SMED30005345

Overview
NameSMED30005345
Smed IDSMED30005345
Length (bp)374
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005345 (SMED30005345) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005345 (SMED30005345) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005345 (SMED30005345) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005345 (SMED30005345) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005345

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005345SMESG000059907.1 dd_Smed_v4_125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005345SMESG000059907.1 dd_Smed_v4_125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005345SMESG000059907.1 dd_Smed_v4_125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005345SMESG000059907.1 dd_Smed_v4_125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005345SMESG000059907.1 dd_Smed_v4_125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005345SMESG000059907.1 dd_Smed_v4_125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005345SMESG000059907.1 Contig12534newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005345SMESG000059907.1 Contig12534uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005345SMESG000059907.1 Contig50535newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005345SMESG000059907.1 Contig50535uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005345SMESG000059907.1 Contig51225newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005345SMESG000059907.1 Contig51225uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30005345SMESG000059907.1 dd_Smed_v6_125_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30005345SMESG000059907.1 dd_Smed_v6_125_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005345SMESG000059907.1 dd_Smed_v6_125_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30005345SMESG000059907.1 dd_Smed_v6_125_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30005345 vs. Ensembl Zebrafish
Match: ahnak (AHNAK nucleoprotein [Source:ZFIN;Acc:ZDB-GENE-030131-8719])

HSP 1 Score: 44.669 bits (104), Expect = 7.142e-6
Identity = 41/125 (32.80%), Postives = 65/125 (52.00%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPSFGGK-VKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            +D ++ GP +  + D+  PK + D K   DVDV    +D++G + K  G    F MPSF G  +  P  ++D +I GP +  +VD+  PK   D+K        I+L+G   +  G + GF MP+
Sbjct: 3654 VDFNLKGPKLKGDFDVSVPKVEGDFKAP-DVDVKTPKVDMEGPEGKFKGPK--FQMPSFSGPNISMP--DVDFNIKGPKLKGDVDVSVPKVQGDIKAP-----KIELEGPDIE--GPEGGFKMPN 3766          
BLAST of SMED30005345 vs. TrEMBL
Match: T1G8K5 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20217402 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.237e-7
Identity = 52/122 (42.62%), Postives = 72/122 (59.02%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKG-HGDV-DVDIDLDGKKKKHGGIDLGF 360
            KGEID+++  P  D NVD   P AD++LKG      D++L G K   GG  +G  MP FG K K PKG++D+D+     +  VD+  P+A+LDLKG  G++ D DI++   K K GG   G 
Sbjct:  266 KGEIDMNL--PEGDLNVDAHLPDADVNLKGPKTEVPDVNLKGPKA-SGGFHIG--MPKFGVKGKVPKGDVDVDL----PEGGVDVNLPEANLDLKGPKGELPDADINVKAPKGK-GGFHFGL 377          

HSP 2 Score: 56.9954 bits (136), Expect = 8.273e-7
Identity = 51/135 (37.78%), Postives = 78/135 (57.78%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDA--NVDIKKPKADLDLKGH---GDVDV-DIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDI--GGPNI---DANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            +G +D D+  PN++A  N  +  PK ++ +KG     D++V D++L G K   GG  +G  MP FG K K PKG++D+D+  GG ++   +AN+D+K PK DL++  H   D D++L G K   G       MPS
Sbjct:   47 EGGVDADVSLPNVEADLNAGVSLPKGEVGIKGELPDADINVPDVNLKGPKA-SGGFHIG--MPKFGVKGKVPKGDVDVDLPEGGVDVNLPEANLDLKGPKGDLNVDAH-LPDADVNLKGPKSSGG---FNIKMPS 174          
BLAST of SMED30005345 vs. TrEMBL
Match: A0A3B5R4P7 (PDZ domain-containing protein OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.047e-6
Identity = 53/129 (41.09%), Postives = 76/129 (58.91%), Query Frame = 1
Query:    7 EIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPS 372
            ++DI++ GP ++ +VD+  PK   DLKG  +VD+   DID++G K   GG+ +  F MPSFG KV K        + GP++D N+    PKAD+D+K   DVD+   D+D+ G   K  G    FNMPS
Sbjct: 4029 DVDINLKGPMVEGDVDVNLPKIKGDLKGP-EVDIEGPDIDIEGPK---GGLKMPKFKMPSFGIKVPK--------LEGPDVDINL----PKADIDVKAP-DVDIEGADLDMKGPNAKLKGPK--FNMPS 4138          

HSP 2 Score: 55.0694 bits (131), Expect = 4.617e-6
Identity = 51/128 (39.84%), Postives = 76/128 (59.38%), Query Frame = 1
Query:    7 EIDIDIGGPNIDANVDIKKPKADLDLKG-HGDVDV-DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPS 372
            ++DI++ GP ++ +VDIK PK   DLKG   D++V D++++G K   GG+ +  F MPSFG K  K        + GP++D N+    PKA++D+K   DVD+   D+D+ G   K  G    FNMPS
Sbjct: 4401 DVDINLKGPKVEGDVDIKMPKIKGDLKGPEVDIEVPDVEIEGPK---GGLKMPKFKMPSFGSKGAK--------LEGPDVDINL----PKAEIDVKAP-DVDIEGADLDIKGPNAKLKGPK--FNMPS 4510          

HSP 3 Score: 54.6842 bits (130), Expect = 5.714e-6
Identity = 51/129 (39.53%), Postives = 76/129 (58.91%), Query Frame = 1
Query:    7 EIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPS 372
            ++DI++ GP ++ +VDIK PK   DLKG  +VD+   D++++G K   GG+ +  F MPSFG K  K        + GP++D N+    PKA++D+K   DVD+   D+D+ G   K  G    FNMPS
Sbjct: 4959 DVDINLKGPKVEGDVDIKMPKIKGDLKGP-EVDIEGPDVEIEGPK---GGLKMPKFKMPSFGSKGAK--------LEGPDVDINL----PKAEIDVKAP-DVDIEGADLDIKGPNAKLKGPK--FNMPS 5068          

