--------IHLTMRTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            E  +++ L+  + WFL++K W+ +W   ++   ++++  P   N+  L  +E++      ++   DY L+P   W+++V  YG++      +R V+E+ N   VEV P++L +  +    K+ T +FS   ++  + + A  +F V   +  R+  K   G+ D +  D +I++ DA L  G+ I ++ +  D  W    S Q  V  + +  +    D + Q G+CGL NLGNTCFMNSA+QC+SNVP LT YF+   + ++LN  NPLGM G +AE Y  L++Q W       VP  FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++KK Y+E  D+  +P Q+ A+EAW+ HK RNDSVIV+ FHGL KST+VCPDC  VSVTFD F  LS+PL ++H ++  + F   D  +K  + +++V K   + D    L K   + PE     +   ++ ++R  ++Y  ++  + + D +++ VYE+       E         ++L  RT    Y         FG P++VSV ++   W  L N +  RL
Sbjct:   89 ESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRL-YDTHITVLDAALETGQLIIMETRKKDGTW---PSAQLHV--MNNNMSEEDEDFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPE----RMMVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRL 639          

HSP 2 Score: 159.844 bits (403), Expect = 2.128e-39
Identity = 83/211 (39.34%), Postives = 121/211 (57.35%), Query Frame = 2
Query: 1904 QTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMN--MQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLS 2527
            + H +  + +DW  E K+++YD  + E    H  +   M+  P+ ++ C+  F   E L   + WYC  CK  + ATKK DLW LP++LI+HLKRF    + R+K+DT VEFP+ DLD S+FV     ++    ++     YDL+AVSNH GG+  GHYT FA N     W+ FDD+  S +  + +++K AYVL Y  + V    R LLS
Sbjct:  736 EVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREKLDTLVEFPIRDLDFSEFVIQPQNESNPELYK-----YDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDV---ARRLLS 938          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: H34C03.2 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q9TYY8])

HSP 1 Score: 240.736 bits (613), Expect = 1.112e-66
Identity = 144/411 (35.04%), Postives = 219/411 (53.28%), Query Frame = 2
Query:  185 WFLIDKVWHHKWSRSIETKNATDIPKIPNSRLLNDNEVS----SDIISNSDYTLIPEETWNFIVDKYGIDANS-ELFQRNVVEMHNTLIVEVEPIKLTI-SIYGKENKAVTKFSRCKTLNDIYQYAMNKFAVTKPLRILQKMDNGA-FDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDG--------------------RVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQ-PVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
            W+LI + W +   +++      D+  I NS++      S      +    DYT +PE  +  +   Y ID +  +  QR VV     L +EV P  + I S   ++ KA        T+  + +  + + +++    I   + NG  ++++    +I   D+     + + +D ++    ++ GKS   +  K + G  S  S G                       G CGL NLGNTCFM SA QC+SN+PPL  YF+   ++ D+N  NPLG HG LA    +L++ MW        PR FK  + +FAP+F+GY+Q D+ ELM ++LDGLHEDLNRI+KKPY+E SD D + P  + A ++W+ +KMRNDS+IV+  HG LKST++CP C+ +S+ FD FG LSLPL
Sbjct:   51 WYLISQKWWNSLIKAVRDGFVDDVGPIDNSQISECRNGSFFLKQRLAEQVDYTPVPEILFKRLERFYHIDDDRRDYIQRRVVRKDGKLCIEVYPRIVHITSARNRDIKADLVLRPDDTMVSLRERVIGELSLSTTDNIRFYVMNGENYELIDTAQSI---DSYFDTVQKVVVDVEEDGEFFIKGKS---ATPKSLFGTQSSSSHGGNGISNSYNSPSPSTGVVTRTTPGACGLSNLGNTCFMASAFQCLSNMPPLREYFLANTYQNDINEDNPLGTHGHLAMAVGELMKGMWSGDYASINPRKFKSIIGQFAPRFNGYSQQDAHELMAYVLDGLHEDLNRIKKKPYIEDSDEDAKLPEAEYAAKSWEVYKMRNDSIIVDTLHGQLKSTLICPVCEKISIKFDPFGYLSLPL 455          

HSP 2 Score: 114.39 bits (285), Expect = 1.135e-25
Identity = 59/158 (37.34%), Postives = 90/158 (56.96%), Query Frame = 2
Query: 2018 RPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKI--ASDSVQTKTAYVLVY 2485
            R + ++  ++ F   E+LG  D WYC  CK  + ATK+  LW+LP++LILHLKRF+   + R+K+   V  P+  LDL+  V++ + +           IYDL+AVS H G L GGHYTA   N  +  W+ F+DS  +     ++  ++   Y+LVY
Sbjct:  696 RKVLLQETLDWFTTKEQLGEQDSWYCPQCKKHERATKQLALWKLPEILILHLKRFQYTKWSREKLTWEVVIPVRGLDLTDKVANPNHEK---------AIYDLIAVSRHYGSLSGGHYTAIGYNDREQKWFDFNDSSANPTYPPAEPYESSDPYILVY 844          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: H34C03.2 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q9TYY8])

HSP 1 Score: 223.402 bits (568), Expect = 1.762e-60
Identity = 100/183 (54.64%), Postives = 132/183 (72.13%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQ-PVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
            G CGL NLGNTCFM SA QC+SN+PPL  YF+   ++ D+N  NPLG HG LA    +L++ MW        PR FK  + +FAP+F+GY+Q D+ ELM ++LDGLHEDLNRI+KKPY+E SD D + P  + A ++W+ +KMRNDS+IV+  HG LKST++CP C+ +S+ FD FG LSLPL
Sbjct:  353 GACGLSNLGNTCFMASAFQCLSNMPPLREYFLANTYQNDINEDNPLGTHGHLAMAVGELMKGMWSGDYASINPRKFKSIIGQFAPRFNGYSQQDAHELMAYVLDGLHEDLNRIKKKPYIEDSDEDAKLPEAEYAAKSWEVYKMRNDSIIVDTLHGQLKSTLICPVCEKISIKFDPFGYLSLPL 535          

HSP 2 Score: 115.161 bits (287), Expect = 8.237e-26
Identity = 59/164 (35.98%), Postives = 92/164 (56.10%), Query Frame = 2
Query: 2015 HRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKI--ASDSVQTKTAYVLVYVSKSV 2500
             R + ++  ++ F   E+LG  D WYC  CK  + ATK+  LW+LP++LILHLKRF+   + R+K+   V  P+  LDL+  V++ + +           IYDL+AVS H G L GGHYTA   N  +  W+ F+DS  +     ++  ++   Y+LVY  + +
Sbjct:  775 RRKVLLQETLDWFTTKEQLGEQDSWYCPQCKKHERATKQLALWKLPEILILHLKRFQYTKWSREKLTWEVVIPVRGLDLTDKVANPNHEK---------AIYDLIAVSRHYGSLSGGHYTAIGYNDREQKWFDFNDSSANPTYPPAEPYESSDPYILVYRRRKL 929          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: F07A11.4 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:I2HA92])

HSP 1 Score: 186.808 bits (473), Expect = 3.284e-48
Identity = 102/250 (40.80%), Postives = 145/250 (58.00%), Query Frame = 2
Query:  785 QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSE--TVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVY 1528
            QG  GL N+GNTCFMN+ +Q + N   L  YF++  ++ ++N TNPLG  GRLA+ +   + QMW        P   K  VA+ A QF+ +AQHD+ E + FLLDGLHED+NR++KKP   + +S  +     + EAWK H +RNDS+ V+ FHG LKS V CP+C  VS+TFD F  L +P    + Q  ++ F+  + +    K+ VS S   TV DFL  + E    V    L A E   ++  ++Y
Sbjct:  420 QGYTGLRNIGNTCFMNAVLQMLVNNIELREYFLRNHYQPEINETNPLGSEGRLAKAFADFMHQMWSGHQKAIEPTQIKNIVAEKASQFANFAQHDAHEFLSFLLDGLHEDVNRVKKKPLTGTVESHGRHDLDVSNEAWKNHILRNDSIFVDLFHGQLKSHVQCPNCDRVSITFDPFVYLPVPFP-KNKQSTDLIFWPLENQTKPYKLTVSYSTEGTVADFLSVVSETV-RVPTRNLRACEAICHKFDKIY 667          

HSP 2 Score: 95.9005 bits (237), Expect = 8.411e-20
Identity = 61/172 (35.47%), Postives = 88/172 (51.16%), Query Frame = 2
Query: 2051 FIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRF-------RSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTA------FANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY------VSKSVLQQ 2509
            F  TE+L   + WYC  CK+   ATKK  L++LP VLI+ LKRF       +S   RR K    VE+PL  LD+S F+      AE     N   +YDL  V  H G    GHY +      F ++     W  FDDS  ++ ++ ++QT+ AY+L Y      V++S+ ++
Sbjct:  917 FSETERLKPEESWYCSTCKENVEATKKLQLYRLPPVLIIQLKRFVYTAFTYQSSMARRSKDTRSVEYPLESLDMSPFL------AETSPHPNST-MYDLTGVVCHSGNSYFGHYISMGRLADFDSSKTKIEWRNFDDSTVARQSTSTLQTEDAYLLFYKMRDQNVTRSIFKR 1081          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: F07A11.4 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:I2HA92])

HSP 1 Score: 186.037 bits (471), Expect = 3.641e-48
Identity = 102/250 (40.80%), Postives = 145/250 (58.00%), Query Frame = 2
Query:  785 QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSE--TVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVY 1528
            QG  GL N+GNTCFMN+ +Q + N   L  YF++  ++ ++N TNPLG  GRLA+ +   + QMW        P   K  VA+ A QF+ +AQHD+ E + FLLDGLHED+NR++KKP   + +S  +     + EAWK H +RNDS+ V+ FHG LKS V CP+C  VS+TFD F  L +P    + Q  ++ F+  + +    K+ VS S   TV DFL  + E    V    L A E   ++  ++Y
Sbjct:  233 QGYTGLRNIGNTCFMNAVLQMLVNNIELREYFLRNHYQPEINETNPLGSEGRLAKAFADFMHQMWSGHQKAIEPTQIKNIVAEKASQFANFAQHDAHEFLSFLLDGLHEDVNRVKKKPLTGTVESHGRHDLDVSNEAWKNHILRNDSIFVDLFHGQLKSHVQCPNCDRVSITFDPFVYLPVPFP-KNKQSTDLIFWPLENQTKPYKLTVSYSTEGTVADFLSVVSETV-RVPTRNLRACEAICHKFDKIY 480          

HSP 2 Score: 95.1301 bits (235), Expect = 1.087e-19
Identity = 59/158 (37.34%), Postives = 81/158 (51.27%), Query Frame = 2
Query: 2051 FIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRF-------RSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTA------FANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            F  TE+L   + WYC  CK+   ATKK  L++LP VLI+ LKRF       +S   RR K    VE+PL  LD+S F+      AE     N   +YDL  V  H G    GHY +      F ++     W  FDDS  ++ ++ ++QT+ AY+L Y
Sbjct:  770 FSETERLKPEESWYCSTCKENVEATKKLQLYRLPPVLIIQLKRFVYTAFTYQSSMARRSKDTRSVEYPLESLDMSPFL------AETSPHPNST-MYDLTGVVCHSGNSYFGHYISMGRLADFDSSKTKIEWRNFDDSTVARQSTSTLQTEDAYLLFY 920          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: cyk-3 (Ubiquitin carboxyl-terminal hydrolase cyk-3 [Source:UniProtKB/Swiss-Prot;Acc:Q8WT44])

HSP 1 Score: 172.555 bits (436), Expect = 1.035e-43
Identity = 168/664 (25.30%), Postives = 277/664 (41.72%), Query Frame = 2
Query:  731 SVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAE---RYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKK--PYLESSDSDDQ----------------PVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLT--AIEIQANRLSRVYFPQDSANILKD---------VENLMVYELPSSDNKDEW---IHLTMRTVDDQY------------FGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSE--HNDC-------------IDP------KVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKA----LQTHIRYELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFR--SGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSV 2500
            + + L S      S GR  G  GL N GN C+ N+ IQC++ V PLT YF+  +    +   N     G  AE    Y +LL +MW        P DF   +   +  F    QHD QE + FLLD LH  +    K   P  E S+  D                   ++KAE +W  ++ +N+S++ + F G L+S ++C  C+  S  F+ F SLSLP+      L+ +     D +I +        ++    L ++  +   ++ S+LT   +  +   +SR   P   ++ L+D            L   ELP S  +D+W   +H  ++   + Y            FG P++V + +E       ++ ++Q   F+   + + S   H+ C             +DP      +   + + +  P+          SK+  I    PI      +  ++RY          +E+  + D  + E   + +    P  +E+C+ +F   E L  +    C  C+ +    K   +W+LPK LI+HLKRF       R  K    V FPL   D + FV     D  D N       Y+ +A++NH G L  GH+ A+A +  D  W L +D    +++ + V  + AY+L Y  K V
Sbjct:  550 AASTLSSNAQLSDSSGR-PGAVGLVNYGNFCYRNAGIQCLARVSPLTQYFLDEDNLDAIKRGNL--RRGDAAETTIEYAKLLREMWAAKKKNIAPNDFNDAIRLSSDMFECSEQHDCQEFVAFLLDQLHTSMYESNKSLHPSPEESEGTDSNKLSDSSKKKEADKEEADEEKAERSWTEYEKQNESLVTQLFTGQLRSRLICRTCQSSSSVFEPFTSLSLPIGFEDVDLYQVIVVHRDGRIPRRYGFRLSRDSKVGNLREVVAVSSGISMSHLTIQCMSSKGTLMSRS--PNHRSSNLRDELPLSSFPSGARLYALELPESTGEDQWRVAMHRKLQYNHEPYILGSTAGFIVSRFGLPLIVGLDEEVTGKKLYEDVMYQMHRFMEHSVNSSSSRAHDPCEDENSGYPFTLCLVDPNYEWCGQCPALRFCRGCPI------RPDESKV-FIPANCPIAVDWLPIALYLRY-------NHSQEQACEDDPSVAE---TWSRHFAPSSLEHCIEKFSCPETL--DAAIQCDRCEKKTMRDKVMTIWKLPKYLIIHLKRFEFLREQGRMGKCKRTVNFPLKHFDPAPFV-----DKPDGN------TYECIALANHYGQLSCGHFIAYAKSNED-KWLLLNDCSVREVSEEEVDKQGAYLLFYERKDV 1177          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp15-31 (gene:FBgn0050421 transcript:FBtr0072369)

HSP 1 Score: 195.667 bits (496), Expect = 7.041e-51
Identity = 168/678 (24.78%), Postives = 274/678 (40.41%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPL-----GMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLV-LTHPQLF-NIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPS----------SDNKDEW------------------------IHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVKIYLKDKSTSK-LHLIDLESPI--------------KALQTHIRYELILDWSKEGK---EKFYDPDFEIPESHPSMNMQ-HRPLD-----IENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFR---SGSYRRDKIDTFVEFPLTDLDLSKFVS----------------------------------DAHRDAEDHNFQNGDEIYDLVAVSNHMG-GLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQ----TKTAYVLVYVSKSV 2500
            GV GL N GNTCFMN+ +QC+S+   L  YF+  ++K DL   N +     G  G L E+   +L+ +W           FK  V ++  QF    QHD+QE + +LLD +HEDLN   K+ Y    +S  +  +  A E    H   N+S +   F    +S++ CP C+  S TFD F  +S+ L  LT   +F  + + +   + ++  + V     +    +++ +    +  S +  +++ A   +RV++       L  +E +   E+P+          S+  D+                         ++      D   FG P  +   + +  +  L+ R+ + +  L             + P+V       ++ + +I L+D S     +L  +E P+              +A   HI+  L+L+WS        K  D +  + E      +   +P D     +E C+  + + E L   D W C  C+      K   LW LP +L++H KRFR   S   +  K+ T V+FPLT  D+S  ++                                  D+     +      D  YDL AV  H G  L  GHYTA   N  D  WY FDD   SK+  D ++       AY+L Y  +SV
Sbjct:  263 GVMGLKNHGNTCFMNAVLQCLSHTDILAEYFVLDQYKADLKRRNKINSRKFGTKGELTEQLANVLKALWTCKNESDHSTSFKAVVDRYGTQFRSSTQHDAQEFLFWLLDKVHEDLNTASKRRYKSLKNSYGRSDEVIAAETLANHIRCNNSFVQAVFQAQFRSSLTCPRCEKQSNTFDPFHCISVQLPQLTQQTIFVTVVYMTRLPRQVRMGLRVPAGSPIVALREQL-QADTGIEGSRMVLVDLNAEGFTRVFYDTQPVETLSSIETIYCIEVPAATPVAKAATPSETGDKSAPTAVTPSPAAAQSQADLLLLVANVYRAKDGADITRFGAPFSMKAPR-DCSYQDLQKRMLREMAPL-------------LKPEVFSYA-TPLAEMFRIRLQDPSADPDTYLEQVEHPLLTEMIDMALSVLSSEAGPQHIK--LLLEWSSPEAHFISKQQDTEEAVVEHESVARLSASKPSDTAALTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFRQHQSKGPQAAKLTTMVKFPLTAFDMSPHLARGVHESASSSLGMGTGIGLGLGLGSNPWKKARSVDSRSSTLNSRCDAKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQWYKFDDQRVSKVPEDDIEQDIINNEAYMLFYQRRSV 922          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp15-31 (gene:FBgn0050421 transcript:FBtr0343495)

HSP 1 Score: 195.667 bits (496), Expect = 7.514e-51
Identity = 168/678 (24.78%), Postives = 274/678 (40.41%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPL-----GMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLV-LTHPQLF-NIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPS----------SDNKDEW------------------------IHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVKIYLKDKSTSK-LHLIDLESPI--------------KALQTHIRYELILDWSKEGK---EKFYDPDFEIPESHPSMNMQ-HRPLD-----IENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFR---SGSYRRDKIDTFVEFPLTDLDLSKFVS----------------------------------DAHRDAEDHNFQNGDEIYDLVAVSNHMG-GLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQ----TKTAYVLVYVSKSV 2500
            GV GL N GNTCFMN+ +QC+S+   L  YF+  ++K DL   N +     G  G L E+   +L+ +W           FK  V ++  QF    QHD+QE + +LLD +HEDLN   K+ Y    +S  +  +  A E    H   N+S +   F    +S++ CP C+  S TFD F  +S+ L  LT   +F  + + +   + ++  + V     +    +++ +    +  S +  +++ A   +RV++       L  +E +   E+P+          S+  D+                         ++      D   FG P  +   + +  +  L+ R+ + +  L             + P+V       ++ + +I L+D S     +L  +E P+              +A   HI+  L+L+WS        K  D +  + E      +   +P D     +E C+  + + E L   D W C  C+      K   LW LP +L++H KRFR   S   +  K+ T V+FPLT  D+S  ++                                  D+     +      D  YDL AV  H G  L  GHYTA   N  D  WY FDD   SK+  D ++       AY+L Y  +SV
Sbjct:  235 GVMGLKNHGNTCFMNAVLQCLSHTDILAEYFVLDQYKADLKRRNKINSRKFGTKGELTEQLANVLKALWTCKNESDHSTSFKAVVDRYGTQFRSSTQHDAQEFLFWLLDKVHEDLNTASKRRYKSLKNSYGRSDEVIAAETLANHIRCNNSFVQAVFQAQFRSSLTCPRCEKQSNTFDPFHCISVQLPQLTQQTIFVTVVYMTRLPRQVRMGLRVPAGSPIVALREQL-QADTGIEGSRMVLVDLNAEGFTRVFYDTQPVETLSSIETIYCIEVPAATPVAKAATPSETGDKSAPTAVTPSPAAAQSQADLLLLVANVYRAKDGADITRFGAPFSMKAPR-DCSYQDLQKRMLREMAPL-------------LKPEVFSYA-TPLAEMFRIRLQDPSADPDTYLEQVEHPLLTEMIDMALSVLSSEAGPQHIK--LLLEWSSPEAHFISKQQDTEEAVVEHESVARLSASKPSDTAALTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFRQHQSKGPQAAKLTTMVKFPLTAFDMSPHLARGVHESASSSLGMGTGIGLGLGLGSNPWKKARSVDSRSSTLNSRCDAKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQWYKFDDQRVSKVPEDDIEQDIINNEAYMLFYQRRSV 894          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp15-31 (gene:FBgn0050421 transcript:FBtr0343494)

HSP 1 Score: 195.667 bits (496), Expect = 7.514e-51
Identity = 168/678 (24.78%), Postives = 274/678 (40.41%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPL-----GMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLV-LTHPQLF-NIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPS----------SDNKDEW------------------------IHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVKIYLKDKSTSK-LHLIDLESPI--------------KALQTHIRYELILDWSKEGK---EKFYDPDFEIPESHPSMNMQ-HRPLD-----IENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFR---SGSYRRDKIDTFVEFPLTDLDLSKFVS----------------------------------DAHRDAEDHNFQNGDEIYDLVAVSNHMG-GLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQ----TKTAYVLVYVSKSV 2500
            GV GL N GNTCFMN+ +QC+S+   L  YF+  ++K DL   N +     G  G L E+   +L+ +W           FK  V ++  QF    QHD+QE + +LLD +HEDLN   K+ Y    +S  +  +  A E    H   N+S +   F    +S++ CP C+  S TFD F  +S+ L  LT   +F  + + +   + ++  + V     +    +++ +    +  S +  +++ A   +RV++       L  +E +   E+P+          S+  D+                         ++      D   FG P  +   + +  +  L+ R+ + +  L             + P+V       ++ + +I L+D S     +L  +E P+              +A   HI+  L+L+WS        K  D +  + E      +   +P D     +E C+  + + E L   D W C  C+      K   LW LP +L++H KRFR   S   +  K+ T V+FPLT  D+S  ++                                  D+     +      D  YDL AV  H G  L  GHYTA   N  D  WY FDD   SK+  D ++       AY+L Y  +SV
Sbjct:  235 GVMGLKNHGNTCFMNAVLQCLSHTDILAEYFVLDQYKADLKRRNKINSRKFGTKGELTEQLANVLKALWTCKNESDHSTSFKAVVDRYGTQFRSSTQHDAQEFLFWLLDKVHEDLNTASKRRYKSLKNSYGRSDEVIAAETLANHIRCNNSFVQAVFQAQFRSSLTCPRCEKQSNTFDPFHCISVQLPQLTQQTIFVTVVYMTRLPRQVRMGLRVPAGSPIVALREQL-QADTGIEGSRMVLVDLNAEGFTRVFYDTQPVETLSSIETIYCIEVPAATPVAKAATPSETGDKSAPTAVTPSPAAAQSQADLLLLVANVYRAKDGADITRFGAPFSMKAPR-DCSYQDLQKRMLREMAPL-------------LKPEVFSYA-TPLAEMFRIRLQDPSADPDTYLEQVEHPLLTEMIDMALSVLSSEAGPQHIK--LLLEWSSPEAHFISKQQDTEEAVVEHESVARLSASKPSDTAALTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFRQHQSKGPQAAKLTTMVKFPLTAFDMSPHLARGVHESASSSLGMGTGIGLGLGLGSNPWKKARSVDSRSSTLNSRCDAKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQWYKFDDQRVSKVPEDDIEQDIINNEAYMLFYQRRSV 894          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp32 (gene:FBgn0036913 transcript:FBtr0332150)

HSP 1 Score: 187.578 bits (475), Expect = 3.533e-48
Identity = 106/292 (36.30%), Postives = 163/292 (55.82%), Query Frame = 2
Query:  494 VTKFSRCKTLNDIYQYAMNKFAV-TKPLRI--LQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQW-------MNGKSKQRSVTKLISGGNSRQSDGRVQ--GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
               FSR  T+  + ++   +  + ++ +R+  + ++DNGA  ++  +  + + +  + + + + ++ ++ D  W          +  Q + T       +R S   V   G  GL NLGNTCFMN+A+Q + N  PL  YF +   + ++N  N LG  G+LA RY +LL+++W        P   +  V K+APQF+G  QHDSQEL+ +LLD LHEDLNR+ +KPY E  DS+ +P +  A EAW  H  RN S+I++ F+G LKS V C  C + SV FD F  LSLPL
Sbjct:  567 TAAFSRLATVRQVGEFLCEQLRLKSEDIRLWHVPQLDNGA--ILLEEDAMCLKELLIRDNDQLLLEIRNKDLTWPEELGSLATAQCGQGAGTPGDRRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKLGTKGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPL 856          

