SMED30005324

Overview
NameSMED30005324
Smed IDSMED30005324
Length (bp)2848
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005324 (SMED30005324) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005324 (SMED30005324) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005324 (SMED30005324) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005324 (SMED30005324) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005324

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30005324SMESG000025293.1 SMESG000025291.1 SMESG000017972.1 SMESG000017971.1 dd_Smed_v4_451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005324SMESG000025293.1 SMESG000025291.1 SMESG000017972.1 SMESG000017971.1 dd_Smed_v4_451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005324SMESG000025293.1 SMESG000025291.1 SMESG000017972.1 SMESG000017971.1 dd_Smed_v4_451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005324SMESG000025291.1 dd_Smed_v4_8929_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005324SMESG000025291.1 SMED_18752_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30005324SMESG000025291.1 SMED_18752_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005324 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.020153:727..6797 -10901
Homology
BLAST of SMED30005324 vs. Planmine SMEST
Match: SMESG000025291.1 (SMESG000025291.1)

HSP 1 Score: 1408.66 bits (3645), Expect = 0.000e+0
Identity = 758/786 (96.44%), Postives = 759/786 (96.56%), Query Frame = 3
Query:   42 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK------------------------IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKVSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVSTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTXXXXXXXXXXXXXXXAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCXXXXXXXXXXXXXXXGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISXXXXXXXXXXXXXXXXXXXXXIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVXXXXXXXXXXXXXXXXXSIKTGCKFKK 2327
            MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK                        IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIK SIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDV TWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIK+ VIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK
Sbjct:    1 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKKVSFTKLMTYFSQSFVKYYFGLELNIEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKFSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVLTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIKVNVIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK 786          

HSP 2 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct:  813 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 959          

HSP 3 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1003 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1149          

HSP 4 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1368 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1514          

HSP 5 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1558 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1704          

HSP 6 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1923 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2069          

HSP 7 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2113 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2259          

HSP 8 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2303 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2449          

HSP 9 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2493 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2639          

HSP 10 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2683 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2829          

HSP 11 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2873 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3019          

HSP 12 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3063 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3209          

HSP 13 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3425 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3571          

HSP 14 Score: 279.256 bits (713), Expect = 1.097e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3615 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3761          

HSP 15 Score: 261.922 bits (668), Expect = 5.999e-72
Identity = 134/138 (97.10%), Postives = 137/138 (99.28%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKV 2820
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKK 
Sbjct: 3253 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKA 3390          

HSP 16 Score: 247.669 bits (631), Expect = 2.461e-67
Identity = 131/147 (89.12%), Postives = 134/147 (91.16%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFK             DGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3805 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFK-------------DGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3938          

HSP 17 Score: 239.58 bits (610), Expect = 1.036e-64
Identity = 131/147 (89.12%), Postives = 131/147 (89.12%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTI                KVTMKFEVTKV
Sbjct: 3982 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTI----------------KVTMKFEVTKV 4112          

HSP 18 Score: 235.343 bits (599), Expect = 2.749e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1193 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1324          

HSP 19 Score: 235.343 bits (599), Expect = 2.749e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1748 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1879          

HSP 20 Score: 151.754 bits (382), Expect = 7.873e-37
Identity = 77/82 (93.90%), Postives = 82/82 (100.00%), Query Frame = 1
Query: 2590 QKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFE 2835
            ++KPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFE
Sbjct: 4167 RRKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFE 4248          
BLAST of SMED30005324 vs. Planmine SMEST
Match: SMESG000025291.1 (SMESG000025291.1)

HSP 1 Score: 1408.28 bits (3644), Expect = 0.000e+0
Identity = 758/786 (96.44%), Postives = 759/786 (96.56%), Query Frame = 3
Query:   42 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK------------------------IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKVSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVSTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTXXXXXXXXXXXXXXXAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCXXXXXXXXXXXXXXXGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISXXXXXXXXXXXXXXXXXXXXXIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVXXXXXXXXXXXXXXXXXSIKTGCKFKK 2327
            MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK                        IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIK SIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDV TWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIK+ VIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK
Sbjct:    1 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKKVSFTKLMTYFSQSFVKYYFGLELNIEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKFSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVLTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIKVNVIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK 786          

HSP 2 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct:  813 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 959          

HSP 3 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1003 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1149          