HSP 4 Score: 54.6842 bits (130), Expect = 5.825e-6
Identity = 54/129 (41.86%), Postives = 75/129 (58.14%), Query Frame = 1
Query:    7 EIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPS 372
            ++DI++ GP +  +VD+  PK   DLKG  +VD+   D D++G K   GG  +  F MPSFG  +K PKGE      GP++D N+    PKAD+D+K   DVD+   D+D+ G   K  G    FNMPS
Sbjct: 5331 DVDINLKGPKVAGDVDVNLPKIKGDLKGP-EVDIEGPDFDIEGHK---GGFKMPKFKMPSFG--MKGPKGE------GPDVDINI----PKADIDVKAP-DVDIEGADLDIKGPNAKLKGPK--FNMPS 5440          
BLAST of SMED30005345 vs. TrEMBL
Match: A0A0S7F4L9 (AHNK (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=AHNK PE=4 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.264e-6
Identity = 54/129 (41.86%), Postives = 78/129 (60.47%), Query Frame = 1
Query:    7 EIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPS 372
            ++DI++ GP ++ +VD+K PK   DLKG  +VD+   DID++G K   GG+ +  F MPSFG  +K PK E      GP++D N+    PKAD+D+K   DVD+   D+D+ G   K  G    F+MPS
Sbjct:   67 DVDINLKGPKVEGDVDVKMPKIKGDLKGP-EVDIECPDIDIEGPK---GGLKMPKFKMPSFG--LKGPKLE------GPDVDINL----PKADIDVKAP-DVDIEGADLDIKGPNAKLKGPK--FHMPS 176          
BLAST of SMED30005345 vs. TrEMBL
Match: A0A3B5KVE3 (Uncharacterized protein OS=Xiphophorus couchianus OX=32473 PE=4 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 4.626e-6
Identity = 52/128 (40.62%), Postives = 76/128 (59.38%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD---IDLDGKKKKHGGIDLGFNMPS 372
            +DI++ GP ++ ++D+K PK   DLKG  +VD+   D D++G K   GG+ +  F MPSFG  +K PK E      GP++D N+    PKAD+D+K   DVD++   +D+ G   K  G    FNMPS
Sbjct:  172 VDINLKGPKVEGDLDVKMPKIKGDLKGP-EVDIEGPDFDMEGPK---GGLKMPKFKMPSFG--LKGPKVE------GPDVDINL----PKADIDVKAP-DVDIEGAALDIKGPNAKLKGPK--FNMPS 280          
BLAST of SMED30005345 vs. TrEMBL
Match: A0A3B5LMB3 (Uncharacterized protein OS=Xiphophorus couchianus OX=32473 PE=4 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 5.696e-6
Identity = 53/129 (41.09%), Postives = 76/129 (58.91%), Query Frame = 1
Query:    7 EIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPS 372
            ++DI++ GP ++ ++D+  PK   DLKG  +VD+   D D++G K   GG  +  F MPSFG  +K PKGE      GP++D N+    PKAD+D+K   DVD+   D+D+ G   K  G    FNMPS
Sbjct:  252 DVDINLKGPKVEGDLDVNLPKIKGDLKGP-EVDIEGPDFDIEGHK---GGFKMPKFKMPSFG--MKGPKGE------GPDVDINI----PKADIDVKAP-DVDIEGADLDIKGPNAKLKGPK--FNMPS 361          
BLAST of SMED30005345 vs. Ensembl Cavefish
Match: ENSAMXT00000039323.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:37004879:37011933:-1 gene:ENSAMXG00000030707.1 transcript:ENSAMXT00000039323.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.806e-8
Identity = 43/127 (33.86%), Postives = 70/127 (55.12%), Query Frame = 1
Query:   22 IGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGG-KVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLK------GHGDVDV----DIDLDGKKKKHGGIDLGFNMP 369
            + GP++D N+    PK D+DLKG      +ID++G +    G + GF MP+  G K+  P  ++D +IGGP +  +VD+  PK + D+K         ++DV    +ID++G +    G + GF MP
Sbjct:  351 VEGPDVDVNL----PKGDIDLKGP-----EIDIEGPEIDVEGPEGGFKMPTISGPKISMP--DVDFNIGGPKVKGDVDVSVPKIECDIKPPKVDIAGPEIDVEGPEEIDIEGPEIDVEGPEGGFKMP 466          

HSP 2 Score: 45.0542 bits (105), Expect = 4.050e-6
Identity = 49/139 (35.25%), Postives = 73/139 (52.52%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLK------GHGDVDV----DIDLDGKKKKHGGIDLGF-----NMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPS 372
            +D +IGGP +  +VD+  PK + D+K         ++DV    +ID++G +    G + GF      MPSFG   K PK E      GP++D N+    PK D+DLKG   +DV   +ID++G + K  G    F MP+
Sbjct:  403 VDFNIGGPKVKGDVDVSVPKIECDIKPPKVDIAGPEIDVEGPEEIDIEGPEIDVEGPEGGFKMPKIKMPSFG--FKGPKVE------GPDVDVNL----PKGDIDLKGP-RIDVKSPEIDIEGPEGKIKGPK--FKMPT 526          

HSP 3 Score: 44.669 bits (104), Expect = 5.515e-6
Identity = 41/119 (34.45%), Postives = 66/119 (55.46%), Query Frame = 1
Query:   25 GGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMPSFGG-KVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            GGP++D N+    PK D+DLKG   +DV   +ID++G + K  G    F MP+  G K+  P  ++D+++ GP +   VD+  PK + D+K        +D++G +    G + GF MP
Sbjct:  714 GGPDVDVNL----PKGDIDLKGP-RIDVKSPEIDIEGPEGKIKGPK--FKMPTISGPKISMP--DVDLNLKGPKVKGGVDMSVPKIEGDIKAP-----KVDIEGPEIDVEGPEGGFKMP 818          
BLAST of SMED30005345 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004925.1 (pep scaffold:Pmarinus_7.0:GL480373:16762:23670:1 gene:ENSPMAG00000004465.1 transcript:ENSPMAT00000004925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 5.971e-7
Identity = 51/132 (38.64%), Postives = 61/132 (46.21%), Query Frame = 1
Query:   13 DIDIGGPNIDANV----------DIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFG---GKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            D DI  PNI  NV          D+K PK + DL        DIDL G K K    DL   MPSFG    K+  P G+ D+++     DA+++I  PK DLD         DIDL G K K       FNMP
Sbjct:  617 DFDISAPNIGGNVSGPNIDLDGPDLKAPKLNADLDAP-----DIDLKGPKGKFNMPDL--KMPSFGMSKPKISGPDGDFDVNL----PDADLNISGPKLDLDAP-------DIDLKGPKGK-------FNMP 723          
BLAST of SMED30005345 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 48.521 bits (114), Expect = 2.787e-7
Identity = 42/133 (31.58%), Postives = 70/133 (52.63%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D++G     GG   GF MP          G K++KP  E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 1775 VDFNLKGPKVKGDIDASLPKIEGDIKAP-----DLDIEGPDVNIGGTKAGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGRAELDIEGPK---GGFKMPKFKMPT 1896          

HSP 2 Score: 48.521 bits (114), Expect = 2.983e-7
Identity = 46/130 (35.38%), Postives = 71/130 (54.62%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDL-GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E+DI + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 1467 KPEVDIRLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPTFKMPTFGSKGHK--------LEGPDVDINL----PSTDIEVKAP-DVDITAPDVDMKGPDTKFKGPK--FNMP 1577          

HSP 3 Score: 46.2098 bits (108), Expect = 1.649e-6
Identity = 44/127 (34.65%), Postives = 69/127 (54.33%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E DI++ GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 5187 KPEFDINLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGAK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 5297          