HSP 2 Score: 69.3218 bits (168), Expect = 1.495e-11
Identity = 35/90 (38.89%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 2000 SMNMQHRPLDIENCVNEFIRTEKLGINDLWY-CKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVS 2266
            S   Q  P+D+ +C+  F   EKL   + WY C  CK +K ATKK  +W+LP +LI+HLKRF   + +  K    V FP  D D + +++
Sbjct: 1394 SRREQVEPVDLNHCLRAFTSEEKL---EQWYHCSHCKGKKPATKKLQIWKLPPILIVHLKRFNCVNGKWVKSQKVVHFPFDDFDPTPYLA 1480          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp32 (gene:FBgn0036913 transcript:FBtr0332148)

HSP 1 Score: 187.578 bits (475), Expect = 3.793e-48
Identity = 105/294 (35.71%), Postives = 160/294 (54.42%), Query Frame = 2
Query:  494 VTKFSRCKTLNDIYQYAMNKFAV-TKPLRI--LQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGR-----------VQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
               FSR  T+  + ++   +  + ++ +R+  + ++DNGA  ++  +  + + +  + + + + ++ ++ D  W   +      T     G     D R             G  GL NLGNTCFMN+A+Q + N  PL  YF +   + ++N  N LG  G+LA RY +LL+++W        P   +  V K+APQF+G  QHDSQEL+ +LLD LHEDLNR+ +KPY E  DS+ +P +  A EAW  H  RN S+I++ F+G LKS V C  C + SV FD F  LSLPL
Sbjct:  567 TAAFSRLATVRQVGEFLCEQLRLKSEDIRLWHVPQLDNGA--ILLEEDAMCLKELLIRDNDQLLLEIRNKDLTW--PEELGSLATAQCGQGAGTPGDRRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKLGTKGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPL 856          

HSP 2 Score: 69.3218 bits (168), Expect = 1.618e-11
Identity = 35/90 (38.89%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 2000 SMNMQHRPLDIENCVNEFIRTEKLGINDLWY-CKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVS 2266
            S   Q  P+D+ +C+  F   EKL   + WY C  CK +K ATKK  +W+LP +LI+HLKRF   + +  K    V FP  D D + +++
Sbjct: 1416 SRREQVEPVDLNHCLRAFTSEEKL---EQWYHCSHCKGKKPATKKLQIWKLPPILIVHLKRFNCVNGKWVKSQKVVHFPFDDFDPTPYLA 1502          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp11 (ubiquitin specific peptidase 11 [Source:ZFIN;Acc:ZDB-GENE-081104-421])

HSP 1 Score: 338.961 bits (868), Expect = 6.533e-105
Identity = 199/554 (35.92%), Postives = 313/554 (56.50%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIP-KIPNSRL---LNDNEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAV--TKPLRI-LQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSS----DNKDEWIHLTMR-------------TVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            Q+ L+  D W+L+DK W+ +W   ++T  +N+T  P KI N+ L   L+   +   +  N D+ L+P E W  ++  Y +  N    +R VV++ +T+ VEV P+++ + +       VT +FSR   ++ I+Q     F V  T   R+ ++ +D  +  +  L  N+++ D+ LS+G  + ++ +++D  W   + +      ++       S     GVCGL NLGNTCFMNSA+QC+SN PPLT YF+K  + ++LN +NPLGM G +AE Y  +++QMW       VPR FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++KK Y+E  D+D +P Q+ AEEAW+ H  RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  LS+PL ++  ++  + + S D   K  + +++V K+  V D    + +    V  + +T  ++  +R  R+Y   +S + + D +++ VY+L S     D+ +  + + MR             +     FG P+ +SV +       L   + +RL
Sbjct:   42 QQQLRAGDSWYLLDKRWYDQWKEYVDTGDQNSTSYPGKIDNTELYEDLDSYRLKERLTENDDFILVPAEAWRKLLSWYDMMDNQPPLERKVVDLPSTVKVEVYPVEIYLCLSSNLESTVTAQFSRADKIHAIHQKIRQHFDVSETAESRLWMRSVDTSSERLRNL--NMTVLDSCLSSGMTVIMEIRNADGTWPTSRPQ------IMRNSADEDSYRGPPGVCGLTNLGNTCFMNSALQCLSNTPPLTEYFLKNLYLEELNFSNPLGMKGEIAEAYADVIKQMWSGRHYSVVPRVFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYIELRDADGRPDQEVAEEAWRNHLRRNDSVIVDTFHGLFKSTLVCPECNKVSVTFDPFCYLSVPLPVSKERVMEVFYVSLDPTAKPTQYRLIVPKAGRVLDLCTALSQA-TGVPPNQMTVTDVFNHRFYRIYQSDESLSCILDRDDIFVYQLSSGCVDEDSDEVVLSIYMRERSHYRDYGSGSNSYGTSLFGHPLRMSVPRAHCTPEHLYQLLLERL 586          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp11 (ubiquitin specific peptidase 11 [Source:ZFIN;Acc:ZDB-GENE-081104-421])

HSP 1 Score: 340.117 bits (871), Expect = 2.028e-101
Identity = 196/554 (35.38%), Postives = 312/554 (56.32%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIP-KIPNSRL---LNDNEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGK-ENKAVTKFSRCKTLNDIYQYAMNKFAVTKPLRI---LQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSS----DNKDEWIHLTMR-------------TVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            Q+ L+  D W+L+DK W+ +W   ++T  +N+T  P KI N+ L   L+   +   +  N D+ L+P E W  ++  Y +  N    +R VV++ +T+ VEV P+++ + +    E+    +FSR   ++ I+Q     F V++       ++ +D  +  +  L  N+++ D+ LS+G  + ++ +++D  W   + +      ++       S     GVCGL NLGNTCFMNSA+QC+SN PPLT YF+K  + ++LN +NPLGM G +AE Y  +++QMW       VPR FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++KK Y+E  D+D +P Q+ AEEAW+ H  RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  LS+PL ++  ++  + + S D   K  + +++V K+  V D    + +    V  + +T  ++  +R  R+Y   +S + + D +++ VY+L S     D+ +  + + MR             +     FG P+ +SV +       L   + +RL
Sbjct:   28 QQQLRAGDSWYLLDKRWYDQWKEYVDTGDQNSTSYPGKIDNTELYEDLDSYRLKERLTENDDFILVPAEAWRKLLSWYDMMDNQPPLERKVVDLPSTVKVEVYPVEIYLCLSSNLESTVTAQFSRADKIHAIHQKIRQHFDVSETAESRLWMRSVDTSSERLRNL--NMTVLDSCLSSGMTVIMEIRNADGTWPTSRPQ------IMRNSADEDSYRGPPGVCGLTNLGNTCFMNSALQCLSNTPPLTEYFLKNLYLEELNFSNPLGMKGEIAEAYADVIKQMWSGRHYSVVPRVFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYIELRDADGRPDQEVAEEAWRNHLRRNDSVIVDTFHGLFKSTLVCPECNKVSVTFDPFCYLSVPLPVSKERVMEVFYVSLDPTAKPTQYRLIVPKAGRVLDLCTALSQAT-GVPPNQMTVTDVFNHRFYRIYQSDESLSCILDRDDIFVYQLSSGCVDEDSDEVVLSIYMRERSHYRDYGSGSNSYGTSLFGHPLRMSVPRAHCTPEHLYQLLLERL 572          

HSP 2 Score: 152.14 bits (383), Expect = 3.358e-37
Identity = 79/198 (39.90%), Postives = 115/198 (58.08%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR--PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQ 2509
            + +DW  + K+K+Y+  + E    H SM++ H+   + ++ C+  F   E L   + WYC  CK  + ATKK DLW LP+VLI+HLKRF    Y R+K+DT VEFPL DLD S F+     ++ +         YDL++VSNH GGL  GHYT++A N  +  WY FDDS  +    + + T  AY+L Y  +  ++Q
Sbjct:  761 IAIDWDPDMKKKYYNENEAEKYIKHQSMDVPHQQTTVQLQECIELFTTVETLEEENPWYCPTCKRHQLATKKLDLWSLPEVLIIHLKRFSYTKYSREKLDTIVEFPLRDLDFSGFLLKKTVNSTEPPCP-----YDLISVSNHYGGLRDGHYTSYARNKDNGQWYYFDDSKVTYAREEQIVTSAAYLLFYQRQDKIRQ 953          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:ZFIN;Acc:ZDB-GENE-041008-187])

HSP 1 Score: 321.627 bits (823), Expect = 1.300e-94
Identity = 201/603 (33.33%), Postives = 310/603 (51.41%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKL---------------------ISGGNSRQSDGRV----------------------------QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            L+  D+W+LID  W  +W +          ++   N    P I NS L +D +  S    +I   DY L+P E WN +V  YG   N +   R VVE H   +    VEV  ++L +      +K VT+ FS+  T++ I +   + F +   K  R+  K M N    + KLD  +   DAGL  G+ + I+ ++ D  W       +S T                       I+ G+S  + G +                             G+CGL NLGNTCFMNSA+QC+SN PPLT YF++  ++ ++N  NPLGM G +AE Y  L++QMW+   +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYL   D++ +P +  A+EAW  H++RNDS+IV+ FHGL KST+VCP+C  VSVTFD F  L+LPL +   +   +    +D   + ++ +++V K   V D    + +L   V    +   ++  +R  ++Y   D  N + + +++ VYE+   D++   + +  R    ++         FG P++++V +  +   +L  R+ +R+
Sbjct:   44 LRKGDEWYLIDSRWFKQWKKYVGFDSWDLYNVGEHNLYPGP-IDNSGLFSDRKSQSLKEHLIDELDYVLVPTEAWNKLVSWYGSLGNQKPIIRKVVE-HGMFVKHCKVEVYLLELNLCENDNMDKVVTRHFSKADTIDTIEKEMRSLFDIPSEKETRLWNKYMSNTYEQLNKLDSTVQ--DAGLFQGQVLVIEKKNEDGTWPRQSCHSKSSTSTSRNYTTSPKPSSNSSATISSTITNGDSNSNSGYMLNNSTSGNRLGSYNSYSSSYSYRESAAQPGLCGLSNLGNTCFMNSALQCLSNTPPLTEYFLEDRYEAEINRENPLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLALRDAEGRPDEIVAKEAWANHRLRNDSIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKKDRTMEVYLVRTDPQFRAMQFRVVVPKMGAVADLCSALAKL-SGVPSENMVVADVYNHRFHKIYKRDDGLNQIMEKDDIFVYEVLEEDSERMNLPVYFRERHAKHSGGSSGTMLFGQPLLITVPRLNLTVDTLYERVLERI 641          

HSP 2 Score: 154.451 bits (389), Expect = 6.518e-38
Identity = 96/246 (39.02%), Postives = 130/246 (52.85%), Query Frame = 2
Query: 1853 STSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYD-PDFEIPESHPSM---NMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLSQDLN-----EDSAMDTD 2563
             T+ +  +  +  +  L TH    + +DW  + K   YD  + E  + H SM     +   + +  C+  F   E LG +D WYC  CK  + ATKKFDLW LP++L++HLKRF      RDK+DT V+FP+ DL++S+FV D   D           IYDL+AVSNH GG+GGGHYTA+  N  D  WY FDDS  S    D + TK AYVL Y  +     ++   S  L       D  MDT+
Sbjct:  775 GTANISSLPFDGNLLKLTTH--STVAIDWDSDTKRLCYDDQEAEAYDKHESMLHAQKKKTTVALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTVVDFPIRDLNMSEFVCDPKADP---------YIYDLIAVSNHYGGMGGGHYTAYGKNKADGKWYYFDDSSVSAATEDQIVTKAAYVLFYQRRDADTPSKSPPSASLGGAPETPDDHMDTN 1009          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp32 (ubiquitin specific peptidase 32 [Source:ZFIN;Acc:ZDB-GENE-100210-5])

HSP 1 Score: 217.238 bits (552), Expect = 1.261e-57
Identity = 129/368 (35.05%), Postives = 199/368 (54.08%), Query Frame = 2
Query:  503 FSRCKTLNDIYQYAMNKFAVTKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVL---THPQLFNIKFYSSDKKILKAKI-LVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVEN-LMVYELP 1591
            FSR  T+ DI++Y   +  + +    L   ++  +  +  D + ++    + + +H+ I+ ++ D  W    S   + +K+      R      +G  GL NLGNTCFMNS+IQC+SN  PLT YFI      +LN TNP+GM G +A+ Y  L++++W        P   +  +AK+AP+F+G+ Q DSQEL+ FLLDGLHEDLNR+ +KPY+E  DSD +P  + A EAW+ H  RN S++V+ FHG L+S V C  C ++S  FD F  LSLPL +    H ++  IK   S       ++ +  K   +K  L ++  L PE     +   E+  + +    FP D+  +   V   L  +E+P
Sbjct:  642 FSRMCTIKDIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHTLESLKIPDEQHLVIEVRNKDMSWPEEMSFIANSSKI-----DRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTKPLTEYFISGRHLYELNRTNPIGMRGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDHEVATEAWENHLRRNRSIVVDLFHGQLRSQVKCKTCGHISARFDPFNFLSLPLPMDSSMHLEITVIKLDGSTPVRYGLRLNMDEKYMGLKKQLSELCSLKPE----QILLAEVHTSNIKN--FPLDNQKVRHSVNGFLCAFEIP 998          

HSP 2 Score: 86.6557 bits (213), Expect = 1.002e-16
Identity = 46/119 (38.66%), Postives = 66/119 (55.46%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYDPDFE-IPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVS 2266
            + +DW        Y    E I E HPS+    R    P+ +++C+  F   E+LG ++L+YC  CK  + ATKK DLW+LP VLI+HLKRF+  + R  K    V+FP    D S F++
Sbjct: 1190 IAVDWDPTALHLRYQTSQERIVEEHPSVEQSRRAQAEPISLDSCLKAFTSEEELGEDELYYCSKCKTHRLATKKLDLWRLPPVLIVHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLA 1308          

HSP 3 Score: 59.3066 bits (142), Expect = 2.363e-8
Identity = 25/64 (39.06%), Postives = 40/64 (62.50%), Query Frame = 2
Query: 2309 DEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSV 2500
            + +Y+L A+S H G +GGGHY  +A N  +  WY ++DS   ++ SD + T +AY+L Y  + V
Sbjct: 1488 ESLYNLYAISCHSGIMGGGHYVTYAKN-PNEKWYCYNDSSCKEVHSDEIDTDSAYILFYEQQGV 1550          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp32 (ubiquitin specific peptidase 32 [Source:ZFIN;Acc:ZDB-GENE-100210-5])

HSP 1 Score: 217.238 bits (552), Expect = 1.277e-57
Identity = 129/368 (35.05%), Postives = 199/368 (54.08%), Query Frame = 2
Query:  503 FSRCKTLNDIYQYAMNKFAVTKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVL---THPQLFNIKFYSSDKKILKAKI-LVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVEN-LMVYELP 1591
            FSR  T+ DI++Y   +  + +    L   ++  +  +  D + ++    + + +H+ I+ ++ D  W    S   + +K+      R      +G  GL NLGNTCFMNS+IQC+SN  PLT YFI      +LN TNP+GM G +A+ Y  L++++W        P   +  +AK+AP+F+G+ Q DSQEL+ FLLDGLHEDLNR+ +KPY+E  DSD +P  + A EAW+ H  RN S++V+ FHG L+S V C  C ++S  FD F  LSLPL +    H ++  IK   S       ++ +  K   +K  L ++  L PE     +   E+  + +    FP D+  +   V   L  +E+P
Sbjct:  634 FSRMCTIKDIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHTLESLKIPDEQHLVIEVRNKDMSWPEEMSFIANSSKI-----DRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTKPLTEYFISGRHLYELNRTNPIGMRGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDHEVATEAWENHLRRNRSIVVDLFHGQLRSQVKCKTCGHISARFDPFNFLSLPLPMDSSMHLEITVIKLDGSTPVRYGLRLNMDEKYMGLKKQLSELCSLKPE----QILLAEVHTSNIKN--FPLDNQKVRHSVNGFLCAFEIP 990          

HSP 2 Score: 86.6557 bits (213), Expect = 1.086e-16
Identity = 46/119 (38.66%), Postives = 66/119 (55.46%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYDPDFE-IPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVS 2266
            + +DW        Y    E I E HPS+    R    P+ +++C+  F   E+LG ++L+YC  CK  + ATKK DLW+LP VLI+HLKRF+  + R  K    V+FP    D S F++
Sbjct: 1182 IAVDWDPTALHLRYQTSQERIVEEHPSVEQSRRAQAEPISLDSCLKAFTSEEELGEDELYYCSKCKTHRLATKKLDLWRLPPVLIVHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLA 1300          

HSP 3 Score: 59.3066 bits (142), Expect = 2.377e-8
Identity = 25/64 (39.06%), Postives = 40/64 (62.50%), Query Frame = 2
Query: 2309 DEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSV 2500
            + +Y+L A+S H G +GGGHY  +A N  +  WY ++DS   ++ SD + T +AY+L Y  + V
Sbjct: 1464 ESLYNLYAISCHSGIMGGGHYVTYAKN-PNEKWYCYNDSSCKEVHSDEIDTDSAYILFYEQQGV 1526          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: fchsd2 (FCH and double SH3 domains 2 [Source:Xenbase;Acc:XB-GENE-5824265])

HSP 1 Score: 402.519 bits (1033), Expect = 8.340e-127
Identity = 277/809 (34.24%), Postives = 409/809 (50.56%), Query Frame = 2
Query:  308 IISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMH---NTLIVEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQW--------------MNGKS-------KQRSVTKLISGGNSR--------------QSDGR---VQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEW-----IHLTMRTVDDQY--------FGWPIMVSVCK---EEIDWYSLKNRIF-QRLPFLNQ------IIG--NKSEHNDCID------------PKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            +I   DY L+P E WN +V  Y +  + +   R VVE         VEV   +L +   G  N  VT+ FS+  T++ I +     F++   K  R+  K  +  F+ +      +I DAGL  G+ + I+ ++ + QW              M  K        KQ       S  NS                  GR     G+CGL NLGNTCFMNSAIQC+SN PPLT YF+  +++ +LN  NPLGM G +A+ Y +L++QMW    +Y  PR FK +V +FAPQFSGY Q D QEL+ FLLDGLHEDLNRI+KKPY++  D+D +P +  AEEAW+ H  RNDS+IV+ FHGL KST+VCP+C  +SVTFD F  L+LPL +   +   +     D   K ++ +++V K   + D    +  L   +A   +   +I  +R  R++   ++ + + + +++ V+E   +  +D       ++L  +     Y        FG P +++V +   E+  +  L  RI  Q LP  N+       +G  N SE+  C +             ++   ++  +      Y+KD +                  +IR++  +D++ + K+ F                    + +++C+  F   EKLG  D WYC  CK+ + ATKK DLW LP VL++HLKRF    Y RDK+DT V+FP++DLD+S F+ + +          G   Y+L+AVSNH GG+GGGHYTAFA N  D  WY FDDS  S  AS+     T Y L+Y
Sbjct:    4 LIDELDYILLPTEGWNKLVSWYSVVESQQPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDMIEKEMRTIFSIPDEKETRLWNKYMSNTFEPLN-KPESTIQDAGLYQGQMLVIEQKNQEGQWPRVICSFVCISSFLMFSKDLKLINIYKQNCFMFYFSMKNSNYCLPSYAAYKNYEYSEPGRHNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQDELNMDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHIKRNDSIIVDIFHGLFKSTLVCPECSKISVTFDPFCYLTLPLPMKKERALEVYLVRMDPLAKPMQVRLIVPKIGNIMDLCTALSSL-SGIAPEKMVVTDIYNHRFHRIFAMDENLSSIMERDDIYVFETSINRTEDTEQVIIPVYLREKFRHTSYSHHHGSTLFGQPFLITVPRNITEDKLYNLLLLRIQDQELPSENENSQSEDSVGGDNDSENGLCTEDTCKGQSVTGQKKRLFTFQFSNLGSSDITYIKDDT-----------------KYIRFDESVDFTPQ-KKAF--------------------MKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPISDLDMSTFLINPNA---------GPCCYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVS-TASEEQIVATVYFLIY 762          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: fchsd2 (FCH and double SH3 domains 2 [Source:Xenbase;Acc:XB-GENE-5824265])

HSP 1 Score: 316.62 bits (810), Expect = 5.423e-93
Identity = 188/503 (37.38%), Postives = 278/503 (55.27%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMH---NTLIVEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNG-----KSKQRSVTKLISGGNSRQSD-GR---VQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYE 1585
            L+  D W+LID  W  +W +           +  +N    P I NS LL D +  S    +I   DY L+P E WN +V  Y +  + +   R VVE         VEV   +L +   G  N  VT+ FS+  T++ I +     F++   K  R+  K  +  F+ +      +I DAGL  G+ + I+ ++ + QW  G     K+    +    +  N   S+ GR     G+CGL NLGNTCFMNSAIQC+SN PPLT YF+  +++ +LN  NPLGM G +A+ Y +L++QMW    +Y  PR FK +V +FAPQFSGY Q D QEL+ FLLDGLHEDLNRI+KKPY++  D+D +P +  AEEAW+ H  RNDS+IV+ FHGL KST+VCP+C  +SVTFD F  L+LPL +   +   +     D   K ++ K++V K   + D    +  L   +A   +   +I  +R  R++   ++ + + + +++ V+E
Sbjct:   24 LRRGDTWYLIDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGP-IDNSGLLKDTDTQSLKEHLIDELDYILLPTEGWNKLVSWYSVVESQQPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDMIEKEMRTIFSIPDEKETRLWNKYMSNTFEPLN-KPESTIQDAGLYQGQMLVIEQKNQEGQWPRGSMPNMKNSNYCLPSYAAYKNYEYSEPGRHNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQDELNMDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHIKRNDSIIVDIFHGLFKSTLVCPECSKISVTFDPFCYLTLPLPMKKERALEVYLVRMDPLAKPMQYKVIVPKIGNIMDLCTALSSL-SGIAPEKMVVTDIYNHRFHRIFAMDENLSSIMERDDIYVFE 523          

HSP 2 Score: 162.925 bits (411), Expect = 2.171e-40
Identity = 93/213 (43.66%), Postives = 124/213 (58.22%), Query Frame = 2
Query: 1895 KALQTHIRYELILDWSKEGKEKFYDP----DFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYL 2521
            + L+   R  L LDW  + K+KF+D     DFE  ES      +   + +++C+  F   EKLG  D WYC  CK+ + ATKK DLW LP VL++HLKRF    Y RDK+DT V+FP++DLD+S F+          N   G   Y+L+AVSNH GG+GGGHYTAFA N  D  WY FDDS  S  + + + +K AYVL Y  +  +  T + 
Sbjct:  710 RQLRLDERSYLALDWDPKLKKKFFDENAAEDFEKHESVDFTPQKKAFMKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPISDLDMSTFLI---------NPNAGPCCYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEEQIVSKAAYVLFYQRQDTITGTGFF 913          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: USP4 (ubiquitin specific peptidase 4 [Source:NCBI gene;Acc:100491110])

HSP 1 Score: 310.457 bits (794), Expect = 1.449e-90
Identity = 205/601 (34.11%), Postives = 303/601 (50.42%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSRSI-----ETKNATDIPKIP----NSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISI-YGKENKAVTKFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQW---------------------------------MNGKSKQRSVTKLISGGNSRQSDGRV-----------QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQY----------FGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            + +LK  D+W+LID  W  +W + +     +  N  +    P    NS L  D++   +   +I   DY L+P E W  +++ YG         R VVE H   +    VEV  I+L +      EN     FS+  T++ I +   N F ++  K  R+  + M N    + K +  +   DAGL  G+ I I+ +++D  W                                  NG S   S     S G ++ S G              G+CGL NLGNTCFMNSA+QC+SN PPLT YF+  E+KK++N  NPLGM G +A  Y +L+ Q+W    +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYLE  D++ +P    A EAW+ H  RN+S+IV+ FHGL KST+VCP+C  VSVTFD F  L+LPL +   +   + F  SD   K  + ++ V K   V D    + +L  EV    +   ++  +R  +++   +  + + + +++ VYE+      +EW+ L +   + +Y          FG PIM+SV K  +    L   + +R+
Sbjct:   47 KSALKKGDEWYLIDSRWFKQWKKYVGFDAWDMYNVGESSLYPGPVDNSGLFADHDTQVLKEHLIDELDYVLVPTEAWKKLMNWYGSVEGQHPIVRKVVE-HGLFVKNCKVEVYLIELKLCDDSDPENVIARHFSKADTIDTIEKEMRNIFNISADKETRLWNRYMTNTYEQLTKKESTVQ--DAGLYQGQMIVIEQRNADGTWPRQPQTKSSTATSRNFATSGKPSTSSYSTSSSMTNGDSSTYSQNN--SSGLNKGSAGDAISYSYREPSSQPGLCGLSNLGNTCFMNSALQCLSNTPPLTRYFVTDEYKKEINRENPLGMKGEIAVAYAELIRQIWSGEHSYVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDSVVAAEAWENHLRRNNSIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKKDRTMEVFFVRSDPHCKPKQYRVTVPKMGVVSDLCSALSKL-SEVPAENMVVTDVYNHRFHKIFQMDEMLSHIMERDDIFVYEV-KPRKAEEWVTLPICFRERRYRQATSTGTVLFGQPIMISVPKHNLTLDVLYEIVLERI 640          