HSP 4 Score: 46.2098 bits (108), Expect = 1.852e-6
Identity = 44/130 (33.85%), Postives = 71/130 (54.62%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDL-GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E+D+ + GP +  ++D+K PK + ++K   DVD+   ++D++G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 1095 KPELDLKLKGPKVGGDLDVKAPKIEGEIKTP-DVDIGGAELDIEGPK---GGFKMPTFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDVDMKGPDTKFKGPK--FNMP 1205          

HSP 5 Score: 45.8246 bits (107), Expect = 2.357e-6
Identity = 41/131 (31.30%), Postives = 67/131 (51.15%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            +D+++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E D+ + GP I  ++D+K PK + D+K   DVD+   ++D++G+K        GF MP
Sbjct: 2147 VDLNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKIGGDLDVKAPKIEGDIKAP-DVDIGEAEMDIEGQK-------AGFKMP 2262          

HSP 6 Score: 45.8246 bits (107), Expect = 2.859e-6
Identity = 44/127 (34.65%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   D+D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 4815 KPEFDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGADLDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 4925          

HSP 7 Score: 45.8246 bits (107), Expect = 2.972e-6
Identity = 45/130 (34.62%), Postives = 69/130 (53.08%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D D+ G   K  G    FNMP
Sbjct: 3141 KPEFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGEAELDIEGPK---GGFKMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDFDIKGPDAKFKGPK--FNMP 3251          

HSP 8 Score: 45.4394 bits (106), Expect = 3.089e-6
Identity = 42/124 (33.87%), Postives = 66/124 (53.23%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV-DIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP I  ++D+K PK + D+K   DVD+ + ++D + +K G     F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 2211 KPEFDLKLKGPKIGGDLDVKAPKIEGDIKAP-DVDIGEAEMDIEGQKAGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 2321          

HSP 9 Score: 45.4394 bits (106), Expect = 3.119e-6
Identity = 43/127 (33.86%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 1839 KPEFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGRAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDSKFKGPK--FNMP 1949          

HSP 10 Score: 45.4394 bits (106), Expect = 3.402e-6
Identity = 44/127 (34.65%), Postives = 68/127 (53.54%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            +DI + GP +  ++D+K PK + D+K   DVD+   ++D +G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 1284 VDIKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGGAELDTEGPK---GGFKMPKFKMPTFGSKGHK--------LEGPDVDINL----PSTDIEVKAP-DVDITAPDVDMKGPDTKFKGTK--FNMP 1391          

HSP 11 Score: 45.4394 bits (106), Expect = 3.711e-6
Identity = 43/127 (33.86%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 2769 KPEFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGEAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 2879          

HSP 12 Score: 45.4394 bits (106), Expect = 3.783e-6
Identity = 42/133 (31.58%), Postives = 69/133 (51.88%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E DI++ GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 5123 VDFNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEKP--EFDINLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGAK---GGFKMPKFKMPT 5244          

HSP 13 Score: 45.0542 bits (105), Expect = 4.957e-6
Identity = 46/131 (35.11%), Postives = 72/131 (54.96%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKG-EIDIDIGGPNIDA---NVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E+D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G ++D+++  P+I+     VDI  P  D+D+KG      D  L G K         FNMP
Sbjct: 2025 KPELDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAP--DVDIKGP-----DAKLKGPK---------FNMP 2135          

HSP 14 Score: 45.0542 bits (105), Expect = 5.303e-6
Identity = 46/130 (35.38%), Postives = 69/130 (53.08%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+   GP +  ++D+K P  + DLK   DVD+   ++D++G+K   GG  +  F MP+FG K  K        + GP++D N+    P  D+D+K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 3885 KPEFDLKFKGPKVGGDLDVKVPNIEGDLKTP-DVDIGGAELDIEGQK---GGFRMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIDVK-VPDVDITAPDVDIKGSDAKFKGPK--FNMP 3995          

HSP 15 Score: 44.669 bits (104), Expect = 6.129e-6
Identity = 42/133 (31.58%), Postives = 68/133 (51.13%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E D+ + GP +  ++D+K PK + DLK   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 3449 VDFNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKVPKIEGDLKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPT 3570          

HSP 16 Score: 44.669 bits (104), Expect = 6.432e-6
Identity = 45/130 (34.62%), Postives = 69/130 (53.08%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D D+ G   K  G    FNMP
Sbjct: 3699 KPEFDLKLKGPKVGGDLDVKIPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDFDIKGPDAKFKGPK--FNMP 3809          

HSP 17 Score: 44.669 bits (104), Expect = 6.494e-6
Identity = 43/127 (33.86%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 2397 KPEFDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 2507          

HSP 18 Score: 44.669 bits (104), Expect = 6.557e-6
Identity = 42/133 (31.58%), Postives = 68/133 (51.13%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E D+ + GP +  ++D+K PK + D+K   DVD+   D+D++G K   GG  +  F MP+
Sbjct: 4751 VDFNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGADLDIEGPK---GGFKMPKFKMPT 4872          

HSP 19 Score: 44.669 bits (104), Expect = 6.685e-6
Identity = 45/130 (34.62%), Postives = 70/130 (53.85%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K    VD+   ++D++G+K   GG  +  F MP+FG K  K        + GP++D N+    P  D+D+K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 4071 KPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPV-VDIGGAELDIEGQK---GGFRMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIDVK-VPDVDITAPDVDIKGSDAKFKGPK--FNMP 4181          

HSP 20 Score: 44.2838 bits (103), Expect = 7.652e-6
Identity = 45/130 (34.62%), Postives = 68/130 (52.31%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + DLK   DVD+   ++D++G K   GG  +  F MP+FG    K        + GP++D N+    P  D+++K   DVD+   D D+ G   K  G    FNMP
Sbjct: 3513 KPEFDLKLKGPKVGGDLDVKVPKIEGDLKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSTGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDFDIKGPDAKFKGPK--FNMP 3623          

HSP 21 Score: 44.2838 bits (103), Expect = 8.509e-6
Identity = 43/132 (32.58%), Postives = 75/132 (56.82%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSF---GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K   D+D+   D+++DG K    G ++    MPS    G K++KP  E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 2705 VDFNLKGPKVKGDIDASLPKIEGDMKTP-DLDIKRPDVNIDGTK---AGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGEAELDIEGPK---GGFKMPKFKMPT 2826          

HSP 22 Score: 44.2838 bits (103), Expect = 8.509e-6
Identity = 43/132 (32.58%), Postives = 75/132 (56.82%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSF---GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K   D+D+   D+++DG K    G ++    MPS    G K++KP  E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 3077 VDFNLKGPKVKGDIDASLPKIEGDMKTP-DLDIKRPDVNIDGTK---AGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGEAELDIEGPK---GGFKMPKFKMPT 3198          

HSP 23 Score: 44.2838 bits (103), Expect = 8.929e-6
Identity = 42/127 (33.07%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K + D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 3327 KPQFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 3437          