HSP 2 Score: 165.622 bits (418), Expect = 2.671e-41
Identity = 91/191 (47.64%), Postives = 116/191 (60.73%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYD-PDFEIPESHPSMNMQHR---PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            + +DW  E K+ FYD  + E  + H SM    +    + +  C+  F +TE LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    + RDK+D  VEFP+ DL++S FV D          Q G  +YDLVAVSNH GG+GGGHYTA+A N     WY FDDS  S  + D + TK AYVL Y
Sbjct:  759 VAIDWDSESKKLFYDDQEAEAFDKHESMTQPQKKKVTVALRECIQLFTKTETLGEHDPWYCPHCKKHQRATKKFDLWSLPKILVVHLKRFSYNRFWRDKLDAVVEFPIRDLNMSDFVCDP---------QAGPYVYDLVAVSNHYGGMGGGHYTAYAKNQDKGQWYYFDDSSVSPASEDQIVTKAAYVLFY 940          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: USP4 (ubiquitin specific peptidase 4 [Source:NCBI gene;Acc:100491110])

HSP 1 Score: 310.457 bits (794), Expect = 1.558e-90
Identity = 204/600 (34.00%), Postives = 304/600 (50.67%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSRSI-----ETKNATDIPKIP----NSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISI-YGKENKAVTKFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQW---------------------------------MNGKSK---QRSVTKLISGGNSRQSDGRVQ-------GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQY----------FGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            + +LK  D+W+LID  W  +W + +     +  N  +    P    NS L  D++   +   +I   DY L+P E W  +++ YG         R VVE H   +    VEV  I+L +      EN     FS+  T++ I +   N F ++  K  R+  + M N    + K +   ++ DAGL  G+ I I+ +++D  W                                  NG S    Q + + L  GG +               G+CGL NLGNTCFMNSA+QC+SN PPLT YF+  E+KK++N  NPLGM G +A  Y +L+ Q+W    +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYLE  D++ +P    A EAW+ H  RN+S+IV+ FHGL KST+VCP+C  VSVTFD F  L+LPL +   +   + F  SD   K  + ++ V K   V D    + +L  EV    +   ++  +R  +++   +  + + + +++ VYE+      +EW+ L +   + +Y          FG PIM+SV K  +    L   + +R+
Sbjct:   47 KSALKKGDEWYLIDSRWFKQWKKYVGFDAWDMYNVGESSLYPGPVDNSGLFADHDTQVLKEHLIDELDYVLVPTEAWKKLMNWYGSVEGQHPIVRKVVE-HGLFVKNCKVEVYLIELKLCDDSDPENVIARHFSKADTIDTIEKEMRNIFNISADKETRLWNRYMTNTYEQLTKKES--TVQDAGLYQGQMIVIEQRNADGTWPRQPQTKSSTATSRNFATSGKPSTSSYSTSSSMTNGDSSTYSQNNSSGLNKGGYTSSYSSYSYREPSSQPGLCGLSNLGNTCFMNSALQCLSNTPPLTRYFVTDEYKKEINRENPLGMKGEIAVAYAELIRQIWSGEHSYVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDSVVAAEAWENHLRRNNSIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKKDRTMEVFFVRSDPHCKPKQYRVTVPKMGVVSDLCSALSKL-SEVPAENMVVTDVYNHRFHKIFQMDEMLSHIMERDDIFVYEV-KPRKAEEWVTLPICFRERRYRQATSTGTVLFGQPIMISVPKHNLTLDVLYEIVLERI 641          

HSP 2 Score: 165.622 bits (418), Expect = 3.052e-41
Identity = 91/191 (47.64%), Postives = 116/191 (60.73%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYD-PDFEIPESHPSMNMQHR---PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            + +DW  E K+ FYD  + E  + H SM    +    + +  C+  F +TE LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    + RDK+D  VEFP+ DL++S FV D          Q G  +YDLVAVSNH GG+GGGHYTA+A N     WY FDDS  S  + D + TK AYVL Y
Sbjct:  756 VAIDWDSESKKLFYDDQEAEAFDKHESMTQPQKKKVTVALRECIQLFTKTETLGEHDPWYCPHCKKHQRATKKFDLWSLPKILVVHLKRFSYNRFWRDKLDAVVEFPIRDLNMSDFVCDP---------QAGPYVYDLVAVSNHYGGMGGGHYTAYAKNQDKGQWYYFDDSSVSPASEDQIVTKAAYVLFY 937          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: fchsd2 (FCH and double SH3 domains 2 [Source:Xenbase;Acc:XB-GENE-5824265])

HSP 1 Score: 308.145 bits (788), Expect = 8.182e-90
Identity = 190/532 (35.71%), Postives = 279/532 (52.44%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMH---NTLIVEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNG---------------KSKQRSVTKLISGGNSR--------------------QSDGR---VQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYE 1585
            L+  D W+LID  W  +W +           +  +N    P I NS LL D +  S    +I   DY L+P E WN +V  Y +  + +   R VVE         VEV   +L +   G  N  VT+ FS+  T++ I +     F++   K  R+  K  +  F+ +      +I DAGL  G+ + I+ ++ + QW  G               K    S++   +  NSR                       GR     G+CGL NLGNTCFMNSAIQC+SN PPLT YF+  +++ +LN  NPLGM G +A+ Y +L++QMW    +Y  PR FK +V +FAPQFSGY Q D QEL+ FLLDGLHEDLNRI+KKPY++  D+D +P +  AEEAW+ H  RNDS+IV+ FHGL KST+VCP+C  +SVTFD F  L+LPL +   +   +     D   K ++ K++V K   + D    +  L   +A   +   +I  +R  R++   ++ + + + +++ V+E
Sbjct:   24 LRRGDTWYLIDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGP-IDNSGLLKDTDTQSLKEHLIDELDYILLPTEGWNKLVSWYSVVESQQPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDMIEKEMRTIFSIPDEKETRLWNKYMSNTFEPLN-KPESTIQDAGLYQGQMLVIEQKNQEGQWPRGSMPKSSGIPNFSTLPKISPSSLSNNYNNFNSRIMKNSNYCLPSYAAYKNYEYSEPGRHNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQDELNMDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHIKRNDSIIVDIFHGLFKSTLVCPECSKISVTFDPFCYLTLPLPMKKERALEVYLVRMDPLAKPMQYKVIVPKIGNIMDLCTALSSL-SGIAPEKMVVTDIYNHRFHRIFAMDENLSSIMERDDIYVFE 552          

HSP 2 Score: 135.576 bits (340), Expect = 7.245e-32
Identity = 89/213 (41.78%), Postives = 116/213 (54.46%), Query Frame = 2
Query: 1895 KALQTHIRYELILDWSKEGKEKFYDP----DFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYL 2521
            + L+   R  L LDW  + K+KF+D     DFE  ES      +   + +++C+  F   EKLG  D WYC  CK+ + ATKK DLW LP VL++HLKRF   SY    I    EF   DLD+S F+          N   G   Y+L+AVSNH GG+GGGHYTAFA N  D  WY FDDS  S  + + + +K AYVL Y  +  +  T + 
Sbjct:  739 RQLRLDERSYLALDWDPKLKKKFFDENAAEDFEKHESVDFTPQKKAFMKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRF---SY----IQNVAEF---DLDMSTFLI---------NPNAGPCCYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEEQIVSKAAYVLFYQRQDTITGTGFF 932          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:MGI Symbol;Acc:MGI:98905])

HSP 1 Score: 461.84 bits (1187), Expect = 7.990e-148
Identity = 294/861 (34.15%), Postives = 451/861 (52.38%), Query Frame = 2
Query:  164 SLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDG-RVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKI--LKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELP-SSDNKDEWIHLTMRTVDDQ-----------YFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDCIDPK--------------------VAKIE----------YDKISPVVKIYLKDKSTSKLHLID---------LESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  I   DAGL  G+ + I+ Q+ D  W   +S Q + +   +  N ++     +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ F+LDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D +   ++ ++ V     + D  + + +L   +A   +   ++  +R  +++   +  + +   +++ VYE+  +S +  E I L +   + +            +G P++VSV K ++   SL   +  R+      P  ++ + +  E   C   +                    ++++E          + + +  VK   + K      L++         L +  K L+ + R  L +DW  E +  ++D  + E  E H SM+   +     + +  C+  F   E LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV D  R A  +       +YDL+AVSNH G +G GHYTA+A N ++  WY FDDS  S  + D + TK AYVL Y
Sbjct:   27 TLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTIQ--DAGLYQGQVLVIEPQNEDGTWPR-QSLQSNGSGFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEPKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRIMEVFLVPADPQCRPIQYRVTVPLMGAISDLCEALSKL-SGIAAENMVVTDVYNHRFHKIFQMDEGLSHITPRDDIFVYEVCNTSMDGSECITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLESLYQAVCDRISRYIKQPLPDEFLSSPLEPGACNGSRSSYEGDEEEEMDHQEEGKEQLSEVEGSGEDDQGDDHSESAQKVKGQPRHKRLFTFSLVNSCGTADINSLATDGKLLKLNSRSTLAIDWDSETRSLYFDEQESEACEKHLSMSQPQKKKKAAVALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVRALNMSEFVCD--RSARPY-------VYDLIAVSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLFY 872          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:MGI Symbol;Acc:MGI:98905])

HSP 1 Score: 455.292 bits (1170), Expect = 6.962e-145
Identity = 299/907 (32.97%), Postives = 454/907 (50.06%), Query Frame = 2
Query:  164 SLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVT----------------------KLISGGNSRQSDG-------------------------RVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKI--LKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELP-SSDNKDEWIHLTMRTVDDQ-----------YFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDCIDPK--------------------VAKIE----------YDKISPVVKIYLKDKSTSKLHLID---------LESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  I   DAGL  G+ + I+ Q+ D  W     + +S T                       LI+ G+S  S G                          +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ F+LDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D +   ++ ++ V     + D  + + +L   +A   +   ++  +R  +++   +  + +   +++ VYE+  +S +  E I L +   + +            +G P++VSV K ++   SL   +  R+      P  ++ + +  E   C   +                    ++++E          + + +  VK   + K      L++         L +  K L+ + R  L +DW  E +  ++D  + E  E H SM+   +     + +  C+  F   E LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV D  R A  +       +YDL+AVSNH G +G GHYTA+A N ++  WY FDDS  S  + D + TK AYVL Y
Sbjct:   27 TLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTIQ--DAGLYQGQVLVIEPQNEDGTWPRQSLQSKSSTAPSRNFTTSSKPSASPYCSVSASLIANGDSTNSSGMHSSGVSRGGSGFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEPKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRIMEVFLVPADPQCRPIQYRVTVPLMGAISDLCEALSKL-SGIAAENMVVTDVYNHRFHKIFQMDEGLSHITPRDDIFVYEVCNTSMDGSECITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLESLYQAVCDRISRYIKQPLPDEFLSSPLEPGACNGSRSSYEGDEEEEMDHQEEGKEQLSEVEGSGEDDQGDDHSESAQKVKGQPRHKRLFTFSLVNSCGTADINSLATDGKLLKLNSRSTLAIDWDSETRSLYFDEQESEACEKHLSMSQPQKKKKAAVALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVRALNMSEFVCD--RSARPY-------VYDLIAVSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLFY 919          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp11 (ubiquitin specific peptidase 11 [Source:MGI Symbol;Acc:MGI:2384312])

HSP 1 Score: 327.791 bits (839), Expect = 2.051e-97
Identity = 195/558 (34.95%), Postives = 305/558 (54.66%), Query Frame = 2
Query:  152 AKQKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIPKIPNSRLLNDNEVS----SDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAV--TKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQG---VCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYEL-----PSSDNKDEW---IHLTMRTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
             +++ L+  + WFL++K W+ +W   ++   ++A+  P   N+  L ++++S      ++   DY L+P   WN++V  YG+       +R V+E+     VEV P++L +  +     A+T +FS   ++  + Q A  +F V   +  R+  K   G+ D +  +  I++ DA L  G+ + ++ ++ D  W + +        L    N    D   QG   +CGL NLGNTCFMNSA+QC+SNVP LT YF+   + ++LN  NPLGM G LAE Y  L++Q W       VP  FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++KK Y+E  +   +P  + A+EAW+ HK RNDSVIV+ FHGL KST+VCPDC  VSVTFD F  LS+PL +   ++  + F   D  +K  + +++V K   + D    +      VA   +   ++ ++R  ++Y  +D  + + D +++ VYE+     P   ++D+    ++L  RT    Y         FG P++VSV ++   W  L N +  RL
Sbjct:   40 GRERPLRAGESWFLVEKHWYKQWEVYVKGGDQDASTFPGCINNAGLFEDQISWHLRERLLEGDDYVLLPAPAWNYMVSWYGLMDGQPPIERKVIELPGIRKVEVYPLELLLVQHSDMETALTIQFSYTDSVELVLQTAREQFLVEPQEDTRLWTKNSEGSLDRL-CNTQITLLDACLETGQLVIMETRNKDGTWPSAQ--------LCGMNNIPDEDEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFRNPLGMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCNGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALS-THTSVAPDKMIVADVFSHRFYKLYQLEDPLSGILDRDDIFVYEVTGRIEPVEGSRDDIVVPVYLRERTPSRDYNNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRL 587          

HSP 2 Score: 151.754 bits (382), Expect = 4.609e-37
Identity = 78/206 (37.86%), Postives = 116/206 (56.31%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYDP-DFEIPESHPSMN--MQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLSQD 2533
            + +DW  + K ++YD  + E    H  +   ++  P+ ++ C+  F   E L   + WYC  CK  + ATKK DLW LP+VLI+HLKRF      R+K+DT V+FP+ DLD S+FV     ++    ++     YDL+AVSNH GG+  GHYT FA N     W+ FDD+  S +  + +++K AYVL Y  + V ++     S D
Sbjct:  702 IAMDWEPDMKRRYYDEVEAEGYVKHDCVGYMLKKSPVQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLPEVLIIHLKRFSFSKISREKLDTLVQFPIRDLDFSEFVIKPKNESSPDLYK-----YDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTSSSD 902          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp15 (ubiquitin specific peptidase 15 [Source:MGI Symbol;Acc:MGI:101857])

HSP 1 Score: 312.768 bits (800), Expect = 9.753e-92
Identity = 191/508 (37.60%), Postives = 279/508 (54.92%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMH---NTLIVEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSK---QRSVTKLISGGNSRQSD----GRVQ---GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYEL 1588
            + SL+  D W+L+D  W  +W +           +  +N    P I NS LL D +  S    +I   DY L+P E WN +V  Y +    E   R VVE         VEV   +L +   G  N  VT+ FS+  T++ I +     F +   K  R+  K  +  F+ +    + +I DAGL  G+ + I+ ++ D  W  G S    + S   L S    +  D    GR     G+CGL NLGNTCFMNSAIQC+SN PPLT YF+  +++++LN  NPLGM G +A+ Y +L++QMW    +Y  PR FK +V +FAPQFSGY Q D QEL+ FLLDGLHEDLNRI+KKPY++  D+D +P +  AEEAW+ H  RNDS+IV+ FHGL KST+VCP+C  +SVTFD F  L+LPL +   +   +     D   K ++ K++V K   + D    +  L   V    +   +I  +R  R++   ++ + + + +++ V+E+
Sbjct:   21 KTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGP-IDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKEARLWNKYMSNTFEPLN-KPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERSLEVYLVRMDPLAKPMQYKVIVPKIGNILDLCTALSAL-SGVPADKMIVTDIYNHRFHRIFAVDENLSSIMERDDIYVFEI 525          

HSP 2 Score: 161.384 bits (407), Expect = 5.196e-40
Identity = 95/225 (42.22%), Postives = 128/225 (56.89%), Query Frame = 2
Query: 1892 IKALQTHIRYE-----------LILDWSKEGKEKFYDP----DFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYL 2521
            IK   +HIR++           L LDW  + K++++D     DFE  ES      +   + +++C+  F   EKLG  D WYC  CK+ + ATKK DLW LP VL++HLKRF    Y RDK+DT V+FP++DLD+S+F+          N   G   Y+L+AVSNH GG+GGGHYTAFA N  D  WY FDDS  S  + D + +K AYVL Y  +     T + 
Sbjct:  698 IKDDTSHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYKPPKRPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPISDLDMSEFLI---------NPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFF 913          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:MGI Symbol;Acc:MGI:98905])

HSP 1 Score: 305.449 bits (781), Expect = 6.050e-91
Identity = 203/628 (32.32%), Postives = 314/628 (50.00%), Query Frame = 2
Query:  164 SLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVT----------------------KLISGGNSRQSDG-------------------------RVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKI--LKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELP-SSDNKDEWIHLTM-----------RTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDC 1780
            +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  I   DAGL  G+ + I+ Q+ D  W     + +S T                       LI+ G+S  S G                          +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ F+LDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D +   ++ ++ V     + D  + + +L   +A   +   ++  +R  +++   +  + +   +++ VYE+  +S +  E I L +            +     +G P++VSV K ++   SL   +  R+      P  ++ + +  E   C
Sbjct:   27 TLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTIQ--DAGLYQGQVLVIEPQNEDGTWPRQSLQSKSSTAPSRNFTTSSKPSASPYCSVSASLIANGDSTNSSGMHSSGVSRGGSGFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEPKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRIMEVFLVPADPQCRPIQYRVTVPLMGAISDLCEALSKL-SGIAAENMVVTDVYNHRFHKIFQMDEGLSHITPRDDIFVYEVCNTSMDGSECITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLESLYQAVCDRISRYIKQPLPDEFLSSPLEPGAC 649          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|P35123|UBP4_MOUSE (Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus OX=10090 GN=Usp4 PE=1 SV=3)

HSP 1 Score: 455.292 bits (1170), Expect = 4.870e-144
Identity = 299/907 (32.97%), Postives = 454/907 (50.06%), Query Frame = 2
Query:  164 SLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVT----------------------KLISGGNSRQSDG-------------------------RVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKI--LKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELP-SSDNKDEWIHLTMRTVDDQ-----------YFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDCIDPK--------------------VAKIE----------YDKISPVVKIYLKDKSTSKLHLID---------LESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  I   DAGL  G+ + I+ Q+ D  W     + +S T                       LI+ G+S  S G                          +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ F+LDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D +   ++ ++ V     + D  + + +L   +A   +   ++  +R  +++   +  + +   +++ VYE+  +S +  E I L +   + +            +G P++VSV K ++   SL   +  R+      P  ++ + +  E   C   +                    ++++E          + + +  VK   + K      L++         L +  K L+ + R  L +DW  E +  ++D  + E  E H SM+   +     + +  C+  F   E LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV D  R A  +       +YDL+AVSNH G +G GHYTA+A N ++  WY FDDS  S  + D + TK AYVL Y
Sbjct:   27 TLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTIQ--DAGLYQGQVLVIEPQNEDGTWPRQSLQSKSSTAPSRNFTTSSKPSASPYCSVSASLIANGDSTNSSGMHSSGVSRGGSGFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEPKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRIMEVFLVPADPQCRPIQYRVTVPLMGAISDLCEALSKL-SGIAAENMVVTDVYNHRFHKIFQMDEGLSHITPRDDIFVYEVCNTSMDGSECITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLESLYQAVCDRISRYIKQPLPDEFLSSPLEPGACNGSRSSYEGDEEEEMDHQEEGKEQLSEVEGSGEDDQGDDHSESAQKVKGQPRHKRLFTFSLVNSCGTADINSLATDGKLLKLNSRSTLAIDWDSETRSLYFDEQESEACEKHLSMSQPQKKKKAAVALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVRALNMSEFVCD--RSARPY-------VYDLIAVSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLFY 919          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|B2GUZ1|UBP4_RAT (Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus OX=10116 GN=Usp4 PE=1 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 1.082e-143
Identity = 297/906 (32.78%), Postives = 452/906 (49.89%), Query Frame = 2
Query:  164 SLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVT----------------------KLISGGNSRQSDG-------------------------RVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSD-NKDEWIHLTMRTVDDQ-----------YFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDCIDPK-------------------VAKIEYD----------KISPVVKIYLKDKSTSKLHLID---------LESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  I   DAGL  G+ + I+ Q+ D  W     + +S T                       LI+ G+S  S G                          +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ F+LDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D   + ++ ++ V     + D  + + +L   +A   +   ++  +R  +++   +  + +   +++ VYE+ ++  +  E+I L +   + +            +G P++VSV K  +   SL   + +R+      P   + + +  E   C   +                   ++++E            + +   K   + K      L++         L +  K L+ + R  L +DW  E +  ++D  + E  E H SM+   +     + +  C+  F   E LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV D  R A  +       +YDL+AVSNH G +G GHYTA+A N ++  WY FDDS  S  + D + TK AYVL Y
Sbjct:   27 TLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTIQ--DAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSSKPSASPYSSMSASLIANGDSTNSSGMHNSGVSRGGAGFSASYNCQEPPSPHIQPGLCGLGNLGNTCFMNSALQCLSNTGPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEPKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRIMEVFLVPADPHCRPIQYRVTVPLMGAISDLCEALSKL-SGIAAENMVVTDVYNHRFHKIFQMDEGLSHITPRDDIFVYEICTTPMDGSEYITLPVYFREKKSRPSSTSSGAVLYGQPLLVSVPKHRLTLESLYQAVCERISRYIKQPLPEEFLSSPLEPGACNGSRGSYEGDEEEMDHQEEGKEQLSEVEESGEDSQGGDPTETTQKAKGPPRHKRLFTFSLVNSCGTADINSLATDGKLLKLNSRSTLAIDWDSETRSLYFDEQESEACEKHTSMSQPQKKKKAAIALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPVRALNMSEFVCD--RAARPY-------VYDLIAVSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLFY 918          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q13107|UBP4_HUMAN (Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=3)

HSP 1 Score: 444.891 bits (1143), Expect = 4.413e-140
Identity = 298/910 (32.75%), Postives = 441/910 (48.46%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTK----------------------LISGGNSRQSDG-------------------------RVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSD-NKDEWIHLTM-----------RTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDC-------------------------------------IDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPI---KALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            + +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  +   DAGL  G+ + I+ Q+ D  W     + +S T                       LI+ G+S  + G                          +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D   +  + ++ V     V D  + +  L   +A   +   ++  +R  +++   +  N +   +++ VYE+ S+  +  E + L +            +     +G P+++SV K ++   SL   +  R+      P  ++   +  E   C                                      DP     +  K  P  K        +     D+ S     K L+ + R  L +DW  E +  +YD  + E  E H SM    +     + + +C+  F   E LG +D WYC  CK  + ATKKFDLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV          N      +YDL+AVSNH G +G GHYTA+A N ++  WY FDDS+ S  + D + TK AYVL Y
Sbjct:   25 RTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQ--DAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRL-SGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVC---------NLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFY 920          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q5RCD3|UBP4_PONAB (Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii OX=9601 GN=USP4 PE=2 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 1.469e-138
Identity = 297/910 (32.64%), Postives = 440/910 (48.35%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVT----------------------KLISGGNSRQSDG-------------------------RVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDK--KILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSD-NKDEWIHLTM-----------RTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNKSEHNDC-------------------------------------IDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPI---KALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR----PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            + +L+   +W+LID  W  +W +          ++   N    P I NS L +D E   +   +I   DY L+P E WN +++ YG     +   R VVE H   +    VEV  ++L +         ++  FS+  T+  I +     F +   +  R+  K M N    + KLD  +   DAGL  G+ + I+ Q+ D  W     + +S T                       LI+ G+S  + G                          +Q G+CGL NLGNTCFMNSA+QC+SN  PLT YF+K E++ ++N  NPLGM G +AE Y +L++QMW     +  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYLE  D++ +P    A+EAW+ H++RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  L+LPL L   ++  +    +D   +  + ++ V     V D  + +  L   +A   +   ++  +R  +++   +  N +   +++ VYE+ S+  +  E + L +            +     +G P+++SV K ++   SL   +  R+      P  ++   +  E   C                                      DP     +  K  P  K        +     D+ S     K L+ + R  L +DW  E +  +YD  + E  E H SM    +     + + +C+  F   E LG +D WYC  CK  + ATKK DLW LPK+L++HLKRF    Y RDK+DT VEFP+  L++S+FV          N      +YDL+AVSNH G +G GHYTA+A N ++  WY FDDS+ S  + D + TK AYVL Y
Sbjct:   25 RTTLQRGAQWYLIDSRWFKQWKKYVGFGSWDMYNVGEHNLFPGP-IDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVE-HGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAEREARLWNKYMSNTYEQLSKLDNTVQ--DAGLYLGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSPKSSASPYSSVSDSLIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDVVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRL-SGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGSDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRSLYYDEQESEAYEKHVSMLQPQKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKSDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVC---------NLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFY 920          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9ZSB5|UBP10_ARATH (Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana OX=3702 GN=UBP10 PE=2 SV=2)

HSP 1 Score: 406.757 bits (1044), Expect = 5.164e-126
Identity = 280/892 (31.39%), Postives = 443/892 (49.66%), Query Frame = 2
Query:  185 WFLIDKVWHHKWSRSIE-------TKNATDIPK---------IPNSRLLNDNEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMH---NTLIVEVEPIKLTISIYGKENKAVTKFSRCKTLNDIYQYAMNKFAVTKPLR----ILQKMDNGAFDVVK----------LDGNISIGDAGL----------SNGEHIFIDYQDSDH--------QWMNGKSKQRSVT---KLISGGNSRQS-----DGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL--VLTHPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVY-FPQDSANILKDVENLMVYEL-----PSSDNKDEWIHL--------TMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVV-----------------KIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDPDF--EIPESH----PSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDE-IYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLSQDLNEDSAMDTD 2563
            +F+I K W+  W   +E       T  +++ P+         I +   +ND ++   ++   DY L+P++ W  +V+ Y   +     +R ++       +  VEV P+ L ++    E++ V +  +  ++ ++Y+       V +          K  NG  D +           +D +I +   GL          +  E   +  + S             NG S   + +   ++ S  + R S      G   G+ GL NLGNTCFMNSA+QC+++ PP+  YF++ ++  D+N  NPLGM G LA  +  LL+++W  G N   PR FK ++A+FAPQFSGY QHDSQEL+ FLLDGLHEDLN++++KPY+E  DSD +P  + AEE W YHK RNDSVIV+   G  KST+VCP C  +S+TFD F  LS+PL   LT      + +    +  +   ++V K  +++D +  +           L   E+  +++ R +  P DS + +KD E+++ Y L      S   K E +H         ++R  D + FG P +  V  E +    +   I   L  L+++      HN   +  +A    D+ S ++                 +I+L D+    +  +  ES I    T  R  ++++W+ EG+ + YD  +  ++PE H     +   +   + + +C+  F+  E LG +D+W+C  CK+ + A KK DLW+LP +L+ HLKRF    Y ++KIDTFV FP+ DLDLSK+V +          +NG   +Y+L AVSNH GGLGGGHYTA+A    D+ WY FDDSH S +    ++   AYVL Y         R + S+   + + M TD
Sbjct:   45 YFVISKRWYTSWQEYVENSANECSTGESSEAPRPGPIDNHDIIESDSDINDPQLRRLLVEGEDYVLVPKQVWKRLVEWY---SGGPPIERKLICQGFYTRSYSVEVYPLCLMLTDGRDESRTVIRLGKQASIRELYEKVCAMTGVPQEKAHIWDYFDKRKNGLLDPLSYKSLEESSLHMDQDILVEVDGLSSSSQSAMSSTGNELALVPLEPSRSIVTIAGGPTLSNGHSTTSNFSLFPRITSEDDGRDSLSILGKGEKGGLAGLSNLGNTCFMNSALQCLAHTPPIVEYFLQ-DYSDDINRDNPLGMCGELAIAFGDLLKKLWSSGRNAVAPRAFKTKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNKVKRKPYIELKDSDSRPDDEVAEELWNYHKARNDSVIVDVCQGQYKSTLVCPVCGKISITFDPFMYLSVPLPSTLTRSMTITVFYCDGSRLPMPYTVIVPKQGSIRDLITALGTACCLAEDESLLLAEVYDHKIFRYFEIPLDSLSAIKDDEHIVAYRLNQIPKGSRKAKLEILHGGQERAVLDSVRGSDVKLFGTPFVTYVNTEPLSGTDIDAVISGFLSPLHKVHAPSKIHNGSDNGHLADATVDQASGILSSPDTEIDNASDRELSFRIFLTDERGLNIKPLQSESSISP-GTVTR--VLVEWN-EGEHERYDSSYLSDLPEVHKTSFSAKKTRQESISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQANKKLDLWKLPDILVFHLKRFTYSRYLKNKIDTFVNFPVHDLDLSKYVKN----------KNGQSYLYELYAVSNHYGGLGGGHYTAYAKLIDDNKWYHFDDSHVSSVNESEIRNSAAYVLFY---------RRVRSETETQTAEMSTD 909          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: R7TVW0 (Ubiquitin carboxyl-terminal hydrolase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_180316 PE=3 SV=1)

HSP 1 Score: 480.33 bits (1235), Expect = 2.425e-151
Identity = 317/894 (35.46%), Postives = 455/894 (50.89%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSR---------SIETKNATDIPKIPNSRLLNDNEVSSDI----ISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVE---MHNTLIVEVEPIKLTISIYGKENKA-VTKFSRCKTLNDIYQYAMNKFAVTK--PLRILQKMDNGAFDVVKLDGN-ISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISG----------------------------------GNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDE---WIHLTMR-----------TVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLP-----------FLNQIIGNKSEHNDCIDPKVAKIEYD--------KISPVVKIYLKDKSTSK------LHLID---------LESPIKALQTHIRYELILDWSKEGKEKFYD----PDFEIPESHPSMN---MQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQ 2506
            + SLK    WFL+D  W  +W +         S+  + + +   I NS L+  N  +  +    +   D+ L+PEE W  +   YG  A  E F R V+E         VEV  + L +  Y    K  V  FSR   +  I       F++     +R+  K     F+++   GN  SI DAGL  G+ I ++ + SD  W   +   +++T                                        +S +S+ R +G+CGL NLGNTCFMNSAIQC+SNV  LT Y +   W+ +LNT NPLGM G +A  + +L++ MW     YTVPR+FKV V +F PQFSGY Q DSQELM FLLDGLHEDLNRI+ KPY+E  D+DD+P    A+EAW+ +  RNDS+IV+ FHGLLKST++CP C  VSVTFD F  LSLPL +   +   + F S D  KK+ + K+ V K  TV D    +  L   V   ++   ++  +R  +++ P+D  N + D +++ V+++P+ +  D     I + MR               Q FG P++V+V K+   +  L   + +++            +   +    SE ++         E D        + S V++    DK +S+       H ++         +    K L+   R  L +DW  + K+ FYD     DF   ES PSMN   +Q R + +  C++ F  TE+LG  DLWYC  CK  + ATKKFD+WQLP+VL++HLKRF    Y RDK+D++VEFP   L L K++          N  +G   YDL++VSNH GG+GGGHYTA+  N     WY FDDS  +  + DSV TK AYVLVY+ + + Q
Sbjct:   24 KSSLKKGATWFLVDAKWFKQWKKYVGYDNWDVSLAGEESANPGPIDNSPLMEANGTTDTLKDHLMDELDFVLVPEEAWQKLTSWYGTVAGQEPFPRKVIEQGMFTKHCKVEVYLMDLKLCDYDDLKKIHVRLFSRADPVEVIKTTMRGVFSIEDDVEIRLWNKYTTSTFELLDDKGNGYSIQDAGLCPGQVIVVERKKSDGTWPR-QVPSKNLTSFSVSSISGSSTSFGAGGSSSSSISNYESNSGSYPSSYFNSSYESNTRNRGLCGLSNLGNTCFMNSAIQCLSNVHHLTEYMLSDRWQGELNTDNPLGMRGEIATTFAELIKNMWSGKFTYTVPRNFKVAVGRFQPQFSGYQQQDSQELMAFLLDGLHEDLNRIKHKPYIEVKDADDRPDHVIAKEAWENYLRRNDSIIVDIFHGLLKSTLICPACNKVSVTFDPFCYLSLPLPIKKERQIEVFFVSGDPAKKLTQYKVTVPKLGTVNDICKALSTL-TSVPADHMMVTDVYNHRFHKIFPPEDGLNHILDRDDIFVHQIPTKNTNDSDHTIIPVYMREKNPHSSKSYNNSSTQLFGQPLLVAVPKKNCSYDMLYQAVLKKMSRYVTSPAEQDEWWKTVSNGSSEESNLNGEMEVNDEADNSSEDSIQEASEVIQEEADDKQSSRAPRLFTFHFVNSYGSTEMQSIRDDGKMLKFPSRCYLAIDWHPKAKQMFYDEKAAEDF---ESDPSMNAKTVQKRHVQLTECLDLFTTTEQLGEQDLWYCPQCKKHRQATKKFDVWQLPRVLVVHLKRFSCNKYWRDKLDSYVEFPTRGLCLKKWLL---------NQCHGSATYDLISVSNHYGGMGGGHYTAYGKNKDTGEWYHFDDSSVTATSEDSVVTKAAYVLVYLQRDLSQ 903          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: H3DBW0 (Ubiquitin carboxyl-terminal hydrolase OS=Tetraodon nigroviridis OX=99883 PE=3 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 3.356e-150
Identity = 285/849 (33.57%), Postives = 454/849 (53.47%), Query Frame = 2
Query:  149 LAKQKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIP-KIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGK-ENKAVTKFSRCKTLNDIYQYAMNKFAVTK--PLRILQKMDNGAFDVVKLDGNISIGDAGLSNG-EHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMR-------------TVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFL-------NQIIGNKSEHNDCI-DPKVAKIEY------------------DKISPVVK---------------IYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMN--MQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            L +Q  L+  D W++++  W+ +W + +ET  +N++  P +I N+ L  D +   +   ++ N D+ L+P E W+ ++  YG+       +R VV++ +T+ VEV PI+L + ++   EN    +FSR  ++  I +     FAV +    R+  K  + + + ++ + ++S+ DA LS G + + ++ +++D  W + + +      ++          R Q GVCGL NLGNTCFMNSA+QC+SN PPLT YF+   +  +LN TNPLGM G +AE Y  +++Q+W       VPR FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++ K Y+E  D+D +P Q+ AEEAW+ H+ RNDSVIV+ FHGL KST++CP+C+ +SVTFD F  LS+PL ++  ++  + F S D   K  + +++V K+  V D    + E    V  S +   ++  +R  ++Y   ++ + + D +++ VYEL + + +   + L +R             +     FG P+++SV +      +L     QRL           Q  G + E   C  DP     E                   +  SP  +                 ++  +  ++H   L   + A Q ++     +DW  E K++FY+  + +    HPSM+  +Q   + ++ C+  F   E L   + WYC +CK  + ATKK DLW LP+VLI+HLKRF    + R+K+++ V+FPL +LD S F+   +  +     Q     YDL+AVSNH GGL  GHYT++A +  ++ WY FDDS  +  A D + T  AYVL Y
Sbjct:   15 LLRQCELRAGDAWYMVECRWYEQWKQFVETGDQNSSSFPGQIDNTELFEDLDSYHIKERLVENEDFVLVPAEAWHKLLSWYGMVDGQPPLERKVVDLPSTVKVEVYPIELFLCLHSNMENAVTAQFSRTDSIYTIQRAVCEAFAVPEGSECRLWMKSSDSSCERLR-NTHVSVLDACLSTGMQTVIMETRNADGTWPSSRPQ------IMRNSVEEPDSFRGQPGVCGLTNLGNTCFMNSALQCLSNTPPLTEYFLGNSYLDELNFTNPLGMKGEIAEAYADVVKQIWSGRHYSVVPRIFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKNKEYIELRDADGRPDQEVAEEAWRNHRRRNDSVIVDTFHGLFKSTLICPECRKISVTFDPFCYLSIPLPVSKERVMEVFFVSLDPYAKPAQHRVVVPKAGRVSDLCAALSETT-GVPPSQMVVADVFNHRFYKIYTCDEALSCILDRDDIFVYELSAREEEPVLLALYLRERSHYRDYGSGSSSYGTTLFGHPLLLSVARGCCSQEALYTLFLQRLARYVRPPDPSEQPDGEQEEAAPCPSDPGAEPSEPGCSRSTSPEEEEEQEKLGEACSPANEQPAKRRACRKRRRSLFTIQAVNLQRVHREILILLVSAAQPYV----AIDWDPEMKKRFYNENEAQKYVKHPSMDVPLQQTTVQLQECIELFTTVETLEEENPWYCPVCKKHQLATKKLDLWSLPEVLIIHLKRFSYTKFTREKLESVVDFPLRNLDFSGFLLRKNVPS-----QEPPSRYDLIAVSNHYGGLRDGHYTSYARHKDNAQWYYFDDSKVTFAAEDQIVTSAAYVLFY 846          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A3B3QW56 (Ubiquitin carboxyl-terminal hydrolase OS=Paramormyrops kingsleyae OX=1676925 PE=3 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 1.692e-148
Identity = 311/870 (35.75%), Postives = 465/870 (53.45%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVV-KLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVK-GCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQ-----------YFGWPIMVSVCKEEIDWYSLKNRIFQRL----PFLNQIIG----NKSEHNDCIDPKVAKIEYDKISPVVKIYLK--------DKSTSKLHLIDLESPIKALQTHI------------RYELILDWSKEGKEKFY-DPDFEIPESHPSM-NMQHRPLDI--ENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSK---SVLQQTRYLLSQDLNE-DSAMDTD 2563
            L+  D WFLID  W  +W +          ++  +N    P I NS L +D+E  S    +I   DY L+P E W  +V  YG         R VVE H   +    VEV  ++L +  +   +K VT+ FS+  T+  I +     F +   K  R+  K  +  F+ + K+D   ++ D+GL  G+ + I+ ++ D  W    S+Q       S            G+CGL NLGNTCFMNSA+QC+S+  PLT YF+   ++ ++N  NPLGM G +AE Y  L++Q+W+   C+Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYLE  D+D +P +  A EAW+ H++RNDS+IV+ FHGL KST+VCP+C  VSVTFD F  L+LPL +   +   +    +D   ++++ +++V K  TV D  + + +L   +A   +   ++  +R  ++Y  +D  + + D +++ VYE+ + D  +  ++L M   + Q            FG P++++V ++ +    L +++F R+    P  +Q+      + SE + C D      E ++    VK  L           S +KL    L +      T +               + +DW+ E K+ +Y D + E  E H SM ++Q + + +  + C+  F   E LG +D WYC  CK  + ATKKFDLW  P++L++HLKRF      RDK+DT V+FP+ +L++S+FV +    AE H       +YDL AVSNH GGLGGGHYTAFA N +D  WY FDDS  S    D + TK AYVL Y  +   S    +  L +QD    D  MDT+
Sbjct:   44 LRKGDDWFLIDTRWFKQWKKYVGYESWDMYNVGERNLFPGP-IDNSGLFSDHEAQSLKEHLIDELDYILLPTEAWQNLVSWYGFLEGQRPIVRKVVE-HGMFVKHCKVEVYLLELNLCEFNNMDKVVTRHFSKADTVGTIEKEMRKLFGIPMEKETRLWNKYMSNTFEQLNKMDS--TVQDSGLFQGQMLVIEQKNGDGMW----SRQSQHANSYSSSYIYSEAQTQPGLCGLSNLGNTCFMNSALQCLSHASPLTEYFLNDHYEAEINRENPLGMRGEIAEAYADLIKQLWLDCNCSYMAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELRDADGRPDETVAAEAWRNHQLRNDSIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKKDRTMEVSLVRTDPQSRLMQYRVVVPKLGTVVDLCNALSKL-SGIATENMIVADVYNHRFHKIYRKEDGLSSIMDKDDIFVYEVEAED--ENGLNLLMYFRERQTKSAGGSPGTVLFGQPLLITVPRQGLSVDLLYSKVFDRIRSERPMDHQVSPEPEYSASEASVCDDEDEDDDEDEEGGGEVKKLLAACTSKSGFGSSQAKLFSFSLINSYGTANTALLPGDGNLLKLNKLSTVAMDWNPEMKKLYYDDQEAEAYEKHESMLHLQKKKVTVALKECIELFTSMETLGEHDPWYCPTCKKHQQATKKFDLWSFPRILVVHLKRFSYNRCWRDKLDTVVDFPIRNLNMSEFVCNPK--AERH-------VYDLFAVSNHYGGLGGGHYTAFAKNNMDEKWYYFDDSSVSSATEDQIVTKAAYVLFYQCRDGDSPAISSTSLTTQDTETGDDNMDTN 893          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A3P9KCG4 (Ubiquitin carboxyl-terminal hydrolase OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 1.919e-148
Identity = 299/811 (36.87%), Postives = 435/811 (53.64%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR-----SIETKNATDIPKIP----NSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRL-PFLNQIIGNKSEHNDCID--PKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR---PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            LK  D+W+LID  W  +W +     S +  N  +    P    NS L +D E  +    +I   DY L+P E WN +V  YG         R VVE H   +    VEV  ++L +      +  VT+ FS+  T++ I +     F +   K  R+  K M N    + K D   ++ DAGL  G+ + I+ ++ D  W    S     +         Q+     G+CGL NLGNTCFMNSA+QC+SN PPLT YF+  +++ ++N  NPLGM G +AE Y  L++QMW+   +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYL   D++ +  +  A+EAWK H++RNDSVIV+ FHGL KST+VCP C  VSVTFD F  L+LPL +   +   +    SD   K  + + +V K  TV D    + +L   +    +   ++  +R  ++Y   D  N + + +++ VYE+   D++   + + +R    ++         FG P++++V +  +    L ++I +R+ P     +  + E    ++   K  K +    S VV  Y     T+ +  +  E  +  L  H    + +DW  E K+ FYD  + E  E H SM    +    + + +C+  F   E LG +D WYC  CK  + ATKKFDLW LP++L++HLKRF      RDK+DT V+FP+ DL++S+FV D          +    IYDL+AVSNH GG+GGGHYTA+A N +D  WY FDDS  S    D + TK AYVL Y
Sbjct:   44 LKKGDEWYLIDSRWFKQWKKYVGFDSWDMYNVGERSLYPGPIDNSGLFSDQETQALKEHLIDELDYVLVPTEAWNKLVSWYGCLEGQRPIVRKVVE-HGMFVKHCKVEVYLLELNLCENDNMDNVVTRHFSKADTIDTIEKEMRTLFEIPSEKETRLWNKYMSNTYEQLNKPDS--TVQDAGLFQGQVLVIERKNEDGTWPRQASHPNYNSYNSYSYRESQAQ---PGLCGLSNLGNTCFMNSALQCLSNAPPLTEYFLDDQYEAEINRENPLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLALRDAEGREDEIVAKEAWKNHRLRNDSVIVDIFHGLFKSTLVCPVCSKVSVTFDPFCYLTLPLPMKKDRTMEVFLVRSDPQSKPTQYRAVVPKLGTVADLCSALSKLC-GIPPENMVVADVYNHRFHKIYRRDDGLNQIMEKDDIFVYEVQEEDSERMNLPVYLRERQSKHAASSSSTLLFGQPLLITVPRHNLTADVLYDKILERIGPEPENGLSEEEEETSDLENGSKAQKTKLFTFS-VVNFY----GTANISSLPCEGNVLKLNPH--STVAIDWDTESKKLFYDEQEAEAYEKHESMLQPQKKKTTVALRDCIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTVVDFPIRDLNMSEFVCDP---------KASPYIYDLIAVSNHYGGMGGGHYTAYAKNKLDGKWYYFDDSSVSSATDDQIVTKAAYVLFY 831          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A3Q0CE20 (Ubiquitin carboxyl-terminal hydrolase OS=Mesocricetus auratus OX=10036 GN=Usp11 PE=3 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 5.344e-148
Identity = 288/845 (34.08%), Postives = 452/845 (53.49%), Query Frame = 2
Query:  146 ELAKQKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIPKIPNSRLLNDNEVS----SDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAV--TKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQG---VCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYEL-----PSSDNKDEW---IHLTMRT----VDDQY-----FGWPIMVSVCKEEIDWYSLKNRIFQRL------PFLNQIIGNK---SEHNDCIDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMN--MQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLSQDLNEDSA 2551
            E  +++ L+  + WFL+++ W  +W   ++   ++A   P   N+  L +++++      ++  +DY L+P  +WN++V  YG++      +R V+E+     VE+ PI+L +  +     A+T +FS   +L+ + Q A  +F V   +  R+  K   G+ D +  +  I++ DA L  G+ + ++ ++ D  W + +        L    N  + D   QG   +CGL NLGNTCFMNSA+QC+SNVP LT YF+   + ++LN  NPLGM G LAE Y  L++Q W       VP  FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++KK Y+E  D   +P  + A+EAW+ HK RNDSVIV+ FHGL KST+VCPDC  VSVTFD F  LS+PL +   ++  + F   D  +K  + +++V K   + D    +      VA   +   ++ ++R  ++Y  +D  + + D +++ VYE+     P   ++D+    ++L  RT     D+ Y     FG P++VSV ++   W  L N +  RL      P  ++  G++   S H     P+  + +   +  V      D++TS           + +QT     + +DW  E K ++YD  + E    H  +   ++  P+ ++ C+  F   E L   + WYC  CK  + ATKK DLW LP+VLI+HLKRF    + R+K+DT V+FP+ DLD S+FV     ++    ++     YDL+AVSNH GG+  GHYT FA N     W+ FDD+  S +  + +++K AYVL Y  + V ++     S D     A
Sbjct:   38 ENGRERPLRAGESWFLVEQHWFKQWEVYVKGGDQDANTFPGCINNAGLFEDQINWHLREGLLEGNDYVLLPATSWNYLVSWYGLEDGQPPIERKVIELSGVPKVELYPIELLLVQHSDMETALTIQFSHTDSLDVVLQTAREQFLVEPQEDTRLWIKNSEGSLDRL-CNTQITLLDASLETGQLVIMETRNKDGTWPSAQ--------LCGMDNMPEEDEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFWNPLGMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALS-THTSVAPDKMIVADVFSHRFYKLYQLEDPLSSILDRDDIFVYEVTGRIEPVEGSRDDIVVPVYLRERTPSRDFDNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRLSRYVTKPTSDEDDGDEKDNSLHTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSP----------EEIQTQPY--IAMDWEPEMKRRYYDEVEAEGYVKHDCVGYMLKKSPVQLQECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLPEVLIIHLKRFSFSKFSREKLDTLVQFPIRDLDFSEFVIKPKNESTPDMYK-----YDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTASSDTPASPA 855          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp4 (ubiquitin specific peptidase 4 [Source:NCBI gene;Acc:103035454])

HSP 1 Score: 397.897 bits (1021), Expect = 2.400e-124
Identity = 232/576 (40.28%), Postives = 326/576 (56.60%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIG--NKSEHNDCIDPKVAKIEYDKI--SPVVKIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFY-DPDFEIPESHPSMNMQHR---PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            G+CGL NLGNTCFMNSA+QC+SN PPLT YF++ +++ ++N  NPLGM G +AE Y  L++QMW+   +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYL   D++ +P +  A+EAW  H++RNDS+IV+ FHGL KST+VCP+C  VSVTFD F  L+LPL +   +   +    SD   +  K +++V K  TV D    + +L    A++ + A ++  +R  ++Y  ++  N + D + + +     S N       T    +           VC  E++    ++           + G    SE  +     V K    K+    +V  Y     T+ +  +  E  I  L  H    + +DW  + K   Y D + E  E H SM    +    + ++ C+  F   E LG +D WYC  CK  + ATKKFDLW LP++L++HLKRF      RDK+DT V+FP+ DL++S+FV D          +    +YDLVAVSNH GG+GGGHYTA+A N  D  WY FDDS  S  + D + TK AYVL Y
Sbjct:  280 GLCGLSNLGNTCFMNSALQCLSNSPPLTEYFLEDQYEAEINRENPLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLALRDAEGRPDEIVAKEAWTNHRLRNDSIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKKDRTMEVILVCSDPLSRPTKYRVVVPKIGTVADLCSALSKLSGVPAENMVVA-DVYNHRFHKIYRKEEGLNHIVDKDIIFI---AGSTNGSSSHSETCNGPN----------GVCDGEVEAMDHQDSPDPESSQSETVDGEDEGSEPENGPVASVGKASRPKLFTFSMVNTY----GTANISPLPCEGNILKLTPH--STIAIDWEADSKRLCYDDQEAEAYEKHESMMQAQKKKTTVALKECIELFTTMETLGEHDPWYCPTCKKHQRATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTIVDFPIRDLNMSEFVCDP---------KAAPYVYDLVAVSNHYGGMGGGHYTAYAKNKADGKWYYFDDSSVSSASEDQIVTKAAYVLFY 826          