HSP 24 Score: 44.2838 bits (103), Expect = 9.929e-6
Identity = 41/133 (30.83%), Postives = 69/133 (51.88%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E+D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 1961 VDFNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKP--ELDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPT 2082          
BLAST of SMED30005345 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 48.521 bits (114), Expect = 2.787e-7
Identity = 42/133 (31.58%), Postives = 70/133 (52.63%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D++G     GG   GF MP          G K++KP  E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 1775 VDFNLKGPKVKGDIDASLPKIEGDIKAP-----DLDIEGPDVNIGGTKAGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGRAELDIEGPK---GGFKMPKFKMPT 1896          

HSP 2 Score: 48.521 bits (114), Expect = 2.983e-7
Identity = 46/130 (35.38%), Postives = 71/130 (54.62%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDL-GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E+DI + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 1467 KPEVDIRLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPTFKMPTFGSKGHK--------LEGPDVDINL----PSTDIEVKAP-DVDITAPDVDMKGPDTKFKGPK--FNMP 1577          

HSP 3 Score: 46.2098 bits (108), Expect = 1.649e-6
Identity = 44/127 (34.65%), Postives = 69/127 (54.33%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E DI++ GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 5187 KPEFDINLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGAK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 5297          

HSP 4 Score: 46.2098 bits (108), Expect = 1.852e-6
Identity = 44/130 (33.85%), Postives = 71/130 (54.62%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDL-GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E+D+ + GP +  ++D+K PK + ++K   DVD+   ++D++G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 1095 KPELDLKLKGPKVGGDLDVKAPKIEGEIKTP-DVDIGGAELDIEGPK---GGFKMPTFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDVDMKGPDTKFKGPK--FNMP 1205          

HSP 5 Score: 45.8246 bits (107), Expect = 2.357e-6
Identity = 41/131 (31.30%), Postives = 67/131 (51.15%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            +D+++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E D+ + GP I  ++D+K PK + D+K   DVD+   ++D++G+K        GF MP
Sbjct: 2147 VDLNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKIGGDLDVKAPKIEGDIKAP-DVDIGEAEMDIEGQK-------AGFKMP 2262          

HSP 6 Score: 45.8246 bits (107), Expect = 2.859e-6
Identity = 44/127 (34.65%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   D+D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 4815 KPEFDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGADLDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 4925          

HSP 7 Score: 45.8246 bits (107), Expect = 2.972e-6
Identity = 45/130 (34.62%), Postives = 69/130 (53.08%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D D+ G   K  G    FNMP
Sbjct: 3141 KPEFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGEAELDIEGPK---GGFKMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDFDIKGPDAKFKGPK--FNMP 3251          

HSP 8 Score: 45.4394 bits (106), Expect = 3.089e-6
Identity = 42/124 (33.87%), Postives = 66/124 (53.23%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV-DIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP I  ++D+K PK + D+K   DVD+ + ++D + +K G     F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 2211 KPEFDLKLKGPKIGGDLDVKAPKIEGDIKAP-DVDIGEAEMDIEGQKAGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 2321          

HSP 9 Score: 45.4394 bits (106), Expect = 3.119e-6
Identity = 43/127 (33.86%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 1839 KPEFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGRAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDSKFKGPK--FNMP 1949          

HSP 10 Score: 45.4394 bits (106), Expect = 3.402e-6
Identity = 44/127 (34.65%), Postives = 68/127 (53.54%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            +DI + GP +  ++D+K PK + D+K   DVD+   ++D +G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 1284 VDIKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGGAELDTEGPK---GGFKMPKFKMPTFGSKGHK--------LEGPDVDINL----PSTDIEVKAP-DVDITAPDVDMKGPDTKFKGTK--FNMP 1391          

HSP 11 Score: 45.4394 bits (106), Expect = 3.711e-6
Identity = 43/127 (33.86%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 2769 KPEFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGEAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 2879          

HSP 12 Score: 45.4394 bits (106), Expect = 3.783e-6
Identity = 42/133 (31.58%), Postives = 69/133 (51.88%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E DI++ GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 5123 VDFNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPTLNIKGPKMEKP--EFDINLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGAK---GGFKMPKFKMPT 5244          

HSP 13 Score: 45.0542 bits (105), Expect = 4.957e-6
Identity = 46/131 (35.11%), Postives = 72/131 (54.96%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKG-EIDIDIGGPNIDA---NVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E+D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G ++D+++  P+I+     VDI  P  D+D+KG      D  L G K         FNMP
Sbjct: 2025 KPELDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHKWEGPDVDVNLPSPDIEVKAPEVDIAAP--DVDIKGP-----DAKLKGPK---------FNMP 2135          

HSP 14 Score: 45.0542 bits (105), Expect = 5.303e-6
Identity = 46/130 (35.38%), Postives = 69/130 (53.08%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+   GP +  ++D+K P  + DLK   DVD+   ++D++G+K   GG  +  F MP+FG K  K        + GP++D N+    P  D+D+K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 3885 KPEFDLKFKGPKVGGDLDVKVPNIEGDLKTP-DVDIGGAELDIEGQK---GGFRMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIDVK-VPDVDITAPDVDIKGSDAKFKGPK--FNMP 3995          

HSP 15 Score: 44.669 bits (104), Expect = 6.129e-6
Identity = 42/133 (31.58%), Postives = 68/133 (51.13%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E D+ + GP +  ++D+K PK + DLK   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 3449 VDFNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKVPKIEGDLKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPT 3570          

HSP 16 Score: 44.669 bits (104), Expect = 6.432e-6
Identity = 45/130 (34.62%), Postives = 69/130 (53.08%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K        + GP++D N+    P  D+++K   DVD+   D D+ G   K  G    FNMP
Sbjct: 3699 KPEFDLKLKGPKVGGDLDVKIPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDFDIKGPDAKFKGPK--FNMP 3809          

HSP 17 Score: 44.669 bits (104), Expect = 6.494e-6
Identity = 43/127 (33.86%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 2397 KPEFDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 2507          

HSP 18 Score: 44.669 bits (104), Expect = 6.557e-6
Identity = 42/133 (31.58%), Postives = 68/133 (51.13%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E D+ + GP +  ++D+K PK + D+K   DVD+   D+D++G K   GG  +  F MP+
Sbjct: 4751 VDFNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGADLDIEGPK---GGFKMPKFKMPT 4872          

HSP 19 Score: 44.669 bits (104), Expect = 6.685e-6
Identity = 45/130 (34.62%), Postives = 70/130 (53.85%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + D+K    VD+   ++D++G+K   GG  +  F MP+FG K  K        + GP++D N+    P  D+D+K   DVD+   D+D+ G   K  G    FNMP
Sbjct: 4071 KPEFDLKLKGPKVGGDLDVKAPKIEGDIKAPV-VDIGGAELDIEGQK---GGFRMPKFKMPTFGSKGHK--------LEGPDVDVNL----PSTDIDVK-VPDVDITAPDVDIKGSDAKFKGPK--FNMP 4181          

HSP 20 Score: 44.2838 bits (103), Expect = 7.652e-6
Identity = 45/130 (34.62%), Postives = 68/130 (52.31%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + DLK   DVD+   ++D++G K   GG  +  F MP+FG    K        + GP++D N+    P  D+++K   DVD+   D D+ G   K  G    FNMP
Sbjct: 3513 KPEFDLKLKGPKVGGDLDVKVPKIEGDLKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSTGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDFDIKGPDAKFKGPK--FNMP 3623          