HSP 2 Score: 58.151 bits (139), Expect = 3.490e-8
Identity = 57/194 (29.38%), Postives = 87/194 (44.85%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIF 676
            + +L+  D+WFLID  W  +W +          ++   N    P I NS L +D E  +    +I   DY L+P E WN +V  YG     +   R VVE H   +    VEV  ++L +      +  VT+ FS+  T++ I +   + F +   K  R+  K M N    + K D  +   DAGL  G+  F
Sbjct:   18 KTTLRKGDEWFLIDSRWFKQWKKYVGFDSWDMYNVGEHNLYPGP-IDNSGLFSDQETQALKDHLIDELDYVLVPTEAWNKLVSWYGCLEGQKPIVRKVVE-HGMFVKHCKVEVYLLELNLCENDNMDNVVTRHFSKADTIDTIEKEMRSLFNIPSEKETRLWNKYMSNTYEQLNKPDSTVQ--DAGLFQGQVGF 207          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp11 (keratin, type II cytoskeletal cochleal-like [Source:NCBI gene;Acc:103034344])

HSP 1 Score: 337.421 bits (864), Expect = 6.422e-99
Identity = 184/502 (36.65%), Postives = 302/502 (60.16%), Query Frame = 2
Query:  131 DAHYFELAKQKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIP-KIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVTKPL--RILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYT-VPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSS 1597
            D ++F+   ++ L++ + W+L+D  W   W   ++T  +N+   P +I N+ L  + E   +   ++ N D+ L+P E W  ++  YG+       +R V+++ +T+ VE+ P+++ + ++    + VT +FSR  T+  I +    +F V +    R+  K  + + + ++ +  +++ D  L+ G  + ++ +++D  W + + +      ++      Q   R Q GVCGL NLGNTCFMNSA+QC+SN PPLT YF+K  +  +LN TNPLGM G +AE Y  +++QMW  G +Y+ VPR FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++ K Y+E  D+D +P Q+ AEEAW+ H+ RNDSVIV+ FHGL KST+VCP+C+ VSVTFD F  LS+PL ++  ++  + F S D   K ++ +++V K+  V D    + +    +  S +   ++  +R  ++Y   +S + + D +++ VYEL SS
Sbjct:  207 DLNFFKAFYEEELRVGESWYLVDCRWFELWKEYVKTGDQNSPSFPGQIDNTELFENLETYRLKERLVENEDFVLVPAEAWRKLLSWYGMVPEQPALERKVIDLPSTVKVEIYPVEIFLCLHSNMEEVVTEQFSRTDTIYTIQKVMQKQFEVEEDAEPRLWMKSSDTSCERLR-NTQMTVLDTCLATGMTVIMELRNADGTWPSSRPQ------IMRNSVEEQDTYRGQPGVCGLTNLGNTCFMNSALQCLSNTPPLTEYFLKNLFLGELNFTNPLGMKGEIAEAYADVIKQMW-SGRHYSVVPRIFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKNKEYIELRDADGRPDQEVAEEAWRNHRRRNDSVIVDTFHGLFKSTLVCPECQKVSVTFDPFCYLSVPLPISKERVMEVFFVSLDPLSKPVQHRVVVPKAGKVIDLCTALSQAT-NIPASQMVVADVFNHRFYKIYQVDESLSCILDRDDIFVYELSSS 699          

HSP 2 Score: 145.976 bits (367), Expect = 3.263e-35
Identity = 78/191 (40.84%), Postives = 109/191 (57.07%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFY-DPDFEIPESHPSMNM--QHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSK-FVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            + +DW  + K+K+Y + + E  +   SM +  QH  + ++ C+  F   E L   + WYC  CK  + ATKK DLW LP+VLI+HLKRF    Y R+K+D+ VEFPL  LD S   +     D+E  +       YDL+AVSNH GGL  GHYT++A N  +  WY FDDS  +    + + T  AY+L Y
Sbjct: 1029 VAIDWDPDMKKKYYNESEAERYDKDQSMKVPQQHTTVQLQECIELFTTVETLEEENPWYCPTCKKHQLATKKLDLWSLPEVLIIHLKRFSYTKYSREKLDSIVEFPLRCLDFSGCLLRKTGTDSEPPSR------YDLIAVSNHYGGLRDGHYTSYAQNKDNGRWYYFDDSKVTCAKEEQIVTNAAYLLFY 1213          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp4 (ubiquitin specific peptidase 4 [Source:NCBI gene;Acc:103035454])

HSP 1 Score: 320.857 bits (821), Expect = 2.571e-94
Identity = 206/610 (33.77%), Postives = 311/610 (50.98%), Query Frame = 2
Query:  158 QKSLKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQW-----------------------------------MNGKSKQRSVTKLISGGNSRQSDGRV------------------QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMR---------TVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            + +L+  D+WFLID  W  +W +          ++   N    P I NS L +D E  +    +I   DY L+P E WN +V  YG     +   R VVE H   +    VEV  ++L +      +  VT+ FS+  T++ I +   + F +   K  R+  K M N    + K D  +   DAGL  G+ + I+ ++ D  W                                    NG S   S   L    NS  S  R+                   G+CGL NLGNTCFMNSA+QC+SN PPLT YF++ +++ ++N  NPLGM G +AE Y  L++QMW+   +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYL   D++ +P +  A+EAW  H++RNDS+IV+ FHGL KST+VCP+C  VSVTFD F  L+LPL +   +   +    SD   +  K +++V K  TV D    + +L    A++ + A ++  +R  ++Y  ++  N + D + + +YE+   D++   + +  R         +     FG P++V+V +  +   +L  R+ +R+
Sbjct:   41 KTTLRKGDEWFLIDSRWFKQWKKYVGFDSWDMYNVGEHNLYPGP-IDNSGLFSDQETQALKDHLIDELDYVLVPTEAWNKLVSWYGCLEGQKPIVRKVVE-HGMFVKHCKVEVYLLELNLCENDNMDNVVTRHFSKADTIDTIEKEMRSLFNIPSEKETRLWNKYMSNTYEQLNKPDSTVQ--DAGLFQGQVLVIERKNEDGTWPRQASHTKSSTTTSRTFTTSPKFSSNSSATISSTVTNGDSSSNSSYML---NNSTSSGNRLGGYNSYSSSYSYRESASQPGLCGLSNLGNTCFMNSALQCLSNSPPLTEYFLEDQYEAEINRENPLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLALRDAEGRPDEIVAKEAWTNHRLRNDSIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKKDRTMEVILVCSDPLSRPTKYRVVVPKIGTVADLCSALSKLSGVPAENMVVA-DVYNHRFHKIYRKEEGLNHIVDKDIIFIYEVLEEDSERMNLPVYFRERHMKHSGGSSGTMLFGQPLLVTVPRHNLSQDTLYERVLERI 642          

HSP 2 Score: 158.303 bits (399), Expect = 3.677e-39
Identity = 92/215 (42.79%), Postives = 122/215 (56.74%), Query Frame = 2
Query: 1853 STSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYD-PDFEIPESHPSMNMQHR---PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
             T+ +  +  E  I  L  H    + +DW  + K   YD  + E  E H SM    +    + ++ C+  F   E LG +D WYC  CK  + ATKKFDLW LP++L++HLKRF      RDK+DT V+FP+ DL++S+FV D          +    +YDLVAVSNH GG+GGGHYTA+A N  D  WY FDDS  S  + D + TK AYVL Y
Sbjct:  777 GTANISPLPCEGNILKLTPH--STIAIDWEADSKRLCYDDQEAEAYEKHESMMQAQKKKTTVALKECIELFTTMETLGEHDPWYCPTCKKHQRATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTIVDFPIRDLNMSEFVCDP---------KAAPYVYDLVAVSNHYGGMGGGHYTAYAKNKADGKWYYFDDSSVSSASEDQIVTKAAYVLFY 980          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: USP15 (ubiquitin specific peptidase 15 [Source:NCBI gene;Acc:103037122])

HSP 1 Score: 312.383 bits (799), Expect = 1.221e-91
Identity = 194/552 (35.14%), Postives = 292/552 (52.90%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEV---SSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEM-----HNTLIVEVEPIKLTISIYGKENKAVTKFSRCKTLNDIYQYAMNKFAVTKPL--RILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSK---QRSVTKLIS---------GGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYE-----LPSSDNKDEWIHLTMRTVDDQY-------FGWPIMVSVCK 1684
            L+  + W+LID  W  +W +           +  +N    P + NS LL D +V      +I   DY L+P E WN +V  YG+    E   R VVE      H  + V +  +KL       +N    +FS+  T++ I +     F++   +  R+  K     F+ +    + +I DAGL  G+ + I+ ++ D  W  G S    + S   L S            SR S+   +G+CGL NLGNTCFMNSA QC+SN+PPLT YF+K +++ +LN  NPLGM G +A+ Y +L++Q+W    +Y  PR FK +V +FAPQFSGY Q DS EL+ FLLDGLHEDLNRI+KKPY++  D+D +P +  AEEAW+ H  RNDS+IV+ FHGL KST+VCP C  +SVTFD F  L+LPL +   +   +     D   K  + K+ V K   + D    +  +   VA   +   +I  +R  R++   ++ + + + +++ V+E     L  +D+    +HL  +     Y       FG P +++V +
Sbjct:   24 LRRGETWYLIDSHWFKQWKKYVGFDSWDKYQMGDQNVYPGP-VDNSGLLKDGDVLAIKEHLIDELDYILVPTEGWNKLVSWYGLTDGQEPIARKVVEQGMFVKHCKVEVYLTELKL-CEDSNMDNVVTRRFSKADTIDTIEKEMRKLFSIPDEMETRLWNKYMTNTFEPLN-KPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGSSTPNVKNSTYSLPSYPPYNSYEYSDQSRHSEK--EGLCGLSNLGNTCFMNSATQCLSNIPPLTEYFLKDKYQDELNEDNPLGMKGEIAKAYAELIKQLWSGKYSYVTPRPFKTQVGRFAPQFSGYQQQDSHELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHIKRNDSIIVDIFHGLFKSTLVCPVCSKISVTFDPFCYLTLPLPMKKERTLEVYLVRLDPLAKPTQYKLTVPKVGYISDLCASLS-VLSGVAAEKMIVTDIYNHRFHRIFATNENLSSIMERDDIYVFEVAVNRLEDTDHVVIPVHLREKYKQSGYNHTSTPLFGQPFLITVPR 569          

HSP 2 Score: 161.384 bits (407), Expect = 4.145e-40
Identity = 93/206 (45.15%), Postives = 121/206 (58.74%), Query Frame = 2
Query: 1916 RYELILDWSKEGKEKFYDP----DFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYL 2521
            R  L LDW  E K+K++D     DF+  ES      +     +++C+  F   EKLG  D WYC  CK  + ATKK DLW LP VL++HLKRF    Y RDK+D+ V+FPL DLD+S+F+          N   G   YDL+AVSNH GG+GGGHYTA+A N  D  WY FDDS  S ++ D + +K AYVL Y  +  ++ T Y 
Sbjct:  717 RSYLSLDWEPEIKKKYFDESVAEDFDKHESMEYKLQKKAFFKLKDCIELFTTKEKLGAEDPWYCPSCKQHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDSLVDFPLHDLDMSEFLI---------NPNAGPCRYDLIAVSNHYGGMGGGHYTAYAKNKDDGKWYNFDDSIVSPVSEDQIVSKAAYVLFYQRQDTVKGTGYF 913          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: USP15 (ubiquitin specific peptidase 15 [Source:NCBI gene;Acc:103037122])

HSP 1 Score: 306.605 bits (784), Expect = 2.821e-89
Identity = 195/580 (33.62%), Postives = 293/580 (50.52%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR----------SIETKNATDIPKIPNSRLLNDNEV---SSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEM-----HNTLIVEVEPIKLTISIYGKENKAVTKFSRCKTLNDIYQYAMNKFAVTKPL--RILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSV-------------TKLISGGNSRQSDGRV---------------------------QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYE-----LPSSDNKDEWIHLTMRTVDDQY-------FGWPIMVSVCK 1684
            L+  + W+LID  W  +W +           +  +N    P + NS LL D +V      +I   DY L+P E WN +V  YG+    E   R VVE      H  + V +  +KL       +N    +FS+  T++ I +     F++   +  R+  K     F+ +    + +I DAGL  G+ + I+ ++ D  W  G S  +S              T L +  NS  S   V                           +G+CGL NLGNTCFMNSA QC+SN+PPLT YF+K +++ +LN  NPLGM G +A+ Y +L++Q+W    +Y  PR FK +V +FAPQFSGY Q DS EL+ FLLDGLHEDLNRI+KKPY++  D+D +P +  AEEAW+ H  RNDS+IV+ FHGL KST+VCP C  +SVTFD F  L+LPL +   +   +     D   K  + K+ V K   + D    +  +   VA   +   +I  +R  R++   ++ + + + +++ V+E     L  +D+    +HL  +     Y       FG P +++V +
Sbjct:   24 LRRGETWYLIDSHWFKQWKKYVGFDSWDKYQMGDQNVYPGP-VDNSGLLKDGDVLAIKEHLIDELDYILVPTEGWNKLVSWYGLTDGQEPIARKVVEQGMFVKHCKVEVYLTELKL-CEDSNMDNVVTRRFSKADTIDTIEKEMRKLFSIPDEMETRLWNKYMTNTFEPLN-KPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGSSTPKSSGASNLSALPKISPTSLTNNHNSSFSSRNVKNSTYSLPSYPPYNSYEYSDQSRHSEKEGLCGLSNLGNTCFMNSATQCLSNIPPLTEYFLKDKYQDELNEDNPLGMKGEIAKAYAELIKQLWSGKYSYVTPRPFKTQVGRFAPQFSGYQQQDSHELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHIKRNDSIIVDIFHGLFKSTLVCPVCSKISVTFDPFCYLTLPLPMKKERTLEVYLVRLDPLAKPTQYKLTVPKVGYISDLCASLS-VLSGVAAEKMIVTDIYNHRFHRIFATNENLSSIMERDDIYVFEVAVNRLEDTDHVVIPVHLREKYKQSGYNHTSTPLFGQPFLITVPR 599          

HSP 2 Score: 161.384 bits (407), Expect = 3.913e-40
Identity = 93/206 (45.15%), Postives = 121/206 (58.74%), Query Frame = 2
Query: 1916 RYELILDWSKEGKEKFYDP----DFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYL 2521
            R  L LDW  E K+K++D     DF+  ES      +     +++C+  F   EKLG  D WYC  CK  + ATKK DLW LP VL++HLKRF    Y RDK+D+ V+FPL DLD+S+F+          N   G   YDL+AVSNH GG+GGGHYTA+A N  D  WY FDDS  S ++ D + +K AYVL Y  +  ++ T Y 
Sbjct:  747 RSYLSLDWEPEIKKKYFDESVAEDFDKHESMEYKLQKKAFFKLKDCIELFTTKEKLGAEDPWYCPSCKQHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDSLVDFPLHDLDMSEFLI---------NPNAGPCRYDLIAVSNHYGGMGGGHYTAYAKNKDDGKWYNFDDSIVSPVSEDQIVSKAAYVLFYQRQDTVKGTGYF 943          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:ZFIN;Acc:ZDB-GENE-041008-187])

HSP 1 Score: 305.449 bits (781), Expect = 8.530e-90
Identity = 198/591 (33.50%), Postives = 298/591 (50.42%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSRSI-----ETKNATDIPKIP----NSRLL------NDNEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMH---NTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMN-------GKSKQ-RSVTKLIS------------------GGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKA--KILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTM-----RTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQI 1750
            LK  D W+L+D  W  +W + +     E  +A D    P    NS L       N   +  ++I   DY L+P E W  +V+ YG  A+ E  +R V+E         VEV   +L +      +  V  +FS+  T++ I +     F +   K  R+  K     ++ +      ++ D GL  G+ + I+ ++ D  W         G  K  +S+ K+ S                  GG S        G+CGL NLGNTCFMNSA+QC+SN PPLT YF++  + K+LN  NPLGM G +A  Y  L++QMW    + TVPR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNRI+KKPY+E  D++ +  +  A+EAW  H+ RNDS+IV+ FHGL KST++CPDC  VSVTFD F  L+LPL +   +   +     D K      +++V K  +V D    +  L  +V K  +   ++  +R  +++   +  N + D +++ V+E+   D   + +H+ +     +T    Y         FG P++VSV +       L   + Q + +   +
Sbjct:   24 LKKGDTWYLVDCHWFKQWKKHVGFDSWEVYSAADQSTYPGPIDNSGLFKVGPDENLEGLKDNLIDELDYILVPTEAWRKLVEWYGYTADQEPVERKVIEYGMFVKHCKVEVYLTELRLCDNSNLDTVVNWQFSKADTIDTIEKEMRKLFHIPEEKETRLWNKYMTNTYEPLN-KPEKTLQDVGLFQGQVLVIEQKNEDGTWPRQSPTTKYGTYKSFKSILKVNSSSSSSNNYNSSYNSYSGRGGTS------TPGLCGLSNLGNTCFMNSALQCLSNTPPLTTYFLEDAYLKELNRDNPLGMRGEIACAYADLIKQMWSGSYSSTVPRSFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRIRKKPYVELKDAEGRDDKVVAQEAWDNHRKRNDSIIVDIFHGLFKSTLICPDCAKVSVTFDPFCYLTLPLPIKTERAVEVTLVWQDPKSKPTMYRVVVPKMGSVSDLCAALG-LLADVPKENMVVTDVYNHRFHKIFTMNEPLNGINDRDDIFVFEVADEDTAPDHVHVAVYMRERKTSRSGYSSSCASTSLFGLPLLVSVPRSTTTLEGLYEHLTQCMDYYENL 606          

HSP 2 Score: 162.925 bits (411), Expect = 2.343e-41
Identity = 93/204 (45.59%), Postives = 123/204 (60.29%), Query Frame = 2
Query: 1916 RYELILDWSKEGKEKFYDPDFEIP-ESHPSMNMQ----HRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQT 2512
            R  L L+W  E + +FY+ + +   E H SM  Q      P+ ++ C+  F   E+L   D WYC  CK  K ATKKFDLW LPKVL++HLKRF    Y RDK+DT V+FP+ DLD+S+FV            Q+    YDL+AVSNH GG+GGGHYTA+A N  +++WY FDDS  S  A D + +K AYVL Y  +  L++ 
Sbjct:  734 RTYLALEWDSETRARFYNNNVDKEFEKHDSMLAQPLKKKNPVKLKECIELFTTKEELAATDPWYCPNCKKHKQATKKFDLWALPKVLVVHLKRFSYNKYWRDKLDTLVDFPIRDLDMSEFVIGT---------QDVPCTYDLIAVSNHYGGMGGGHYTAYAKNKGENSWYYFDDSSVSSSAEDQIVSKAAYVLFYQRRDNLKRA 928          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001826.1 (pep scaffold:Pmarinus_7.0:GL478831:2528:40053:1 gene:ENSPMAG00000001614.1 transcript:ENSPMAT00000001826.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.307 bits (669), Expect = 1.019e-75
Identity = 169/477 (35.43%), Postives = 244/477 (51.15%), Query Frame = 2
Query:  437 VEVEPIKLTISIYGK-ENKAVTKFSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVV-KLDGNISIGDAGLSNGEHIFIDYQDSDHQWMN-------------------------------GKSKQRSVTKLISGGNSR-------QSDGR---VQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKD-EWI-----HLTMRTVDDQY----------FGWPIMVSV 1678
            VEV   +L +   G  EN     FS+  T++ I +     F +   K  R+  K  +  ++ + KLD   SI DAGL  G+ + I+ ++ D  W                                 G++ + +     SG NS        +  GR     G+CGL NLGNTCFMNSAIQC+SN PPLT YF+  ++  +LN  NPLGM G +A+ Y  L +Q+W    +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNRI  KPY+E  D++ +P +  A EAW+ H+ RN+S+IV+ FHGL KST+VCP+C  VSVTFD F  L+LPL +   +   +     D   K  + K+ V KS  + D    + +L   V    +   ++  +R  +++   +  N + + +++ VYE+      D E +     H   R   + Y          FG P+ +SV
Sbjct:   14 VEVYLTELKLCENGDVENSFTRHFSKADTIDTIEKEMKKLFEIPEDKETRLWNKYTSNTYEPLNKLDS--SIQDAGLCQGQVLIIEQKNEDGTWPRQFISNNFPTSPGLSSASSSLAIGSSTYSSGYGRTNRFNPFNSSSGYNSYGYSSYDYREPGRGTSQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFVNNKYVSELNNENPLGMKGEIAKAYADLTKQIWSGRYSYVTPRAFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRILNKPYVELKDAEGRPDEVVAREAWENHQKRNNSIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKKERNMEVFLICMDPRSKPTQYKVTVPKSGQISDLCVALSKL-SGVPAHKMVVADVYNHRFHKIFQMDEKLNNILERDDIFVYEVAGGKQDDPEQVVLPVYHREKRIRHNSYNCNLVSTGMLFGQPLFISV 487          

HSP 2 Score: 106.686 bits (265), Expect = 6.927e-24
Identity = 49/108 (45.37%), Postives = 66/108 (61.11%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYDP----DFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPL 2236
            + LDW  E K ++YD     DFE  ES  S   +   + + +C+  F   E+LG++D WYC  CK  + ATKKFDLW LP +L++HLKRF    Y RDK+DT V+FP 
Sbjct:  647 IALDWDPELKRRYYDEKAAEDFERHESMQSQPTRKHSVRLRDCIELFTTKERLGVDDPWYCPSCKRHQQATKKFDLWSLPHILVVHLKRFSYSRYLRDKLDTLVDFPF 754          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp32 (ubiquitin specific peptidase 32 [Source:ZFIN;Acc:ZDB-GENE-100210-5])

HSP 1 Score: 207.223 bits (526), Expect = 2.751e-55
Identity = 143/476 (30.04%), Postives = 223/476 (46.85%), Query Frame = 2
Query:  293 EVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVTK----------------------------FSRCKTLNDIYQYAMNKFAVTKP-LRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQW-------MNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVY------FPQDSANILKDVEN-LMVYELP 1591
            + S  ++   DY ++P+  W  +   YG +    +  R V+   N   +E+E   + I +   +    +                             FS   ++  I+++   +  + +  LR+    D     ++  D   +I    + + + I I+ ++ D  W        N K+ +RS  KL+            +G  GL NLGNTCFMNS+IQC+SN   LT YF+      +LN TNPLGM G +A+ Y  L+ ++W        P   +  + K+AP+F+G+ Q DSQEL+ FLLDGLHEDLNR+  KPY+E  DSD +P  + A EAW+ H +RN S++V+ FHG LKS V C  C +VSV FD F  LSLPL +       I     D  +    +       V+D    +K+   E     L +++ Q   L+ V+      FP D+  +     + L  +E+P
Sbjct:  528 KCSPPLMWGQDYEIVPDPVWRSLSHWYGYNI---VLPRTVIPQVNGRPLELELYPVCIYLLRHQQPPTSARLAAAAAAAGGVASAPAPPKRYLAYTACFSTMLSVRQIHEFLAQRLRLRQEDLRLWLLKDENNLTLLD-DDEQTIKSLRIEDNQQILIEVRNKDMSWPEEMSSLANRKNLERS--KLVP---------TEKGATGLSNLGNTCFMNSSIQCVSNTRQLTQYFLSGMHLYELNRTNPLGMKGHMAKCYGDLINELWSGTQKNVAPLKLRWTIGKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHDKPYVELKDSDGRPDHEVATEAWENHLLRNKSIVVDLFHGQLKSQVRCKMCDHVSVRFDPFNFLSLPLPMDSSMHVEITVIRLDGSV---PVRYGLRLGVEDKYSGLKQQLSE-----LCSLQPQQILLAEVFSSNIRNFPDDNQKVRSGATSYLCAFEIP 980          

HSP 2 Score: 55.4546 bits (132), Expect = 6.177e-8
Identity = 20/55 (36.36%), Postives = 35/55 (63.64%), Query Frame = 2
Query: 2000 SMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLI 2164
            S   Q  P+ + +C+  F + E+LG ++L+YC  C+  + A+KK D+W+LP  L+
Sbjct: 1214 SRRAQTEPISLNSCLQAFTKEEELGEDELYYCSKCRAHRLASKKLDIWRLPPSLV 1268          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp32 (ubiquitin specific peptidase 32 [Source:ZFIN;Acc:ZDB-GENE-100210-5])

HSP 1 Score: 207.223 bits (526), Expect = 3.102e-55
Identity = 143/476 (30.04%), Postives = 223/476 (46.85%), Query Frame = 2
Query:  293 EVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVTK----------------------------FSRCKTLNDIYQYAMNKFAVTKP-LRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQW-------MNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVY------FPQDSANILKDVEN-LMVYELP 1591
            + S  ++   DY ++P+  W  +   YG +    +  R V+   N   +E+E   + I +   +    +                             FS   ++  I+++   +  + +  LR+    D     ++  D   +I    + + + I I+ ++ D  W        N K+ +RS  KL+            +G  GL NLGNTCFMNS+IQC+SN   LT YF+      +LN TNPLGM G +A+ Y  L+ ++W        P   +  + K+AP+F+G+ Q DSQEL+ FLLDGLHEDLNR+  KPY+E  DSD +P  + A EAW+ H +RN S++V+ FHG LKS V C  C +VSV FD F  LSLPL +       I     D  +    +       V+D    +K+   E     L +++ Q   L+ V+      FP D+  +     + L  +E+P
Sbjct:  502 KCSPPLMWGQDYEIVPDPVWRSLSHWYGYNI---VLPRTVIPQVNGRPLELELYPVCIYLLRHQQPPTSARLAAAAAAAGGVASAPAPPKRYLAYTACFSTMLSVRQIHEFLAQRLRLRQEDLRLWLLKDENNLTLLD-DDEQTIKSLRIEDNQQILIEVRNKDMSWPEEMSSLANRKNLERS--KLVP---------TEKGATGLSNLGNTCFMNSSIQCVSNTRQLTQYFLSGMHLYELNRTNPLGMKGHMAKCYGDLINELWSGTQKNVAPLKLRWTIGKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHDKPYVELKDSDGRPDHEVATEAWENHLLRNKSIVVDLFHGQLKSQVRCKMCDHVSVRFDPFNFLSLPLPMDSSMHVEITVIRLDGSV---PVRYGLRLGVEDKYSGLKQQLSE-----LCSLQPQQILLAEVFSSNIRNFPDDNQKVRSGATSYLCAFEIP 954          

HSP 2 Score: 55.0694 bits (131), Expect = 6.863e-8
Identity = 20/55 (36.36%), Postives = 35/55 (63.64%), Query Frame = 2
Query: 2000 SMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLI 2164
            S   Q  P+ + +C+  F + E+LG ++L+YC  C+  + A+KK D+W+LP  L+
Sbjct: 1184 SRRAQTEPISLNSCLQAFTKEEELGEDELYYCSKCRAHRLASKKLDIWRLPPSLV 1238          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp2b (ubiquitin specific peptidase 2b [Source:ZFIN;Acc:ZDB-GENE-100208-2])

HSP 1 Score: 151.754 bits (382), Expect = 3.711e-42
Identity = 82/199 (41.21%), Postives = 120/199 (60.30%), Query Frame = 2
Query:  767 QSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTV-PRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPV---------QKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
            Q+   V+G+ GL NLGNTCF+NS IQC+SN   L  Y +K ++K++LN  +   M G L E + +LL+ +W    + TV P+ FK ++ K+AP+F GY Q D+QE + FLLDGLH ++NR+  +P         QP+          +KA+  WK +  + +S IV+ F G LKS++ C  C + S TFD F  LSLP+
Sbjct:   13 QATKSVKGLVGLRNLGNTCFLNSVIQCLSNSNDLRDYCLKGDFKQELNMGSR--MKGALMEEFARLLQALWSSTGSETVSPQAFKTQIQKYAPRFMGYNQQDAQEFLRFLLDGLHGEVNRVLSRP--------RQPISDDLDSYSDDEKAKRMWKRYLEKENSKIVDLFVGQLKSSLKCSTCDFCSTTFDPFWDLSLPI 201          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP12 (Ubiquitin-specific protease; cleaves ubiquitin from ubiquitinated proteins; present in the nucleus and cytoplasm [Source:SGD;Acc:S000003733])

HSP 1 Score: 191.045 bits (484), Expect = 2.909e-50
Identity = 131/413 (31.72%), Postives = 218/413 (52.78%), Query Frame = 2
Query:  782 VQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMW-----VKGCNYTVPRD-FKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLES---SDSDD----QPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSET---VKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDS-------ANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQY-----FGWPIMVSVCKEEID-----WYSLKNRIFQ----RLPFLNQIIGNKSEHNDCIDPKVAK---IEYDKISPV-----VKIYLKDKSTSKLHLIDLE 1885
              G  GL NLGNTC+MNSA+QC+ ++P L  YF+   ++ ++N  NPLG HG +A  +  L+++++     +   N   P   FK  +  F   FSGY Q DSQE + FLLD LHEDLNRI KK Y E    S  DD      V+K A++ W+ H  RN SVI + F G+ KST+ CP+C+ VS+TFD +  ++LPL +       IK +  +   L  ++ +SKS T   +K+++ K+  L P      L   EI +N++   Y   +S         ++K  ++++ YELP +++ +  + +    ++  Y     FG P  +++ ++E++        L+NR        +PF  + +GN+++  D     V K   +E+++   +     +K+  KDKS   + ++ +E
Sbjct:  360 ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSDLVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRIIKKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRNCSVITDLFVGMYKSTLYCPECQNVSITFDPYNDVTLPLPVDTVWDKTIKIFPMNSPPLLLEVELSKSSTYMDLKNYVGKMSGLDPNT----LFGCEIFSNQIYVNYESTESNAQFLTLQELIKPADDVIFYELPVTNDNEVIVPVLNTRIEKGYKNAMLFGVPFFITLKEDELNNPGAIRMKLQNRFVHLSGGYIPF-PEPVGNRTDFADAFPLLVEKYPDVEFEQYKDILQYTSIKVTDKDKSFFSIKILSVE 767          

HSP 2 Score: 140.584 bits (353), Expect = 2.195e-34
Identity = 81/206 (39.32%), Postives = 117/206 (56.80%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYDPD----FEIPESHPS----------MNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFV--SDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSK 2494
            ++ +WS+ G  + +  D    +E P + P+           N + R + +++C+  F + E LG+ D WYC  CK+ + ATK+  LW  P +L++HLKRF S     DKID  V FP+TDLDLS++V   D  R            IYDL AV NH GGLGGGHYTA+  NF D+ WY FDDS  ++ A ++    +AY+L Y+ +
Sbjct:  915 IVCEWSELGSNEAFSDDKIYNWENPATLPNKELENAKLERSNAKERTITLDDCLQLFSKPEILGLTDSWYCPTCKEHRQATKQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGL----------IYDLYAVDNHYGGLGGGHYTAYVKNFADNKWYYFDDSRVTETAPENSIAGSAYLLFYIRR 1110          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: DOA4 (Ubiquitin hydrolase; deubiquitinates intralumenal vesicle (ILVs) cargo proteins; required for recycling ubiquitin from proteasome-bound ubiquitinated intermediates, acts at the late endosome/prevacuolar compartment to recover ubiquitin from ubiquitinated membrane proteins destined for the vacuole; DOA4 has a paralog, UBP5, that arose from the whole genome duplication [Source:SGD;Acc:S000002476])

HSP 1 Score: 106.301 bits (264), Expect = 6.769e-24
Identity = 63/190 (33.16%), Postives = 94/190 (49.47%), Query Frame = 2
Query:  797 GLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYT-----VPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKK------AEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
            GL NLGN+C+MN  IQCI     LT  F+   + K +N  + LG  G LA+ + +L+  M+ +  + +      P  FK+        F   +Q D QE   FLLDGLHEDLN+    P L+    + +  ++K      +   W+     + SVIV+ F G   S + C  C + S T+  F  LS+P+
Sbjct:  563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLHEDLNQCGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKCKVCSHTSTTYQPFTVLSIPI 752          

HSP 2 Score: 87.0409 bits (214), Expect = 6.999e-18
Identity = 55/166 (33.13%), Postives = 88/166 (53.01%), Query Frame = 2
Query: 2024 LDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEI----------YDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKI--ASDSVQTKTAYVLVY 2485
            + IE+C  EF + E L +++ W C  C+ ++ +TK+  + +LP+ LI+HLKRF +     +K + FV +P   LDL+ F ++   D       N DE+          Y+L  V+ H G L GGHYTA+    +   W  FDD+    +   +D++ +  AYVL Y
Sbjct:  761 ITIEDCFREFTKCENLEVDEQWLCPHCEKRQPSTKQLTITRLPRNLIVHLKRFDN---LLNKNNDFVIYPFL-LDLTPFWANDF-DGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNKADAINS-NAYVLFY 920          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP5 (Putative ubiquitin-specific protease; concentrates at the bud neck; UBP5 has a paralog, DOA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000946])

HSP 1 Score: 95.5153 bits (236), Expect = 1.602e-20
Identity = 61/196 (31.12%), Postives = 97/196 (49.49%), Query Frame = 2
Query:  791 VCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVP--RDFKVEVAKFA-------PQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLES-SDSDDQ-----PVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
            + GL N+GN C+MN  +QC+     L   F+   +   +N  +  G  G LA+ +  L+  M   G  +T P  R   V+  +F        P +S   Q D QE   FLLDGLHEDLN+   K +L+  SD +++      ++K +   W+   + + S I++ F G   S + C  C++ S T+  F  LS+P+
Sbjct:  445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVNNMHRHGA-FTPPNVRTIPVQTIQFKKICGHINPMYSDSMQQDCQEFCQFLLDGLHEDLNQNGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLTDFSAIIDLFQGQYASRLQCQVCEHTSTTYQTFSVLSVPV 639          

HSP 2 Score: 92.4337 bits (228), Expect = 1.373e-19
Identity = 54/160 (33.75%), Postives = 87/160 (54.37%), Query Frame = 2
Query: 2027 DIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSD--AHRDAEDHNFQNGDEI----YDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIA-SDSVQTKTAYVLVY 2485
            +I +C  EF + E+LG+++ W C  C  ++ +TK+  + +LPK LI++LKRF +   + +K + FV++P + LDL+ + +    H    + +     ++    Y L  V+ H G L GGHYT++        WY FDDS    I  S    T +AYVL Y
Sbjct:  646 NILDCFREFTKCERLGVDEQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRFDN---QMNKNNVFVQYPYS-LDLTPYWARDFNHEAIVNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKGPKKGWYFFDDSLYRPITFSTEFITPSAYVLFY 801          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP8 (Ubiquitin-specific protease component of the SAGA acetylation complex; required for SAGA (Spt-Ada-Gcn5-Acetyltransferase)-mediated deubiquitination of histone H2B [Source:SGD;Acc:S000004836])

HSP 1 Score: 90.8929 bits (224), Expect = 1.591e-19
Identity = 55/158 (34.81%), Postives = 86/158 (54.43%), Query Frame = 2
Query: 2039 CVNEFIRTEKLGINDL-WYCKMCKDQKAATKKFDLWQLPKVLILHLKRFR---SGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSV 2500
            C++ F + E+L   D  ++C  C   + A K+  + +LP VL+L LKRF    +GS R  K+D F+EFP T L++  + S   +D    N +  D IY+L+ + +H G +  GHY AF        W+ F+DS  S I+ + V  + AY+L Y  + V
Sbjct:  319 CLDSFHKKEQL--KDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNR--KLDDFIEFP-TYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFC-KISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQV 470          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP7 (Ubiquitin-specific protease that cleaves ubiquitin-protein fusions; UBP7 has a paralog, UBP11, that arose from the whole genome duplication [Source:SGD;Acc:S000001418])

HSP 1 Score: 78.9518 bits (193), Expect = 2.063e-15
Identity = 54/191 (28.27%), Postives = 88/191 (46.07%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMH--GRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFS-GYAQHDSQELMMFLLDGLHEDLNRIQK----KPYLESSDSDDQPVQKKAEEAWKYHKMRNDSV--IVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
             + GL NLGNTC++NS IQC+         FI +++K  L      G H   +L+     L  +M++ G    VP  F   + +  P       Q D+QE +M LLD LH++L+  Q      P L   ++D   V     + W    +  + +  I + F G +++++ C  C Y +  +  F  LSL +
Sbjct:  607 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSNGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAI 797          

HSP 2 Score: 50.447 bits (119), Expect = 1.377e-6
Identity = 48/153 (31.37%), Postives = 66/153 (43.14%), Query Frame = 2
Query: 2072 GINDLWYCKMCKDQKAAT-KKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEI-YDLVAVSNHMGGLGGGHYTAFAN-------NFIDSNWYLFDDS---HTSKIASD---SVQTKTAYVLVY 2485
            G ND       K++K  T K  +   LPK+L++HL RF     +++  +T V +PL  L++                +N D + Y L  V NH G L  GHYT+  N       N   S WY FDD       K  SD    + +   YVL Y
Sbjct:  931 GGNDSNNSSDYKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKN--NTVVTYPLI-LNII--------------LKNNDTMKYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFY 1066          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO44454 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVV5])

HSP 1 Score: 419.468 bits (1077), Expect = 2.699e-131
Identity = 300/904 (33.19%), Postives = 446/904 (49.34%), Query Frame = 2
Query:  164 SLKLNDKWFLIDKVWHHKWSRSIE--------TKNATDIPK-IPNSRLLNDNEVS--SDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVTKP--LRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGG----------------------------NSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHP---QLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHL--------------TMRTVDDQYFGWPIMVSVCKEEIDWYSL------KNRIFQRLPFLN----QIIGNKSEHNDCIDPKVA---------------------------------KIEYDKISPVV---KIYLKDKSTSKLHLIDL-------ESPIKALQ--------THIRYELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRP------LDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            +L+  D W+LID  W  +W + +            A + P  + NS L  D+ V+    +I   DY L+PE  W+ +V  YG+  + +   R VVE H   +    VEV  ++  +      +  VT+ FS+  T+  I     N F++ +    R+  K  +  F+++  +   S+ DAGL  G+ + I+ Q+ D  W    ++    +  I+                              ++++S     G+ GL NLGNTCFMNS +QC+SN   LT YF+  E+  +LNT NPLGM G +A+ Y  LL Q+W    +   PR FK++V +FAPQFSGY Q DS EL+ FLLDGLHEDLNRI+ KPY+E  D+D +P Q  A EAW  H+ RNDS+IV+ FHGL KST+VCP+C  +SVTFD    LSLPL +      + F IK    +K + + K+ V K  +V D    + +    V K  L   ++  NR  +++   +S   + D +++ +YE+    +  E++ L              T  +     FG P+++SV K+ + +  L      K R +   P       +   +K++   C  P V                                  K + D+ +P V   K  + +K T K  L  L        + + AL         +H  Y L LDW+ E KEK+Y+ +    E+    ++  +P      + + +C+  F+  EKLG ND WYC  CK  + A+KKFDLW LP+VL++HLKRF   S  RDKIDT V FPL  LD+S +V    +D           +YDL+ VSNH GG+GGGHYTA+  N  D +WY +DDS  S+I  + + +K AYVL Y
Sbjct:   37 TLQKGDTWYLIDCRWFKQWKKFVGFDSWDVYGAGEAVNNPGPLDNSNLFTDDRVTLKDHLIDELDYNLVPEAAWHKLVSWYGLVNDQQPISRQVVE-HGMYVRHCKVEVYLMEFKLCENSDMDTVVTQQFSKGDTIGHIVSTMKNLFSIPEESETRLWNKYMSNTFELLS-NMEQSVQDAGLYQGQTLVIEQQNEDGSWQRQNTRSSYSSSTITSSSADNGYSSSNNSSSYSGYGSGRYWSNLYDNKKSYRGTPGLTGLANLGNTCFMNSGLQCLSNTMTLTKYFLSKEYVDELNTDNPLGMKGEIAKAYADLLNQIWSGQSSSIAPRQFKMQVGRFAPQFSGYQQQDSHELLAFLLDGLHEDLNRIKMKPYIELRDADGRPDQVVASEAWHNHRQRNDSIIVDIFHGLFKSTLVCPECNKISVTFDPLCYLSLPLPVKKERNIECFLIKNEPMEKPV-QFKLTVPKMGSVADMCAILGKQ-AGVPKDKLVVTDVYNNRFHKIFKNTESLTTIMDRDDIFIYEVSERVDNPEYLVLPVYQRKKGARLASYTYGSSSKVLFGIPLLISVPKKGLVYSELYKMCLNKMRRYVTAPEEKDDDVENGDDKTDKTVCNGPDVEMNEAESGDSDAESDEELEKAYKNVSVNGDEEEDKADTDEETPTVTNPKTEVTEKPTKKTRLFSLTLVNMYGSTDMHALADDGKPLKLSHQSY-LSLDWTTEKKEKYYNTNLS-EETEEDESVARKPTQRKSVVQLNDCIQLFLTREKLGANDPWYCPQCKKHQQASKKFDLWCLPEVLVIHLKRFSYTSLWRDKIDTLVNFPLCGLDMSDYV--IGKDGP-------PPLYDLIGVSNHYGGMGGGHYTAYCRNHEDDHWYSYDDSSVSQINEEQIVSKAAYVLFY 925          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO34754 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SNI6])

HSP 1 Score: 288.115 bits (736), Expect = 4.354e-86
Identity = 196/633 (30.96%), Postives = 295/633 (46.60%), Query Frame = 2
Query:  797 GLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDL----NTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLT--HPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQ-------YFGWPIMVSVCKE------------EIDWYSLKNRIFQ--------RLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDPDFE-IPESHPSM-NMQH-----RPLDIENCVNEFIRTEKLGINDLWYCKMCKD-QKAATKKFDLWQLPKVLILHLKRFRSGSY-------RRDKIDTFVEFPLTDLDLS-------KFVSDAH----------RDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSV 2500
            GL N GNTCF+N+ IQC+++   L  YF+   +K+DL          G  G + E+   LL+ +W    +  V  +FK  V K   Q+ GY+QHD+QE +++LLD +HEDLNR  K+ Y  + D+  +  +  A EA   H   NDS +++ F    +S + CP CK  S TFD F  LSLP+      P L  I F  + +  L+  + V  S ++ D    I E+  ++  S L   E+ ++  +R ++     +I+ D + +  +E P        IH    TV           FG P +V V +E            E+D   L N  FQ        RL  +N + G     ++   P               +Y          L   ++P      HIR  ++L+W  E +     PD +  PE H S+ N+Q+       ++++NC   + + E LG++D W C  CK  Q+   KK  LW LP+VLI+HLKRFR   +        R K+ T VEFP+ DLD+S       K + D H          R          D +YDL AV NH+G + GGHYTA   N  D  WYL+DD+   ++  + V T+ AY+L Y  +++
Sbjct:    3 GLKNHGNTCFINAIIQCLAHTDLLAEYFVMGGYKQDLKLRKGQIKKFGTKGEVTEKLAVLLKSLWYSEYSGEVSSEFKSVVGKHGAQYRGYSQHDAQEFLLWLLDIVHEDLNRATKRKYKANKDNLGRSDECIATEALNNHLRCNDSFVLDLFQAQYRSALSCPKCKQKSTTFDPFLCLSLPIPQRSLRPLLVTIVFVGASRAPLRIGVSVPISGSISDLCAAISEM-TDIPCSSLIITELSSDGFNRRFYANQPLSIIHDSDAIYGFEAPQRLG----IHTFTETVISPSLYRCCCRFGQPFVVHVLQELSFSKLQALFLHEMDRMLLDNADFQIKKHRQLFRLRVMNGLAGRSYLSSELDHP---------------LYTATVERRVALLTHSDAPGSTGPAHIR--MVLEWESELRNSCIKPDVQDSPEEHTSVQNVQNLFSNTHAVNLDNCFELYTKDETLGLDDAWLCPRCKKLQQGTVKKLSLWSLPEVLIIHLKRFRQLLFLQLQCPSGRTKLHTLVEFPVNDLDMSPHLEPRHKIIPDTHSVLTNWPHWRRTRRSSGVAGEDNLYDLYAVCNHLGNMSGGHYTAHCRNPTDGQWYLYDDTRVEQVPVNQVTTQAAYLLFYARRNL 613          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO39905 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7S8P2])

HSP 1 Score: 216.853 bits (551), Expect = 4.879e-58
Identity = 147/447 (32.89%), Postives = 216/447 (48.32%), Query Frame = 2
Query:  323 DYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIY----GKENKAVTKFSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVVKL----------DGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYS-SDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVY------FPQDSANILKDVENLM-VYELP 1591
            D+ ++PE  W  ++  YG      L +  VV ++     E+E   L + IY          +T ++        + +  N    +   P + L  +   AF  +            + N S+ D  L++  ++ ++ ++ D  W    S   S   L    N   ++   +G  GL NLGNTCFMNSA+QC+SN  PLT +F       +LN TNPLGM G +A RY  L+E +W        P   +  + ++AP+F+G+ QHD+QE + FLLDGLHEDLNR+  KPY+E  DSD +  +  A+EAW  H  RN S+IV+ F G LKS V C +C YVS  FD F  LSLPL + +     I     S    +K  +L++         DK K +  E+AK  L  I +    L  VY       P DS  I   +  ++  YE+P
Sbjct:  490 DFEILPEPVWRALLTWYG--GGPALPRTVVVPLNGDCTPELELFPLNLKIYRHSPPPTRGGITTWTGVGFGLSSFGFNTNSMTASHAPPKKYLAYL--AAFSYINTLQQNTLHLLEEENSSLRDLNLTDNMNLLLEVRNRDMSWPEEMSSLASSKSLREKLNLEPTE---KGATGLSNLGNTCFMNSALQCLSNTQPLTQFFTAKCHYYELNRTNPLGMKGHIARRYGDLVEDLWSGSSRSLAPLKLRWTIGRYAPRFNGFQQHDAQEFLSFLLDGLHEDLNRVHDKPYVELKDSDGRLDEIVAQEAWDNHIKRNQSIIVDLFQGQLKSQVRCVECGYVSARFDPFTFLSLPLPMDNSIFIEIVVVPLSGATPVKYGLLLNND-------DKYKAVRKELAK--LCVINVAQLLLVEVYGATVKSLPTDSQKIRSALGGILYAYEVP 920          

HSP 2 Score: 78.9518 bits (193), Expect = 7.805e-15
Identity = 39/118 (33.05%), Postives = 61/118 (51.69%), Query Frame = 2
Query: 1910 HIRYELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFV 2263
            H+RY+  L+ + E  E              S  +Q  P+D+  C+  F   E+LG  +LWYC  CK  + A KK ++W LP +L++HLKRF+  +    K +  V +P+   D S F+
Sbjct: 1151 HLRYQSSLEKNCEEHESV----------ERSRRLQTEPIDLYECLRAFTNEEELGDEELWYCNKCKKHRLAVKKLEIWSLPPILVIHLKRFQYVNGHWVKSNKIVNYPMAGFDPSAFL 1258          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO44502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVS4])