HSP 21 Score: 44.2838 bits (103), Expect = 8.509e-6
Identity = 43/132 (32.58%), Postives = 75/132 (56.82%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSF---GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K   D+D+   D+++DG K    G ++    MPS    G K++KP  E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 2705 VDFNLKGPKVKGDIDASLPKIEGDMKTP-DLDIKRPDVNIDGTK---AGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGEAELDIEGPK---GGFKMPKFKMPT 2826          

HSP 22 Score: 44.2838 bits (103), Expect = 8.509e-6
Identity = 43/132 (32.58%), Postives = 75/132 (56.82%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSF---GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K   D+D+   D+++DG K    G ++    MPS    G K++KP  E D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 3077 VDFNLKGPKVKGDIDASLPKIEGDMKTP-DLDIKRPDVNIDGTK---AGFEMPKVKMPSLNIKGPKMEKP--EFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGEAELDIEGPK---GGFKMPKFKMPT 3198          

HSP 23 Score: 44.2838 bits (103), Expect = 8.929e-6
Identity = 42/127 (33.07%), Postives = 68/127 (53.54%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K + D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG K  K +G  D+D+  P+ D  +++K P+ D+          D D+ G   K  G    FNMP
Sbjct: 3327 KPQFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGP-DVDVNLPSTD--IEVKAPEVDITAP-------DFDIKGPDAKFKGPK--FNMP 3437          

HSP 24 Score: 44.2838 bits (103), Expect = 9.929e-6
Identity = 41/133 (30.83%), Postives = 69/133 (51.88%), Query Frame = 1
Query:   10 IDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSF--------GGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPS 372
            +D ++ GP +  ++D   PK + D+K       D+D+ G      G   GF MP          G K++KP  E+D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+
Sbjct: 1961 VDFNLKGPKVKGDIDASLPKIEGDMKTP-----DLDIKGPDVNIDGTKAGFEMPKVKMPSLNIKGPKMEKP--ELDLKLKGPKVGGDLDVKVPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPT 2082          
BLAST of SMED30005345 vs. Ensembl Medaka
Match: AHNAK (AHNAK nucleoprotein [Source:NCBI gene;Acc:101161979])

HSP 1 Score: 44.2838 bits (103), Expect = 7.473e-6
Identity = 46/130 (35.38%), Postives = 71/130 (54.62%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGG---KVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            K + D+ + GP +  ++D+K PK + D+K   DVD+   ++D++G K   GG  +  F MP+FG    K++ P  + DID   P I+   D+K P  DLD+KG      D+++DG K        GF MP
Sbjct:   13 KPQFDLKLKGPKVGGDLDVKAPKIEGDIKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSKGHKLEGPDVKGDIDASLPKIEG--DMKTP--DLDIKGP-----DVNIDGTK-------AGFEMP 122          

HSP 2 Score: 44.2838 bits (103), Expect = 8.230e-6
Identity = 45/130 (34.62%), Postives = 68/130 (52.31%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLG-FNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDV---DIDLDGKKKKHGGIDLGFNMP 369
            K E D+ + GP +  ++D+K PK + DLK   DVD+   ++D++G K   GG  +  F MP+FG    K        + GP++D N+    P  D+++K   DVD+   D D+ G   K  G    FNMP
Sbjct:  138 KPEFDLKLKGPKVGGDLDVKVPKIEGDLKAP-DVDIGGAELDIEGPK---GGFKMPKFKMPTFGSTGHK--------LEGPDVDVNL----PSTDIEVKAP-DVDITAPDFDIKGPDAKFKGPK--FNMP 248          
BLAST of SMED30005345 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  306 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 429          

HSP 2 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  504 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 627          

HSP 3 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  570 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 693          

HSP 4 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  240 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 363          

HSP 5 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  372 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 495          

HSP 6 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  438 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 561          

HSP 7 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  768 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 891          

HSP 8 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  834 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 957          

HSP 9 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1083 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1206          

HSP 10 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1391 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1514          

HSP 11 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1624 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1747          

HSP 12 Score: 217.238 bits (552), Expect = 1.924e-66
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP
Sbjct:  636 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 758          

HSP 13 Score: 216.853 bits (551), Expect = 2.701e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1457 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1580          

HSP 14 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1824 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1947          

HSP 15 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1890 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2013          

HSP 16 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1956 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2079          

HSP 17 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2022 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2145          

HSP 18 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2203 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2326          

HSP 19 Score: 216.468 bits (550), Expect = 3.279e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2489 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2612          

HSP 20 Score: 216.468 bits (550), Expect = 4.137e-66
Identity = 124/126 (98.41%), Postives = 124/126 (98.41%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1015 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1140          

HSP 21 Score: 214.542 bits (545), Expect = 1.931e-65
Identity = 121/124 (97.58%), Postives = 121/124 (97.58%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP FGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  702 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 825          

HSP 22 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1257 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1382          

HSP 23 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1323 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1448          

HSP 24 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA--NVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA   VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1690 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKRKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1815          

HSP 25 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDAN--VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA   VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1756 KGEIDIDIGGPNIDAKRKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1881          

HSP 26 Score: 199.134 bits (505), Expect = 5.090e-60
Identity = 122/159 (76.73%), Postives = 122/159 (76.73%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-----------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                   GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1523 KGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1681          

HSP 27 Score: 196.438 bits (498), Expect = 3.784e-59
Identity = 122/166 (73.49%), Postives = 122/166 (73.49%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                          GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1149 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1314          

HSP 28 Score: 195.282 bits (495), Expect = 9.142e-59
Identity = 121/163 (74.23%), Postives = 121/163 (74.23%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG---------------------------------------IDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG                                       IDLGF MPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPS
Sbjct: 2384 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPS 2546          

HSP 29 Score: 193.741 bits (491), Expect = 3.318e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2088 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2260          

HSP 30 Score: 193.741 bits (491), Expect = 3.318e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2269 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2441          

HSP 31 Score: 191.045 bits (484), Expect = 3.053e-57
Identity = 123/175 (70.29%), Postives = 123/175 (70.29%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  900 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1074          

HSP 32 Score: 187.963 bits (476), Expect = 3.346e-56
Identity = 104/114 (91.23%), Postives = 108/114 (94.74%), Query Frame = 1
Query:   31 PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            P ID NVD KKPKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  184 PKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 297          

HSP 33 Score: 187.193 bits (474), Expect = 5.928e-56
Identity = 106/111 (95.50%), Postives = 108/111 (97.30%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKK 333
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLD +K+
Sbjct: 2555 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDERKR 2665          

HSP 34 Score: 93.2041 bits (230), Expect = 4.830e-23
Identity = 60/97 (61.86%), Postives = 67/97 (69.07%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGH 291
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKH GID     P           +   D+ G  +D +V+    K D+DL G+
Sbjct: 2670 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGIDYHIQNP-----------KTHSDVSGKKLDIDVEGDLKKGDIDLPGN 2755          