HSP 1 Score: 213.001 bits (541), Expect = 5.013e-58
Identity = 171/574 (29.79%), Postives = 255/574 (44.43%), Query Frame = 2
Query: 1043 QFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKI----------------------LKAKILVSKSETVKDFLDKIKELFPEVAK-SYLTAIE-----------------IQANRLSRVYFP-------------QDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVK----IYLKDKSTSKLHLIDLESPIKALQTHIRYEL-ILDWSKEG-----KEKFYDPDFEIPESHPSMNMQHRPL-----------DIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYR----RDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAF------ANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQT 2512
            QF G+ Q D+QE M FLLDGLHEDLNR+ KKPY E  +   +P  + A EAW+ H+ RNDS+IV+ F G LKS + CP CK +S+ +D F +LS+PL   +  L  + F+    ++                       K  I V     V++F  K  ++F   +  S +TA +                  + + + RV++P             Q+ A+ LK    +  Y +   + K +  H            WP    VCK +        R    LPF+  +  +++ +    D  +A+ EY + S  V+       K    S     D  S     +TH R+ +  ++   EG       +  D D+ I    P +  +  P             +  C   F   E LG +D W+C  CK  + ATK+  LW+LP  LI+HLKRF   S++    RDKI   VEFP+  LD++ F  D  R         G ++YDL AV+NH+G +  GHYTA+      A +  +  W  FDD + +  A + V +K AYVL Y  +    QT
Sbjct:  118 QFRGFMQQDAQEFMAFLLDGLHEDLNRVLKKPYTEEVEGAGKPDHEVANEAWRRHRSRNDSIIVDMFQGQLKSKLTCPVCKTISIKYDPFMNLSVPLPKENKLLKVVVFFKDTSRMPLKMTVKVSQDGSVEQLMAAVERKTGIRVQNMRVVEEFQGKFHKVFQRNSSLSSVTATDNIFVFQVLGVEEAEEEVYEVSIMQRVHYPAKIPLHCADCFTNQNPADPLKRC--MRCYAIGYCNKKCQEKH------------WPTHRKVCKVK------SGRHMIGLPFIVSMPASQATYTRLKD--LAE-EYARHSVDVRDGEDNTTKTSDPSSACETDNSSSDLMTETHPRFFIKPVNGQGEGLTGPEGTRITDQDYPIVSGKP-LECEELPCESEELSSSYSCTLRECFELFTEPETLGEDDAWHCPKCKKHREATKQMSLWRLPDTLIIHLKRF---SFKNILFRDKITKLVEFPVRGLDMTPFCLDKGR--------LGGDVYDLYAVANHVGNVNFGHYTAYGRLPPAAGHSDEIGWRYFDDRNVTVTAEERVVSKYAYVLFYQRRPTGPQT 656          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO34837 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SN67])

HSP 1 Score: 152.91 bits (385), Expect = 1.579e-40
Identity = 78/185 (42.16%), Postives = 119/185 (64.32%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTV--PRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQ-KKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
            G+ GL NLGNTCFMNS +QC+S+   LT   +K  +   +N  N   M GRL + +  L++ MW      +      FK ++ +FAP+F G+ Q D+QE + FLL+GLH+DLN++Q+KP  +  + D+     +KA++AWK +  R++S+I + F G+LKST++C +C + SVTFD F  LSLP+
Sbjct:    4 GLVGLRNLGNTCFMNSILQCLSSTWLLTNIVLKGTYVSSIN--NKSSMKGRLVQAFADLIKSMWKHDATESAISAHAFKTQIQRFAPRFVGFNQQDAQEFLHFLLEGLHDDLNKVQEKPKYKMCEFDNSLSDLEKAKKAWKLYIERDNSLITDLFVGVLKSTLICLECGFKSVTFDPFWDLSLPI 186          

HSP 2 Score: 88.9669 bits (219), Expect = 7.376e-19
Identity = 56/155 (36.13%), Postives = 87/155 (56.13%), Query Frame = 2
Query: 2024 LDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTD-LDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            +DI +C+  F + E L  ++   C+ CK ++ +TKKF + + P++L++HLKRF SG   R K+ T V FP+T   +L +F +D          +    +Y L AVSNH G   GGHYTA+  +     W+ F+DS   +I+S  V    AY+L +
Sbjct:  205 VDIRDCMELFTKEEVLDGDERPTCEKCKKKRKSTKKFTVQRFPRILVIHLKRF-SGYGFRSKLQTNVVFPVTSPQELGEFAADPS--------EGQSAVYSLYAVSNHSGSTYGGHYTAYCKHPQSRQWHCFNDSRVDQISSSRVTGPQAYILFF 350          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp11 (ubiquitin carboxyl-terminal hydrolase 11 [Source:NCBI gene;Acc:101166285])

HSP 1 Score: 462.611 bits (1189), Expect = 1.420e-148
Identity = 286/841 (34.01%), Postives = 449/841 (53.39%), Query Frame = 2
Query:  149 LAKQKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIP-KIPNSRLLND---NEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVTKP---LRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVEN-------LMVYELPSSDNKDEWIHLTMRTVDDQYFGWPIMVSV----CKEEIDWYSLKNRIFQRLPFLNQIIGNKSEH-NDCIDPKVAKI-EYDKISPVVKI----------------------YLKDKSTSKLHLIDLESPIKALQTHIRYE-----------LILDWSKEGKEKFYDP-DFEIPESHPSMNM--QHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            L ++  L+  D W+++D+ W  +W    ET  +N++  P +I N+ L  D     +   ++ N D+ L+P E W+ ++  YG+       +R VV++ +TL VEV P+++ + ++   +  +T +FSR   + +    AM +     P    R+  K  + + + ++ + +IS+ DA LS+G  + ++ ++SD  W + + +      ++      Q   R Q GVCGL NLGNTCFMNSA+QC+SN PPLT YF++  +  +LN TNPLGM G +AE Y  +++QMW       VPR FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++ K Y+E  D+D +P Q+ A EAW+ H+ RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  LS+PL ++  ++  + F   D   K ++ +++V K+  V D    + ++   VA + +   ++  +R  ++Y   +S ++++   +       L +Y    S  +D        +     FG P++++V    C  E + YSL         FL ++  +  E  N C D   A   E     P V                          K ++  +    +L + I+A+ ++   E           + +DW  + K++FY+  + E    H SM +  Q   + ++ C+  F   E L   + WYC +CK  + ATKK DLW LP+VLI+HLKRF    + R+K+D+ V+FPL DLD S F+      +E+   +     YDL+AVSNH GGL  GHYT++A N  ++ WY FDDS  +  + D + T  AYVL Y
Sbjct:   25 LLRECELRAGDSWYVVDRRWFEQWREFAETGDQNSSSFPGQIDNTELFEDLDSYRLKERLVENEDFVLVPAEAWHKLLAWYGMVDGQPPLERKVVDLPSTLKVEVYPVEIFLCLHSNMDNVITDQFSRTDNIREFVFTAMCRAFSVPPGSECRLWMKSSDSSCERLR-NVHISVLDACLSSGMTVIMEMRNSDGTWPSSRPQ------IMRNSVEEQDSYRGQPGVCGLTNLGNTCFMNSALQCLSNTPPLTEYFLQNSYLDELNFTNPLGMKGEIAEAYADVIKQMWSGRHYSVVPRVFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKNKEYIELRDADGRPDQEVAGEAWRNHRRRNDSVIVDKFHGLFKSTLVCPECHKVSVTFDPFCYLSVPLPVSKERVMEVFFVFLDPHAKPVQHRVVVPKAGKVSDLCAALSDM-TSVAPTQMVVADVFNHRFYKIYNADESLSLMRGSSSTSREQVLLALYLRERSHYRD--YGSGSSSYGTSLFGHPLLLNVPQSSCSRE-ELYSL---------FLQRLASSAEEGMNACADQSAAGCTEAAPEQPCVTTEEENTESKQEGACSPSPPPNENPAKRRACRQRRKKNLFT-IQAVNSNGTTERGTGDGGTQPYVAIDWDPDMKKRFYNENEAEKYVKHSSMEVPQQQATVQLQECIELFTTVETLEEENPWYCPVCKKHQLATKKLDLWSLPEVLIIHLKRFSYTKFTREKLDSIVDFPLRDLDFSDFLLRKSLSSEEPPSR-----YDLIAVSNHYGGLRDGHYTSYAKNKDNAQWYYFDDSKVTYASEDQIMTNAAYVLFY 839          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp4 (ubiquitin specific peptidase 4 [Source:NCBI gene;Acc:101173051])

HSP 1 Score: 450.284 bits (1157), Expect = 1.464e-143
Identity = 298/862 (34.57%), Postives = 441/862 (51.16%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR-----SIETKNATDIPKIP----NSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWM--------NGKSKQRSVTKLI------------SGGNSRQSDGRV-----------------------------QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHN-DCIDPKVAKIEYDKISPVVKIY----LKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR---PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            LK  D+WFLID  W  +W +     S +  N  +    P    NS L +D E  +    +I   DY L+P E WN +V  YG         R VVE H   +    VEV  ++L +      +  VT+ FS+  T++ I +     F +   K  R+  K M N    + K D  +   DAGL  G+ + +  + +  +++           S+  S +  +            + G+S  S G                                G+CGL NLGNTCFMNSA+QC+SN PPLT YF+  +++ ++N  NPLGM G +AE Y  L++QMW+   +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYL   D++ +  +  A+EAWK H++RNDSVIV+ FHGL KST+VCP C  VSVTFD F  L+LPL +   +   +    SD   K  + + +V K  TV D    + +L   +    +   ++  +R  ++Y   D  N + + +++ VYE+   D++   + + +R    ++         FG P++++V +  +    L ++I +R       IG + E+     + + + +E        K++    +    T+ +  +  E  +  L  H    + +DW  E K+ FYD  + E  E H SM    +    + + +C+  F   E LG +D WYC  CK  + ATKKFDLW LP++L++HLKRF      RDK+DT V+FP+ DL++S+FV D          +    IYDL+AVSNH GG+GGGHYTA+A N +D  WY FDDS  S    D + TK AYVL Y
Sbjct:   44 LKKGDEWFLIDSRWFKQWKKYVGFDSWDMYNVGERSLYPGPIDNSGLFSDQETQALKEHLIDELDYVLVPTEAWNKLVSWYGCLEGQRPIVRKVVE-HGMFVKHCKVEVYLLELNLCENDNMDNVVTRHFSKADTIDTIEKEMRTLFEIPSEKETRLWNKYMSNTYEQLNKPDSTVQ--DAGLFQGQTLLVILESTKLEFVFVLMVRSSTTPSRNFSTSPKLSSNSSMSISPTATNGDSSCSPGYTLNNSSTSSSNRLGSYNSYNSYSYRESQAQPGLCGLSNLGNTCFMNSALQCLSNAPPLTEYFLDDQYEAEINRENPLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLALRDAEGREDEIVAKEAWKNHRLRNDSVIVDIFHGLFKSTLVCPVCSKVSVTFDPFCYLTLPLPMKKDRTMEVFLVRSDPQSKPTQYRAVVPKLGTVADLCSALSKLC-GIPPENMVVADVYNHRFHKIYRRDDGLNQIMEKDDIFVYEVQEEDSERMNLPVYLRERQSKHAASSSSTLLFGQPLLITVPRHNLTADVLYDKILER-------IGPEPENGLSEEEEETSDLENGSKGQKTKLFTFSVVNFYGTANISSLPCEGNVLKLNPH--STIAIDWDTESKKLFYDEQEAEAYEKHESMLQPQKKKTTVALRDCIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTVVDFPIRDLNMSEFVCDP---------KASPYIYDLIAVSNHYGGMGGGHYTAYAKNKLDGKWYYFDDSSVSSATDDQIVTKAAYVLFY 883          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp11 (ubiquitin carboxyl-terminal hydrolase 11 [Source:NCBI gene;Acc:101166285])

HSP 1 Score: 342.428 bits (877), Expect = 3.155e-102
Identity = 194/554 (35.02%), Postives = 316/554 (57.04%), Query Frame = 2
Query:  149 LAKQKSLKLNDKWFLIDKVWHHKWSRSIET--KNATDIP-KIPNSRLLNDNE---VSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVT-KFSRCKTLNDIYQYAMNKFAVT--KPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQ-GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDE---WIHLTMRT-----------VDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            L ++  L+  D W+++D+ W  +W    ET  +N++  P +I N+ L  D +   +   ++ N D+ L+P E W+ ++  YG+       +R VV++ +TL VEV P+++ + ++   +  +T +FSR   ++ I       F+V      R+  K  + + + ++ + +IS+ DA LS+G  + ++ ++SD  W + + +      ++      Q   R Q GVCGL NLGNTCFMNSA+QC+SN PPLT YF++  +  +LN TNPLGM G +AE Y  +++QMW       VPR FK +V  FA QF GY QHDSQEL+ FLLDGLHEDLNR++ K Y+E  D+D +P Q+ A EAW+ H+ RNDSVIV+ FHGL KST+VCP+C  VSVTFD F  LS+PL ++  ++  + F   D   K ++ +++V K+  V D    + ++   VA + +   ++  +R  ++Y   +S + + D +++ VYEL     +++    ++L  R+                FG P++++V +       L +   QRL
Sbjct:   25 LLRECELRAGDSWYVVDRRWFEQWREFAETGDQNSSSFPGQIDNTELFEDLDSYRLKERLVENEDFVLVPAEAWHKLLAWYGMVDGQPPLERKVVDLPSTLKVEVYPVEIFLCLHSNMDNVITDQFSRTDNIHAIQTAMCRAFSVPPGSECRLWMKSSDSSCERLR-NVHISVLDACLSSGMTVIMEMRNSDGTWPSSRPQ------IMRNSVEEQDSYRGQPGVCGLTNLGNTCFMNSALQCLSNTPPLTEYFLQNSYLDELNFTNPLGMKGEIAEAYADVIKQMWSGRHYSVVPRVFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKNKEYIELRDADGRPDQEVAGEAWRNHRRRNDSVIVDKFHGLFKSTLVCPECHKVSVTFDPFCYLSVPLPVSKERVMEVFFVFLDPHAKPVQHRVVVPKAGKVSDLCAALSDMT-SVAPTQMVVADVFNHRFYKIYNADESLSCILDRDDIFVYELAQGPQEEQVLLALYLRERSHYRDYGSGSSSYGTSLFGHPLLLNVPQSSCSREELYSLFLQRL 570          

HSP 2 Score: 154.451 bits (389), Expect = 5.936e-38
Identity = 79/190 (41.58%), Postives = 113/190 (59.47%), Query Frame = 2
Query: 1925 LILDWSKEGKEKFYDP-DFEIPESHPSMNM--QHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            + +DW  + K++FY+  + E    H SM +  Q   + ++ C+  F   E L   + WYC +CK  + ATKK DLW LP+VLI+HLKRF    + R+K+D+ V+FPL DLD S F+      +E+   +     YDL+AVSNH GGL  GHYT++A N  ++ WY FDDS  +  + D + T  AYVL Y
Sbjct:  780 VAIDWDPDMKKRFYNENEAEKYVKHSSMEVPQQQATVQLQECIELFTTVETLEEENPWYCPVCKKHQLATKKLDLWSLPEVLIIHLKRFSYTKFTREKLDSIVDFPLRDLDFSDFLLRKSLSSEEPPSR-----YDLIAVSNHYGGLRDGHYTSYAKNKDNAQWYYFDDSKVTYASEDQIMTNAAYVLFY 964          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp4 (ubiquitin specific peptidase 4 [Source:NCBI gene;Acc:101173051])

HSP 1 Score: 317.39 bits (812), Expect = 4.728e-93
Identity = 204/603 (33.83%), Postives = 303/603 (50.25%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR-----SIETKNATDIPKIP----NSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVT---------------------KLISGGNSRQSDGRV-----------------------------QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            LK  D+WFLID  W  +W +     S +  N  +    P    NS L +D E  +    +I   DY L+P E WN +V  YG         R VVE H   +    VEV  ++L +      +  VT+ FS+  T++ I +     F +   K  R+  K M N    + K D  +   DAGL  G+ + I+ ++ D  W    S  +S T                        + G+S  S G                                G+CGL NLGNTCFMNSA+QC+SN PPLT YF+  +++ ++N  NPLGM G +AE Y  L++QMW+   +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYL   D++ +  +  A+EAWK H++RNDSVIV+ FHGL KST+VCP C  VSVTFD F  L+LPL +   +   +    SD   K  + + +V K  TV D    + +L   +    +   ++  +R  ++Y   D  N + + +++ VYE+   D++   + + +R    ++         FG P++++V +  +    L ++I +R+
Sbjct:   84 LKKGDEWFLIDSRWFKQWKKYVGFDSWDMYNVGERSLYPGPIDNSGLFSDQETQALKEHLIDELDYVLVPTEAWNKLVSWYGCLEGQRPIVRKVVE-HGMFVKHCKVEVYLLELNLCENDNMDNVVTRHFSKADTIDTIEKEMRTLFEIPSEKETRLWNKYMSNTYEQLNKPDSTVQ--DAGLFQGQVLVIERRNEDGTWPRQASHPKSSTTPSRNFSTSPKLSSNSSMSISPTATNGDSSCSPGYTLNNSSTSSSNRLGSYNSYNSYSYRESQAQPGLCGLSNLGNTCFMNSALQCLSNAPPLTEYFLDDQYEAEINRENPLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLALRDAEGREDEIVAKEAWKNHRLRNDSVIVDIFHGLFKSTLVCPVCSKVSVTFDPFCYLTLPLPMKKDRTMEVFLVRSDPQSKPTQYRAVVPKLGTVADLCSALSKLC-GIPPENMVVADVYNHRFHKIYRRDDGLNQIMEKDDIFVYEVQEEDSERMNLPVYLRERQSKHAASSSSTLLFGQPLLITVPRHNLTADVLYDKILERI 682          

HSP 2 Score: 162.54 bits (410), Expect = 1.928e-40
Identity = 93/215 (43.26%), Postives = 124/215 (57.67%), Query Frame = 2
Query: 1853 STSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR---PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
             T+ +  +  E  +  L  H    + +DW  E K+ FYD  + E  E H SM    +    + + +C+  F   E LG +D WYC  CK  + ATKKFDLW LP++L++HLKRF      RDK+DT V+FP+ DL++S+FV D          +    IYDL+AVSNH GG+GGGHYTA+A N +D  WY FDDS  S    D + TK AYVL Y
Sbjct:  779 GTANISSLPCEGNVLKLNPH--STIAIDWDTESKKLFYDEQEAEAYEKHESMLQPQKKKTTVALRDCIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTVVDFPIRDLNMSEFVCDP---------KASPYIYDLIAVSNHYGGMGGGHYTAYAKNKLDGKWYYFDDSSVSSATDDQIVTKAAYVLFY 982          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp4 (ubiquitin specific peptidase 4 [Source:NCBI gene;Acc:101173051])

HSP 1 Score: 317.39 bits (812), Expect = 6.313e-93
Identity = 204/603 (33.83%), Postives = 303/603 (50.25%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSR-----SIETKNATDIPKIP----NSRLLNDNEVSS---DIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLI----VEVEPIKLTISIYGKENKAVTK-FSRCKTLNDIYQYAMNKFAVT--KPLRILQK-MDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVT---------------------KLISGGNSRQSDGRV-----------------------------QGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSD--KKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQY---------FGWPIMVSVCKEEIDWYSLKNRIFQRL 1732
            LK  D+WFLID  W  +W +     S +  N  +    P    NS L +D E  +    +I   DY L+P E WN +V  YG         R VVE H   +    VEV  ++L +      +  VT+ FS+  T++ I +     F +   K  R+  K M N    + K D  +   DAGL  G+ + I+ ++ D  W    S  +S T                        + G+S  S G                                G+CGL NLGNTCFMNSA+QC+SN PPLT YF+  +++ ++N  NPLGM G +AE Y  L++QMW+   +Y  PR FK +V +FAPQFSGY Q DSQEL+ FLLDGLHEDLNR++KKPYL   D++ +  +  A+EAWK H++RNDSVIV+ FHGL KST+VCP C  VSVTFD F  L+LPL +   +   +    SD   K  + + +V K  TV D    + +L   +    +   ++  +R  ++Y   D  N + + +++ VYE+   D++   + + +R    ++         FG P++++V +  +    L ++I +R+
Sbjct:   84 LKKGDEWFLIDSRWFKQWKKYVGFDSWDMYNVGERSLYPGPIDNSGLFSDQETQALKEHLIDELDYVLVPTEAWNKLVSWYGCLEGQRPIVRKVVE-HGMFVKHCKVEVYLLELNLCENDNMDNVVTRHFSKADTIDTIEKEMRTLFEIPSEKETRLWNKYMSNTYEQLNKPDSTVQ--DAGLFQGQVLVIERRNEDGTWPRQASHPKSSTTPSRNFSTSPKLSSNSSMSISPTATNGDSSCSPGYTLNNSSTSSSNRLGSYNSYNSYSYRESQAQPGLCGLSNLGNTCFMNSALQCLSNAPPLTEYFLDDQYEAEINRENPLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLALRDAEGREDEIVAKEAWKNHRLRNDSVIVDIFHGLFKSTLVCPVCSKVSVTFDPFCYLTLPLPMKKDRTMEVFLVRSDPQSKPTQYRAVVPKLGTVADLCSALSKLC-GIPPENMVVADVYNHRFHKIYRRDDGLNQIMEKDDIFVYEVQEEDSERMNLPVYLRERQSKHAASSSSTLLFGQPLLITVPRHNLTADVLYDKILERI 682          

HSP 2 Score: 162.54 bits (410), Expect = 1.963e-40
Identity = 93/215 (43.26%), Postives = 124/215 (57.67%), Query Frame = 2
Query: 1853 STSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDP-DFEIPESHPSMNMQHR---PLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
             T+ +  +  E  +  L  H    + +DW  E K+ FYD  + E  E H SM    +    + + +C+  F   E LG +D WYC  CK  + ATKKFDLW LP++L++HLKRF      RDK+DT V+FP+ DL++S+FV D          +    IYDL+AVSNH GG+GGGHYTA+A N +D  WY FDDS  S    D + TK AYVL Y
Sbjct:  803 GTANISSLPCEGNVLKLNPH--STIAIDWDTESKKLFYDEQEAEAYEKHESMLQPQKKKTTVALRDCIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTVVDFPIRDLNMSEFVCDP---------KASPYIYDLIAVSNHYGGMGGGHYTAYAKNKLDGKWYYFDDSSVSSATDDQIVTKAAYVLFY 1006          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000021124.1 (SMESG000021124.1)

HSP 1 Score: 1693.32 bits (4384), Expect = 0.000e+0
Identity = 813/816 (99.63%), Postives = 815/816 (99.88%), Query Frame = 2
Query:  119 MSKDDAHYFELAKQKSLKLNDKWFLIDKVWHHKWSRSIETKNATDIPKIPNSRLLNDNEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVTKFSRCKTLNDIYQYAMNKFAVTKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLSQDLNEDSAMDTDE 2566
            MSKDDAHYFELAKQKSLKLNDKWFLIDKVWHHKWSRSIETKNATDIPKIPNSRLLNDNEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVTKFSRCKTLNDIYQYAMNKFAVTKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRPLD+ENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTA+ANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLSQDLNEDS MDTDE
Sbjct:    1 MSKDDAHYFELAKQKSLKLNDKWFLIDKVWHHKWSRSIETKNATDIPKIPNSRLLNDNEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKENKAVTKFSRCKTLNDIYQYAMNKFAVTKPLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRPLDVENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAYANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRYLLSQDLNEDSTMDTDE 816          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039010.1 (SMESG000039010.1)