HSP 35 Score: 50.0618 bits (118), Expect = 5.900e-8
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  184 KVKKPKGEIDIDIGGPNID---ANVDIKK-------------------------------------------PKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            ++KKP  ++ +   GP  D    N+DI+                                            PKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPS
Sbjct:  123 EIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPS 231          
BLAST of SMED30005345 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  306 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 429          

HSP 2 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  504 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 627          

HSP 3 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  570 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 693          

HSP 4 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  240 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 363          

HSP 5 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  372 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 495          

HSP 6 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  438 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 561          

HSP 7 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  768 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 891          

HSP 8 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  834 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 957          

HSP 9 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1083 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1206          

HSP 10 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1391 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1514          

HSP 11 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1624 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1747          

HSP 12 Score: 217.238 bits (552), Expect = 1.924e-66
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP
Sbjct:  636 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 758          

HSP 13 Score: 216.853 bits (551), Expect = 2.701e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1457 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1580          

HSP 14 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1824 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1947          

HSP 15 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1890 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2013          

HSP 16 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1956 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2079          

HSP 17 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2022 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2145          

HSP 18 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2203 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2326          

HSP 19 Score: 216.468 bits (550), Expect = 3.279e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2492 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2615          

HSP 20 Score: 216.468 bits (550), Expect = 4.137e-66
Identity = 124/126 (98.41%), Postives = 124/126 (98.41%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1015 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1140          

HSP 21 Score: 214.542 bits (545), Expect = 1.931e-65
Identity = 121/124 (97.58%), Postives = 121/124 (97.58%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP FGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  702 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 825          

HSP 22 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1257 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1382          

HSP 23 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1323 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1448          

HSP 24 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA--NVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA   VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1690 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKRKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1815          

HSP 25 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDAN--VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA   VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1756 KGEIDIDIGGPNIDAKRKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1881          

HSP 26 Score: 199.134 bits (505), Expect = 5.090e-60
Identity = 122/159 (76.73%), Postives = 122/159 (76.73%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-----------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                   GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1523 KGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1681          

HSP 27 Score: 196.438 bits (498), Expect = 3.784e-59
Identity = 122/166 (73.49%), Postives = 122/166 (73.49%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                          GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1149 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1314          

HSP 28 Score: 195.282 bits (495), Expect = 9.142e-59
Identity = 121/163 (74.23%), Postives = 121/163 (74.23%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG---------------------------------------IDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG                                       IDLGF MPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPS
Sbjct: 2387 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPS 2549          

HSP 29 Score: 193.741 bits (491), Expect = 3.318e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2088 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2260          

HSP 30 Score: 192.586 bits (488), Expect = 8.413e-58
Identity = 122/176 (69.32%), Postives = 122/176 (69.32%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL----------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                    GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2269 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2444          

HSP 31 Score: 191.045 bits (484), Expect = 3.053e-57
Identity = 123/175 (70.29%), Postives = 123/175 (70.29%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  900 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1074          

HSP 32 Score: 187.963 bits (476), Expect = 3.346e-56
Identity = 104/114 (91.23%), Postives = 108/114 (94.74%), Query Frame = 1
Query:   31 PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            P ID NVD KKPKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  184 PKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 297          

HSP 33 Score: 187.193 bits (474), Expect = 5.928e-56
Identity = 106/111 (95.50%), Postives = 108/111 (97.30%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKK 333
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLD +K+
Sbjct: 2558 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDERKR 2668          

HSP 34 Score: 93.2041 bits (230), Expect = 4.925e-23
Identity = 60/97 (61.86%), Postives = 67/97 (69.07%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGH 291
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKH GID     P           +   D+ G  +D +V+    K D+DL G+
Sbjct: 2673 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGIDYHIQNP-----------KTHSDVSGKKLDIDVEGDLKKGDIDLPGN 2758          

HSP 35 Score: 50.0618 bits (118), Expect = 6.074e-8
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  184 KVKKPKGEIDIDIGGPNID---ANVDIKK-------------------------------------------PKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            ++KKP  ++ +   GP  D    N+DI+                                            PKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPS
Sbjct:  123 EIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPS 231          
BLAST of SMED30005345 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  306 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 429          

HSP 2 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  504 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 627          

HSP 3 Score: 221.476 bits (563), Expect = 7.346e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  570 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 693          

HSP 4 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  240 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 363          

HSP 5 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  372 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 495          

HSP 6 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  438 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 561          

HSP 7 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  768 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 891          

HSP 8 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  834 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 957          

HSP 9 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1083 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1206          

HSP 10 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1391 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1514          

HSP 11 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1624 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1747          

HSP 12 Score: 217.238 bits (552), Expect = 1.924e-66
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP
Sbjct:  636 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 758          

HSP 13 Score: 216.853 bits (551), Expect = 2.701e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1457 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1580          

HSP 14 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1828 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1951          

HSP 15 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1894 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2017          

HSP 16 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1960 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2083          

HSP 17 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2026 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2149          

HSP 18 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2207 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2330          

HSP 19 Score: 216.468 bits (550), Expect = 3.279e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2493 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2616          

HSP 20 Score: 216.468 bits (550), Expect = 4.137e-66
Identity = 124/126 (98.41%), Postives = 124/126 (98.41%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1015 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1140          

HSP 21 Score: 214.542 bits (545), Expect = 1.950e-65
Identity = 121/124 (97.58%), Postives = 121/124 (97.58%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP FGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  702 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 825          

HSP 22 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1257 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1382          

HSP 23 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1323 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1448          

HSP 24 Score: 210.305 bits (534), Expect = 5.363e-64
Identity = 122/130 (93.85%), Postives = 122/130 (93.85%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA------NVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA       VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1690 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKSEYRRKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1819          

HSP 25 Score: 210.305 bits (534), Expect = 5.363e-64
Identity = 122/130 (93.85%), Postives = 122/130 (93.85%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDAN------VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA       VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1756 KGEIDIDIGGPNIDAKSEYRRKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1885          

HSP 26 Score: 199.134 bits (505), Expect = 5.090e-60
Identity = 122/159 (76.73%), Postives = 122/159 (76.73%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-----------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                   GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1523 KGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1681          

HSP 27 Score: 196.438 bits (498), Expect = 3.784e-59
Identity = 122/166 (73.49%), Postives = 122/166 (73.49%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                          GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1149 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1314          

HSP 28 Score: 195.282 bits (495), Expect = 9.142e-59
Identity = 121/163 (74.23%), Postives = 121/163 (74.23%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG---------------------------------------IDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG                                       IDLGF MPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPS
Sbjct: 2388 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPS 2550          

HSP 29 Score: 193.741 bits (491), Expect = 3.318e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2092 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2264          

HSP 30 Score: 193.741 bits (491), Expect = 3.318e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2273 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2445          