HSP 1 Score: 497.278 bits (1279), Expect = 3.992e-162
Identity = 306/852 (35.92%), Postives = 463/852 (54.34%), Query Frame = 2
Query:  167 LKLNDKWFLIDKVWHHKWSRSIETKN------ATDIP-KIPNSRLLNDNEVSSDIISNSDYTLIPEETWNFIVDKYG-IDANSELFQRNVVEMHNTLIVEVEPIKLTISIYGKE---NKAVTKFSRCKTLNDIYQYAMNKFAVTKP--LRILQKMDNGAFDVVKLDG-NISIGDAGLSNGEHIFID---------------YQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQG------VCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKK--ILKAKILVSKS---ETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWIHLTMRTVDD-QYFGWPIMVSVCKEEIDWYSL-------KNRIFQRLPFLNQIIGNKSEHNDCIDPKVA-------------------------KIEYDKISPVVKIYLKDKSTSK--LHLIDLESPIKALQTHIRYELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKS 2497
            L L+  WF ID  W  KW + +   N        + P  I N  L+ ++      +   DY ++PE  WN + + YG + ++  +FQR V + +N+L VE+ P+KL   IYG     N     FS    L ++ +Y    + + +    +++Q+ DN +  V+     + ++ DA  +  + I++D               Y +S      G S       L S  +S + D  V G      VCGL NLGNTCFMNSAIQCISNV P+T YF++  W  DLN  NPLGM GR+A  Y  L+ +MW    +Y +PR+FK EVA+FAPQF GY+QHDSQELMMFLLDGLHEDLNRI  KPY+E  +  +QP    AE+ W YH  RN+S+IV+ FHG LKS VVCPDC +VSVTFD F SLSLPL  ++ Q   + F+  D    I++  +L+ K+   E++KDF +K  +      K+ +   +++ +++ R     +     +  +++++YE+ +      +I ++ +      Y   P++V V K +++W++         +R F    F    + + S+  D ID +                           K   +    +  + L++ S++    H I+  S  + L++     ++++WS +G + ++     +  +H + N Q   L IE+C+ +F+  E LG  DLW+C  CK  +AA+KK D+W+LPKVL+LHLKRF++ SY  DKI+  V FP+ +L+LS++V     +         D IYDLVAVSNHMG L GGHY AFA N++DS WY FDDS+TS +    + TK+AYVLVYV++S
Sbjct:   20 LDLSQTWFTIDANWWKKWKKYVNYSNNEQSVIENESPGAINNIELMENDGFKWSALIEYDYEIVPETVWNLLTENYGCMQSDVSIFQRFVYKDNNSLQVELFPLKLKFQIYGDSSDSNPMEESFSSMAKLIEVEKYVQEAYNIPEGAIFQLIQEFDNESLHVIHCSAESTTLSDARFTPSQKIYVDVRNSLGEFAFKENRLYGNSSGAVKGGSSSVVYGPYLPSSPSSFKVDETVNGTRYTPGVCGLSNLGNTCFMNSAIQCISNVYPITDYFLRNSWTSDLNKDNPLGMEGRIATAYANLIREMWSGKVSYALPREFKYEVAQFAPQFCGYSQHDSQELMMFLLDGLHEDLNRITNKPYVEQKNQTNQPDHILAEQNWDYHLRRNNSIIVDYFHGQLKSKVVCPDCNFVSVTFDPFASLSLPLRHSYYQ--PVIFFPIDPAMPIVELSVLIYKNISLESLKDFAEKQIKW---NTKNEIIMAQVKKSKIFRYLKENELMPNTQLDDHIILYEVNALQPDHHYIDISFKEKSMYSYCSLPMIVQVHK-KLNWHNFLLAIKLQMSRFFNESGFSGDNLFDFSDKIDFIDNQPMTDDSNDNISDFDKSESVSNSSIESLKTNNNPFENIFSVVLRENSSTSTNYHEINPLSRNRLLKSGADQHIVIEWSADGMKDYHKG---VSRNHINCNQQIPKLTIEDCLKQFLCEEHLGQKDLWFCPKCKKDEAASKKLDIWRLPKVLVLHLKRFKATSYFGDKINNEVLFPIKNLNLSQYVPKVKNE--------NDYIYDLVAVSNHMGCLAGGHYFAFAKNYLDSRWYKFDDSNTSCVDESEIVTKSAYVLVYVARS 854          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000062710.1 (SMESG000062710.1)

HSP 1 Score: 296.59 bits (758), Expect = 4.523e-84
Identity = 225/741 (30.36%), Postives = 351/741 (47.37%), Query Frame = 2
Query:  503 FSRCKTLNDIYQYAMNKFAVTKP-LRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGKSKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKP-YLESSDSDDQPVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTHPQLFNIKFYSSDKKILKAK-ILVSKSETVKDFLDKIKELFPEVAKSYLTAIEIQANRLSRVYFPQDS--------ANILKDVENLMVYELPSSDNKDE-----------------WIHLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSEHNDCIDPKVAKIEYDKISPVVKI--YLKDKSTSKLHLIDLESPIKALQTHIRYELILDWSK-------------------EGKEKFYDPDFEIPESHPSMNMQ------------------HRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVS----------DAHRDAEDHNFQNGDE---IYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            FS    + D+ +    K  + +  +RI + +D     ++  D +  + D  L N + I ++ ++ D  W     +   +  L S  N + S  +  GV GL N+GNTCF NSAIQCISN   LT YFI+     ++N TNP G  G +A RY +L++ +W    N  VP   K+ + K+A QFSG  QHD+QEL+  LLD LHEDLNRI  KP Y E  DS+ +   + A+EAW+ H   N S++V+ FHGLLKS V C  CK  SV FDA+  LSLP+ +   Q F I  +     I K   +L +  ++   F+ +       V  + +  + I+ N++ +   P D         A I +D E   + +  SS +  E                 +     RTV  + FG+PI+++V K++I    + N+  Q    +  I+ N+  H+         ++ +   P++K    L   S ++ H   L      + ++I++  I  WS                       E+++  D+ +   H S N++                  ++P+D+  C+  F   E L  + L+ C  CK  + A KK DLW LP +LI+HLKRF+    R  K    V +P+ +LDL+KF+             H  +E +  Q GDE   IY+L A++ H+G L  GHY  +A N   + WYLF+DS   ++    +    AY+L Y
Sbjct:  687 FSHRTRITDLIELLSKKLNINREEMRIWKVIDENNLTLID-DEDKLLQDLCLRNFDKILVEQRNIDLTW---PEELNQLVTLKSLQNRKASVSK--GVTGLSNIGNTCFFNSAIQCISNTNILTEYFIRDVHLCEINKTNPQGCQGIVALRYGELIKDIWTGSTNLIVPLKLKMTMDKYAKQFSGNQQHDAQELLSVLLDALHEDLNRIDAKPSYRELKDSNGRHDDEVAQEAWQAHIATNFSIVVDLFHGLLKSNVCCDICKTNSVRFDAYSMLSLPIPMQLNQDFEILVFERLSAIPKKYCVLFNTIDSTSSFICEQVSRQLSVEPNSILLVSIEDNKIKKFLNPNDRIYLTQTLYAYIFEDTECSEINKNGSSPSTQENLIKFVIYHRKLIQKANYFMAHSRTV-TELFGYPIVLTVRKDDI--AEITNQDIQDK--VAHILNNQIFHSHVYPADQVSVKQNSPIPIIKPNHALDCDSVNQRHPFVLAQ----VNSNIKHCSICHWSNFCNGCPLPNNSDAYNTVGTFNDEQYFAIDWSMAALHLSSNIKFEKKFLSDDKNKNAKSTANQPMDLIKCIESFTTQEMLDKDTLYQCFKCKKPQRAYKKLDLWTLPPILIIHLKRFQFLDKRWQKSHKTVRYPVRNLDLNKFIQRDNNNNVTNNSDHSSSETNRTQPGDENDAIYNLYAINCHLGSLQMGHYVTYALNKESNKWYLFNDSICKEVDEKEITMSCAYLLFY 1412          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000020277.1 (SMESG000020277.1)

HSP 1 Score: 160.229 bits (404), Expect = 5.873e-40
Identity = 82/187 (43.85%), Postives = 108/187 (57.75%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQ-KKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTH 1345
            G+ GL N+GNTC+MNS +Q +SN   LT Y +   ++ D+N  NPLG  G +   +  L+  +W        P DFK  +      F G  QHDSQE ++FLLDGLHEDLNR  K   +    ++D+    ++A ++WK H   NDSVIV  F G  +S V C  C+  SVTFDAF  LSLPLV  H
Sbjct:  627 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQEFLLFLLDGLHEDLNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANH 813          

HSP 2 Score: 117.857 bits (294), Expect = 1.328e-26
Identity = 57/164 (34.76%), Postives = 88/164 (53.66%), Query Frame = 2
Query: 2015 HRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQ 2506
            H    +E+C+  F+  E++     W+C  CK  + A KK D+W+LP  L++HLKRF      R K++TFV+FP+    L   +    +  + H      + Y L AVSNH G +  GHYT+F  N   + W+ +DD   +KI    V+T + Y+L Y S ++ Q
Sbjct:  813 HNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHT-KQPQKH------DTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLKQ 969          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000053081.1 (SMESG000053081.1)

HSP 1 Score: 135.961 bits (341), Expect = 7.237e-33
Identity = 75/186 (40.32%), Postives = 111/186 (59.68%), Query Frame = 2
Query:  788 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGC-NYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKP-YLESSDSDDQPVQKK--AEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPL 1333
            G+ GL NLGNTCFMNS +QC+SN  PL  Y +  +++ DLN  +    +G L + Y +L++ +W     +Y  P  FK    K AP F   +Q DSQE +  +L+GLH+D+N++++K   +  +D + + +  K  AE  W  +   +DS IV+ F G LKST+ C  C Y S+TFD F  LSLP+
Sbjct:  278 GLVGLVNLGNTCFMNSVLQCLSNCKPLQEYCLSNKYEADLNPNS--KSNGSLFKSYAELMKSIWKSDSESYVSPDKFKRIFQKLAPAFHVTSQQDSQEFLRLMLEGLHQDVNKVRRKSKSIPITDEESEKLSDKELAELYWGRYIKVDDSFIVDLFVGQLKSTLRCNKCGYRSITFDPFWDLSLPI 461          

HSP 2 Score: 115.161 bits (287), Expect = 3.259e-26
Identity = 63/174 (36.21%), Postives = 96/174 (55.17%), Query Frame = 2
Query: 1964 YDPDFEIPESHPSMNMQHRPLDIENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVY 2485
            +DP +++    P +N     + + +C++ F   E L  +++  C  CK ++  TK+F + + P VL++HLKRF SG   R KI +F+EFP  +L+L  +       AE   F      Y+L AVSNH G + GGHYTA+  N    NWY +DD+   K+   +V +  AYVL Y
Sbjct:  451 FDPFWDLSLPIPKINRNQ--ISLTDCLSLFTSEEILDGDEMPKCFKCKTKRPCTKRFSIHKFPSVLVIHLKRF-SGDRYRSKISSFIEFPTRNLNLQSY-------AEPSTF----ATYNLYAVSNHSGTVDGGHYTAYCCNPSSKNWYKYDDTRVYKVNETNVCSTEAYVLFY 610          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP41.300e-14433.91ubiquitin specific peptidase 4 [Source:HGNC Symbol... [more]
USP49.188e-14132.75ubiquitin specific peptidase 4 [Source:HGNC Symbol... [more]
USP44.116e-10635.08ubiquitin specific peptidase 4 [Source:HGNC Symbol... [more]
USP116.297e-10035.47ubiquitin specific peptidase 11 [Source:HGNC Symbo... [more]
USP111.907e-9935.47ubiquitin specific peptidase 11 [Source:HGNC Symbo... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H34C03.21.112e-6635.04Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
H34C03.21.762e-6054.64Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
F07A11.43.284e-4840.80Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
F07A11.43.641e-4840.80Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
cyk-31.035e-4325.30Ubiquitin carboxyl-terminal hydrolase cyk-3 [Sour... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp15-317.041e-5124.78gene:FBgn0050421 transcript:FBtr0072369[more]
Usp15-317.514e-5124.78gene:FBgn0050421 transcript:FBtr0343495[more]
Usp15-317.514e-5124.78gene:FBgn0050421 transcript:FBtr0343494[more]
Usp323.533e-4836.30gene:FBgn0036913 transcript:FBtr0332150[more]
Usp323.793e-4835.71gene:FBgn0036913 transcript:FBtr0332148[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp116.533e-10535.92ubiquitin specific peptidase 11 [Source:ZFIN;Acc:Z... [more]
usp112.028e-10135.38ubiquitin specific peptidase 11 [Source:ZFIN;Acc:Z... [more]
usp41.300e-9433.33ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
usp321.261e-5735.05ubiquitin specific peptidase 32 [Source:ZFIN;Acc:Z... [more]
usp321.277e-5735.05ubiquitin specific peptidase 32 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fchsd28.340e-12734.24FCH and double SH3 domains 2 [Source:Xenbase;Acc:X... [more]
fchsd25.423e-9337.38FCH and double SH3 domains 2 [Source:Xenbase;Acc:X... [more]
USP41.449e-9034.11ubiquitin specific peptidase 4 [Source:NCBI gene;A... [more]
USP41.558e-9034.00ubiquitin specific peptidase 4 [Source:NCBI gene;A... [more]
fchsd28.182e-9035.71FCH and double SH3 domains 2 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp47.990e-14834.15ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
Usp46.962e-14532.97ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
Usp112.051e-9734.95ubiquitin specific peptidase 11 [Source:MGI Symbol... [more]
Usp159.753e-9237.60ubiquitin specific peptidase 15 [Source:MGI Symbol... [more]
Usp46.050e-9132.32ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35123|UBP4_MOUSE4.870e-14432.97Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus mus... [more]
sp|B2GUZ1|UBP4_RAT1.082e-14332.78Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus ... [more]
sp|Q13107|UBP4_HUMAN4.413e-14032.75Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sa... [more]
sp|Q5RCD3|UBP4_PONAB1.469e-13832.64Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo a... [more]
sp|Q9ZSB5|UBP10_ARATH5.164e-12631.39Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabid... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TVW02.425e-15135.46Ubiquitin carboxyl-terminal hydrolase OS=Capitella... [more]
H3DBW03.356e-15033.57Ubiquitin carboxyl-terminal hydrolase OS=Tetraodon... [more]
A0A3B3QW561.692e-14835.75Ubiquitin carboxyl-terminal hydrolase OS=Paramormy... [more]
A0A3P9KCG41.919e-14836.87Ubiquitin carboxyl-terminal hydrolase OS=Oryzias l... [more]
A0A3Q0CE205.344e-14834.08Ubiquitin carboxyl-terminal hydrolase OS=Mesocrice... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp42.400e-12440.28ubiquitin specific peptidase 4 [Source:NCBI gene;A... [more]
usp116.422e-9936.65keratin, type II cytoskeletal cochleal-like [Sourc... [more]
usp42.571e-9433.77ubiquitin specific peptidase 4 [Source:NCBI gene;A... [more]
USP151.221e-9135.14ubiquitin specific peptidase 15 [Source:NCBI gene;... [more]
USP152.821e-8933.62ubiquitin specific peptidase 15 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp48.530e-9033.50ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
ENSPMAT00000001826.11.019e-7535.43pep scaffold:Pmarinus_7.0:GL478831:2528:40053:1 ge... [more]
usp322.751e-5530.04ubiquitin specific peptidase 32 [Source:ZFIN;Acc:Z... [more]
usp323.102e-5530.04ubiquitin specific peptidase 32 [Source:ZFIN;Acc:Z... [more]
usp2b3.711e-4241.21ubiquitin specific peptidase 2b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBP122.909e-5031.72Ubiquitin-specific protease; cleaves ubiquitin fro... [more]
DOA46.769e-2433.16Ubiquitin hydrolase; deubiquitinates intralumenal ... [more]
UBP51.602e-2031.12Putative ubiquitin-specific protease; concentrates... [more]
UBP81.591e-1934.81Ubiquitin-specific protease component of the SAGA ... [more]
UBP72.063e-1528.27Ubiquitin-specific protease that cleaves ubiquitin... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444542.699e-13133.19Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO347544.354e-8630.96Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO399054.879e-5832.89Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO445025.013e-5829.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348371.579e-4042.16Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp111.420e-14834.01ubiquitin carboxyl-terminal hydrolase 11 [Source:N... [more]
usp41.464e-14334.57ubiquitin specific peptidase 4 [Source:NCBI gene;A... [more]
usp113.155e-10235.02ubiquitin carboxyl-terminal hydrolase 11 [Source:N... [more]
usp44.728e-9333.83ubiquitin specific peptidase 4 [Source:NCBI gene;A... [more]
usp46.313e-9333.83ubiquitin specific peptidase 4 [Source:NCBI gene;A... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021124.10.000e+099.63SMESG000021124.1[more]
SMESG000039010.13.992e-16235.92SMESG000039010.1[more]
SMESG000062710.14.523e-8430.36SMESG000062710.1[more]
SMESG000020277.15.873e-4043.85SMESG000020277.1[more]
SMESG000053081.17.237e-3340.32SMESG000053081.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005346 ID=SMED30005346|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=2760bp
CATTGACAAAGTATATAATTAATTGAAATAGTTGATTCTAAATAATTTTA
ATTTAAATATTTATTTTTCTGAAATTTAGACCTTAAAAAAATATTTGTAC
AAATCTTCTTATTTAATAATGTCAAAAGATGATGCTCATTATTTTGAATT
GGCTAAGCAGAAATCATTGAAACTTAATGATAAATGGTTCCTTATTGATA
AAGTTTGGCACCATAAATGGAGTAGAAGTATTGAAACTAAAAATGCCACA
GATATTCCTAAAATACCAAATTCTCGACTACTAAATGATAATGAAGTTAG
TAGTGACATTATTAGTAATTCGGATTATACATTAATACCAGAAGAAACAT
GGAATTTTATAGTCGATAAATATGGAATTGATGCAAATTCAGAACTGTTT
CAAAGAAATGTTGTTGAAATGCACAATACACTGATTGTAGAAGTTGAGCC
AATCAAATTAACAATATCAATTTACGGAAAAGAGAACAAAGCTGTCACTA
AATTTTCACGTTGTAAAACTCTAAACGACATCTATCAATACGCAATGAAC
AAATTTGCAGTGACGAAACCTTTGAGAATATTACAAAAAATGGATAACGG
TGCATTTGATGTAGTAAAGTTAGATGGCAATATTAGTATTGGTGATGCTG
GTTTGTCGAATGGAGAACATATTTTCATTGATTACCAGGATTCAGATCAT
CAATGGATGAACGGTAAATCGAAACAGCGGTCAGTAACGAAGTTAATTTC
TGGTGGAAATTCTAGACAAAGTGACGGTCGTGTTCAAGGGGTCTGTGGCC
TCTGTAATTTAGGAAATACTTGTTTTATGAACAGTGCTATACAATGCATT
AGTAATGTTCCTCCGTTGACCTATTATTTTATTAAAACCGAATGGAAAAA
AGACTTAAATACAACAAATCCACTGGGAATGCATGGCAGATTAGCTGAAC
GTTATCATCAATTACTCGAACAAATGTGGGTAAAAGGATGTAACTACACA
GTTCCTCGCGATTTCAAAGTAGAAGTAGCGAAATTTGCCCCTCAATTTTC
CGGTTATGCACAACATGACTCACAAGAATTGATGATGTTCCTATTGGACG
GTTTGCATGAAGATCTAAACCGTATTCAGAAAAAACCCTATCTAGAATCT
AGCGATTCAGACGATCAACCCGTTCAAAAGAAAGCCGAAGAAGCTTGGAA
ATATCACAAAATGAGAAACGATTCTGTGATTGTAGAGAATTTTCATGGAT
TATTGAAATCAACTGTTGTTTGTCCTGATTGTAAATATGTTTCTGTGACT
TTCGATGCTTTTGGATCTCTGAGTTTACCCCTGGTTCTTACTCATCCTCA
ATTATTCAATATCAAATTTTACAGTTCCGACAAAAAAATTCTCAAAGCAA
AAATACTCGTATCAAAATCCGAGACAGTTAAAGATTTCCTAGATAAAATC
AAAGAATTGTTTCCGGAAGTTGCTAAGTCATATCTAACAGCCATTGAAAT
CCAAGCTAATCGTCTTTCTCGCGTTTATTTTCCCCAAGATTCCGCGAATA
TTCTTAAAGATGTTGAGAATCTTATGGTTTATGAGCTTCCTAGTTCTGAT
AATAAAGACGAATGGATTCATTTGACAATGCGTACAGTGGACGATCAGTA
TTTCGGCTGGCCAATAATGGTCTCGGTTTGCAAAGAGGAAATCGACTGGT
ACAGTTTGAAAAATCGAATTTTCCAACGTCTACCATTTCTCAACCAAATA
ATCGGCAACAAATCAGAACATAACGACTGCATTGATCCTAAAGTAGCCAA
GATCGAATACGATAAAATATCCCCAGTGGTCAAGATCTACCTGAAAGACA
AATCAACTTCGAAATTACACCTAATCGATCTAGAATCACCGATTAAAGCT
TTACAAACCCATATCAGATACGAGCTCATATTGGATTGGTCGAAAGAAGG
CAAAGAAAAGTTTTACGATCCTGATTTTGAAATTCCCGAGTCTCACCCGT
CAATGAATATGCAACATCGGCCATTGGACATAGAGAATTGTGTGAACGAG
TTTATTAGAACGGAAAAACTCGGCATTAACGATTTGTGGTACTGTAAAAT
GTGCAAAGACCAAAAAGCGGCCACGAAGAAATTCGATCTTTGGCAATTAC
CGAAAGTTTTGATTTTGCATTTGAAACGATTTCGATCCGGATCATATCGA
CGAGACAAAATCGATACTTTCGTTGAATTTCCATTAACTGATTTAGATTT
ATCTAAATTTGTTTCCGATGCTCACAGAGATGCCGAGGATCATAATTTTC
AAAACGGGGATGAAATTTATGATTTAGTAGCAGTCAGCAACCACATGGGC
GGCCTTGGTGGGGGACATTATACTGCTTTTGCTAACAATTTCATTGATAG
CAACTGGTATCTGTTTGATGATTCTCATACGTCCAAAATCGCTTCGGATA
GTGTCCAGACCAAAACCGCCTACGTGCTCGTATATGTCAGCAAATCCGTG
TTGCAGCAGACGAGATATTTGCTGAGCCAGGACCTGAATGAGGATTCCGC
CATGGATACCGATGAATGATGAAGGTGTGATACCAGGATACCGGGTGGGT
TACCCCAGAGATAATACTAATAATTGTTTTATAATTATTAATAATAGTGT
TTCGGTCGTGGATTTGACAACTTTAAATAAATTATGATAAATTGTTATTT
GTTATAATTTGCTTTCAATTATCTGACCGAGTTGTGTTTTTATTTCTTGG
AACAATTACA
back to top

protein sequence of SMED30005346-orf-1

>SMED30005346-orf-1 ID=SMED30005346-orf-1|Name=SMED30005346-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=817bp
MSKDDAHYFELAKQKSLKLNDKWFLIDKVWHHKWSRSIETKNATDIPKIP
NSRLLNDNEVSSDIISNSDYTLIPEETWNFIVDKYGIDANSELFQRNVVE
MHNTLIVEVEPIKLTISIYGKENKAVTKFSRCKTLNDIYQYAMNKFAVTK
PLRILQKMDNGAFDVVKLDGNISIGDAGLSNGEHIFIDYQDSDHQWMNGK
SKQRSVTKLISGGNSRQSDGRVQGVCGLCNLGNTCFMNSAIQCISNVPPL
TYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFK
VEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQ
PVQKKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGS
LSLPLVLTHPQLFNIKFYSSDKKILKAKILVSKSETVKDFLDKIKELFPE
VAKSYLTAIEIQANRLSRVYFPQDSANILKDVENLMVYELPSSDNKDEWI
HLTMRTVDDQYFGWPIMVSVCKEEIDWYSLKNRIFQRLPFLNQIIGNKSE
HNDCIDPKVAKIEYDKISPVVKIYLKDKSTSKLHLIDLESPIKALQTHIR
YELILDWSKEGKEKFYDPDFEIPESHPSMNMQHRPLDIENCVNEFIRTEK
LGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDT
FVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGH
YTAFANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQQTRY
LLSQDLNEDSAMDTDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR035927DUSP-like_sf
IPR038765Papain-like_cys_pep_sf
IPR006615Pept_C19_DUSP
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006615Peptidase C19, ubiquitin-specific peptidase, DUSP domainSMARTSM00695duspcoord: 16..102
e-value: 6.3E-13
score: 58.9
IPR006615Peptidase C19, ubiquitin-specific peptidase, DUSP domainPFAMPF06337DUSPcoord: 20..92
e-value: 7.6E-12
score: 45.7
IPR006615Peptidase C19, ubiquitin-specific peptidase, DUSP domainPROSITEPS51283DUSPcoord: 1..99
score: 13.327
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 226..789
e-value: 4.9E-74
score: 249.1
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 112..199
e-value: 1.7E-6
score: 29.8
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 221..447
e-value: 6.1E-70
score: 238.0
coord: 599..799
e-value: 1.8E-55
score: 190.5
NoneNo IPR availableGENE3DG3DSA:3.30.2230.10coord: 2..110
e-value: 2.7E-18
score: 67.5
NoneNo IPR availablePANTHERPTHR21646:SF29UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 11coord: 629..799
coord: 43..498
NoneNo IPR availablePANTHERPTHR21646FAMILY NOT NAMEDcoord: 629..799
coord: 43..498
NoneNo IPR availableCDDcd02674Peptidase_C19Rcoord: 627..789
e-value: 1.13307E-49
score: 172.472
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00972USP_1coord: 227..242
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00973USP_2coord: 734..751
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 226..792
score: 51.447
IPR035927DUSP-like superfamilySUPERFAMILYSSF143791DUSP-likecoord: 13..99
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 223..790