HSP 31 Score: 191.045 bits (484), Expect = 3.053e-57
Identity = 123/175 (70.29%), Postives = 123/175 (70.29%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  900 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1074          

HSP 32 Score: 187.963 bits (476), Expect = 3.314e-56
Identity = 104/114 (91.23%), Postives = 108/114 (94.74%), Query Frame = 1
Query:   31 PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            P ID NVD KKPKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  184 PKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 297          

HSP 33 Score: 187.193 bits (474), Expect = 5.928e-56
Identity = 106/111 (95.50%), Postives = 108/111 (97.30%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKK 333
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLD +K+
Sbjct: 2559 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDERKR 2669          

HSP 34 Score: 93.2041 bits (230), Expect = 4.925e-23
Identity = 60/97 (61.86%), Postives = 67/97 (69.07%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGH 291
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKH GID     P           +   D+ G  +D +V+    K D+DL G+
Sbjct: 2674 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGIDYHIQNP-----------KTHSDVSGKKLDIDVEGDLKKGDIDLPGN 2759          

HSP 35 Score: 50.0618 bits (118), Expect = 5.957e-8
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  184 KVKKPKGEIDIDIGGPNID---ANVDIKK-------------------------------------------PKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            ++KKP  ++ +   GP  D    N+DI+                                            PKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPS
Sbjct:  123 EIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPS 231          
BLAST of SMED30005345 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 221.476 bits (563), Expect = 7.347e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  306 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 429          

HSP 2 Score: 221.476 bits (563), Expect = 7.347e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  504 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 627          

HSP 3 Score: 221.476 bits (563), Expect = 7.347e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  570 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 693          

HSP 4 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  240 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 363          

HSP 5 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  372 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 495          

HSP 6 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  438 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 561          

HSP 7 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  768 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 891          

HSP 8 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  834 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 957          

HSP 9 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1083 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1206          

HSP 10 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1391 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1514          

HSP 11 Score: 219.164 bits (557), Expect = 4.498e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1624 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1747          

HSP 12 Score: 217.238 bits (552), Expect = 1.924e-66
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP
Sbjct:  636 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 758          

HSP 13 Score: 216.853 bits (551), Expect = 2.728e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1457 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1580          

HSP 14 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1854 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1977          

HSP 15 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1920 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2043          

HSP 16 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1986 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2109          

HSP 17 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2052 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2175          

HSP 18 Score: 216.853 bits (551), Expect = 2.754e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2233 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2356          

HSP 19 Score: 216.853 bits (551), Expect = 3.248e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2519 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2642          

HSP 20 Score: 216.468 bits (550), Expect = 4.138e-66
Identity = 124/126 (98.41%), Postives = 124/126 (98.41%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1015 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1140          

HSP 21 Score: 214.542 bits (545), Expect = 1.932e-65
Identity = 121/124 (97.58%), Postives = 121/124 (97.58%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP FGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  702 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 825          

HSP 22 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1257 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1382          

HSP 23 Score: 211.846 bits (538), Expect = 1.551e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1323 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1448          

HSP 24 Score: 198.749 bits (504), Expect = 6.003e-60
Identity = 122/159 (76.73%), Postives = 122/159 (76.73%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-----------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                   GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1523 KGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1681          

HSP 25 Score: 196.438 bits (498), Expect = 3.785e-59
Identity = 122/166 (73.49%), Postives = 122/166 (73.49%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                          GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1149 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1314          

HSP 26 Score: 195.282 bits (495), Expect = 1.089e-58
Identity = 121/163 (74.23%), Postives = 121/163 (74.23%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG---------------------------------------IDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG                                       IDLGF MPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPS
Sbjct: 2414 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPS 2576          

HSP 27 Score: 193.741 bits (491), Expect = 3.319e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2118 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2290          

HSP 28 Score: 193.741 bits (491), Expect = 3.319e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2299 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2471          

HSP 29 Score: 191.045 bits (484), Expect = 3.054e-57
Identity = 123/175 (70.29%), Postives = 123/175 (70.29%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  900 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1074          

HSP 30 Score: 187.963 bits (476), Expect = 3.379e-56
Identity = 104/114 (91.23%), Postives = 108/114 (94.74%), Query Frame = 1
Query:   31 PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            P ID NVD KKPKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  184 PKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 297          

HSP 31 Score: 187.193 bits (474), Expect = 5.872e-56
Identity = 106/111 (95.50%), Postives = 108/111 (97.30%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKK 333
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLD +K+
Sbjct: 2585 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDERKR 2695          

HSP 32 Score: 177.948 bits (450), Expect = 1.150e-52
Identity = 106/124 (85.48%), Postives = 106/124 (85.48%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIG                 DLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1690 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIG-----------------DLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1796          

HSP 33 Score: 177.948 bits (450), Expect = 1.150e-52
Identity = 106/124 (85.48%), Postives = 106/124 (85.48%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIG                 DLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1805 KGEIDIDIG-----------------DLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1911          

HSP 34 Score: 93.2041 bits (230), Expect = 5.272e-23
Identity = 60/97 (61.86%), Postives = 67/97 (69.07%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGH 291
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKH GID     P           +   D+ G  +D +V+    K D+DL G+
Sbjct: 2700 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGIDYHIQNP-----------KTHSDVSGKKLDIDVEGDLKKGDIDLPGN 2785          

HSP 35 Score: 50.0618 bits (118), Expect = 6.254e-8
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  184 KVKKPKGEIDIDIGGPNID---ANVDIKK-------------------------------------------PKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            ++KKP  ++ +   GP  D    N+DI+                                            PKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPS
Sbjct:  123 EIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPS 231          
BLAST of SMED30005345 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 221.476 bits (563), Expect = 7.562e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  306 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 429          

HSP 2 Score: 221.476 bits (563), Expect = 7.562e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  504 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 627          

HSP 3 Score: 221.476 bits (563), Expect = 7.562e-68
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  570 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 693          

HSP 4 Score: 219.164 bits (557), Expect = 4.630e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  240 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 363          

HSP 5 Score: 219.164 bits (557), Expect = 4.630e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  372 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 495          

HSP 6 Score: 219.164 bits (557), Expect = 4.630e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  438 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 561          

HSP 7 Score: 219.164 bits (557), Expect = 4.630e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  768 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 891          

HSP 8 Score: 219.164 bits (557), Expect = 4.630e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  834 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 957          

HSP 9 Score: 219.164 bits (557), Expect = 4.630e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1083 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1206          

HSP 10 Score: 219.164 bits (557), Expect = 4.630e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1391 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1514          

HSP 11 Score: 219.164 bits (557), Expect = 4.630e-67
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1624 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1747          

HSP 12 Score: 217.238 bits (552), Expect = 1.981e-66
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 369
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP
Sbjct:  636 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP 758          

HSP 13 Score: 216.853 bits (551), Expect = 2.807e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1457 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1580          

HSP 14 Score: 216.853 bits (551), Expect = 2.835e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1824 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1947          

HSP 15 Score: 216.853 bits (551), Expect = 2.835e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1890 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2013          

HSP 16 Score: 216.853 bits (551), Expect = 2.835e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1956 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2079          

HSP 17 Score: 216.853 bits (551), Expect = 2.835e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2022 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2145          

HSP 18 Score: 216.853 bits (551), Expect = 2.835e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2203 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2326          

HSP 19 Score: 216.468 bits (550), Expect = 3.375e-66
Identity = 122/124 (98.39%), Postives = 122/124 (98.39%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2489 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2612          

HSP 20 Score: 216.468 bits (550), Expect = 4.259e-66
Identity = 124/126 (98.41%), Postives = 124/126 (98.41%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1015 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1140          

HSP 21 Score: 214.542 bits (545), Expect = 2.007e-65
Identity = 121/124 (97.58%), Postives = 121/124 (97.58%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMP FGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  702 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 825          

HSP 22 Score: 211.846 bits (538), Expect = 1.597e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1257 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1382          

HSP 23 Score: 211.846 bits (538), Expect = 1.597e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVD--IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVD  IDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1323 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1448          

HSP 24 Score: 211.846 bits (538), Expect = 1.597e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA--NVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA   VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1690 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKRKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1815          

HSP 25 Score: 211.846 bits (538), Expect = 1.597e-64
Identity = 122/126 (96.83%), Postives = 122/126 (96.83%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDAN--VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA   VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1756 KGEIDIDIGGPNIDAKRKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1881          

HSP 26 Score: 199.134 bits (505), Expect = 4.849e-60
Identity = 122/159 (76.73%), Postives = 122/159 (76.73%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-----------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDI GPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                   GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1523 KGEIDIDICGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1681          

HSP 27 Score: 196.438 bits (498), Expect = 3.896e-59
Identity = 122/166 (73.49%), Postives = 122/166 (73.49%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                          GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 1149 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 1314          

HSP 28 Score: 195.282 bits (495), Expect = 8.709e-59
Identity = 121/163 (74.23%), Postives = 121/163 (74.23%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG---------------------------------------IDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGG                                       IDLGF MPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKK GGIDLGFNMPS
Sbjct: 2384 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPS 2546          

HSP 29 Score: 193.741 bits (491), Expect = 3.415e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2088 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2260          

HSP 30 Score: 193.741 bits (491), Expect = 3.415e-58
Identity = 122/173 (70.52%), Postives = 122/173 (70.52%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct: 2269 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 2441          

HSP 31 Score: 191.045 bits (484), Expect = 3.143e-57
Identity = 123/175 (70.29%), Postives = 123/175 (70.29%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL-------------------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG--DVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                                 GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHG  DVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  900 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPS 1074          

HSP 32 Score: 187.963 bits (476), Expect = 3.444e-56
Identity = 104/114 (91.23%), Postives = 108/114 (94.74%), Query Frame = 1
Query:   31 PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            P ID NVD KKPKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS
Sbjct:  184 PKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 297          

HSP 33 Score: 184.496 bits (467), Expect = 5.456e-55
Identity = 116/163 (71.17%), Postives = 116/163 (71.17%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL---------------------------------------GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            KGEIDIDIGGPNIDA VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDL                                       GFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKH GID     P 
Sbjct: 2555 KGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGIDYHIQNPK 2717          

HSP 34 Score: 93.2041 bits (230), Expect = 4.512e-23
Identity = 60/97 (61.86%), Postives = 67/97 (69.07%), Query Frame = 1
Query:    1 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGH 291
            KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKH GID     P           +   D+ G  +D +V+    K D+DL G+
Sbjct: 2660 KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGIDYHIQNP-----------KTHSDVSGKKLDIDVEGDLKKGDIDLPGN 2745          

HSP 35 Score: 50.0618 bits (118), Expect = 5.786e-8
Identity = 40/109 (36.70%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  184 KVKKPKGEIDIDIGGPNID---ANVDIKK-------------------------------------------PKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPS 372
            ++KKP  ++ +   GP  D    N+DI+                                            PKADL+LK HGD+DVD+DL+ KKKKHGGIDLGFNMPS
Sbjct:  123 EIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNMPS 231          
The following BLAST results are available for this feature:
BLAST of SMED30005345 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005345 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005345 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005345 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ahnak7.142e-632.80AHNAK nucleoprotein [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of SMED30005345 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005345 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005345 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005345 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1G8K52.237e-742.62Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A3B5R4P72.047e-641.09PDZ domain-containing protein OS=Xiphophorus macul... [more]
A0A0S7F4L94.264e-641.86AHNK (Fragment) OS=Poeciliopsis prolifica OX=18813... [more]
A0A3B5KVE34.626e-640.63Uncharacterized protein OS=Xiphophorus couchianus ... [more]
A0A3B5LMB35.696e-641.09Uncharacterized protein OS=Xiphophorus couchianus ... [more]
back to top
BLAST of SMED30005345 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000039323.11.806e-833.86pep primary_assembly:Astyanax_mexicanus-2.0:24:370... [more]
back to top
BLAST of SMED30005345 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004925.15.971e-738.64pep scaffold:Pmarinus_7.0:GL480373:16762:23670:1 g... [more]
back to top
BLAST of SMED30005345 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005345 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005345 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
AHNAK2.787e-731.58AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
AHNAK2.787e-731.58AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
AHNAK7.473e-635.38AHNAK nucleoprotein [Source:NCBI gene;Acc:10116197... [more]
back to top
BLAST of SMED30005345 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059907.17.346e-68100.00SMESG000059907.1[more]
SMESG000059907.17.346e-68100.00SMESG000059907.1[more]
SMESG000059907.17.346e-68100.00SMESG000059907.1[more]
SMESG000059907.17.347e-68100.00SMESG000059907.1[more]
SMESG000059907.17.562e-68100.00SMESG000059907.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005345 ID=SMED30005345|Name=SMED30005345|organism=Schmidtea mediterranea sexual|type=transcript|length=374bp
AAAGGCGAAATCGATATTGATATTGGAGGTCCGAATATAGACGCAAATGT
TGATATAAAGAAACCCAAAGCTGATCTAGATTTGAAAGGTCATGGTGATG
TTGATGTTGATATTGATTTAGATGGAAAGAAAAAGAAACATGGTGGAATC
GATCTTGGATTTAACATGCCTTCGTTCGGAGGAAAAGTAAAGAAACCGAA
AGGCGAAATCGATATTGATATTGGAGGTCCGAATATAGACGCAAATGTTG
ATATAAAGAAACCCAAAGCTGATCTAGATTTGAAAGGTCATGGTGATGTT
GATGTTGATATTGATTTAGATGGAAAGAAAAAGAAACATGGTGGAATCGA
TCTTGGATTTAACATGCCTTCGTT
back to top

protein sequence of SMED30005345-orf-1

>SMED30005345-orf-1 ID=SMED30005345-orf-1|Name=SMED30005345-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
KGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGI
DLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDV
DVDIDLDGKKKKHGGIDLGFNMPS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0031090organelle membrane
GO:0043231intracellular membrane-bounded organelle
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development