HSP 4 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1368 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1514          

HSP 5 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1558 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1704          

HSP 6 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1923 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2069          

HSP 7 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2113 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2259          

HSP 8 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2303 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2449          

HSP 9 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2493 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2639          

HSP 10 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2683 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2829          

HSP 11 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2873 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3019          

HSP 12 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3063 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3209          

HSP 13 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3431 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3577          

HSP 14 Score: 279.256 bits (713), Expect = 1.118e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3621 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3767          

HSP 15 Score: 273.863 bits (699), Expect = 7.276e-76
Identity = 140/144 (97.22%), Postives = 143/144 (99.31%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEV 2838
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFE 
Sbjct: 3253 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEA 3396          

HSP 16 Score: 247.669 bits (631), Expect = 2.484e-67
Identity = 131/147 (89.12%), Postives = 134/147 (91.16%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFK             DGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3811 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFK-------------DGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3944          

HSP 17 Score: 239.58 bits (610), Expect = 1.056e-64
Identity = 131/147 (89.12%), Postives = 131/147 (89.12%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTI                KVTMKFEVTKV
Sbjct: 3988 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTI----------------KVTMKFEVTKV 4118          

HSP 18 Score: 235.343 bits (599), Expect = 2.799e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1193 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1324          

HSP 19 Score: 235.343 bits (599), Expect = 2.799e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1748 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1879          

HSP 20 Score: 151.754 bits (382), Expect = 7.943e-37
Identity = 77/82 (93.90%), Postives = 82/82 (100.00%), Query Frame = 1
Query: 2590 QKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFE 2835
            ++KPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFE
Sbjct: 4173 RRKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFE 4254          
BLAST of SMED30005324 vs. Planmine SMEST
Match: SMESG000025291.1 (SMESG000025291.1)

HSP 1 Score: 1407.89 bits (3643), Expect = 0.000e+0
Identity = 758/786 (96.44%), Postives = 759/786 (96.56%), Query Frame = 3
Query:   42 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK------------------------IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKVSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVSTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTXXXXXXXXXXXXXXXAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCXXXXXXXXXXXXXXXGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISXXXXXXXXXXXXXXXXXXXXXIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVXXXXXXXXXXXXXXXXXSIKTGCKFKK 2327
            MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK                        IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIK SIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDV TWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIK+ VIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK
Sbjct:    1 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKKVSFTKLMTYFSQSFVKYYFGLELNIEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKFSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVLTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIKVNVIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK 786          

HSP 2 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct:  813 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 959          

HSP 3 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1003 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1149          

HSP 4 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1368 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1514          

HSP 5 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1558 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1704          

HSP 6 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1923 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2069          

HSP 7 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2113 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2259          

HSP 8 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2303 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2449          

HSP 9 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2493 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2639          

HSP 10 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2683 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2829          

HSP 11 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2873 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3019          

HSP 12 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3063 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3209          

HSP 13 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3425 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3571          

HSP 14 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3615 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3761          

HSP 15 Score: 261.536 bits (667), Expect = 7.563e-72
Identity = 134/138 (97.10%), Postives = 137/138 (99.28%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKV 2820
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKK 
Sbjct: 3253 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKA 3390          

HSP 16 Score: 247.284 bits (630), Expect = 3.098e-67
Identity = 131/147 (89.12%), Postives = 134/147 (91.16%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFK             DGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3805 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFK-------------DGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3938          

HSP 17 Score: 234.958 bits (598), Expect = 3.424e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1193 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1324          

HSP 18 Score: 234.958 bits (598), Expect = 3.424e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1748 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1879          

HSP 19 Score: 226.868 bits (577), Expect = 1.631e-60
Identity = 125/147 (85.03%), Postives = 125/147 (85.03%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTI                      KKVTMKFEVTKV
Sbjct: 3982 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTI----------------------KKVTMKFEVTKV 4106          

HSP 20 Score: 216.468 bits (550), Expect = 3.316e-57
Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK 2739
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK
Sbjct: 4259 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK 4369          

HSP 21 Score: 151.754 bits (382), Expect = 8.243e-37
Identity = 77/82 (93.90%), Postives = 82/82 (100.00%), Query Frame = 1
Query: 2590 QKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFE 2835
            ++KPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFE
Sbjct: 4161 RRKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFE 4242          
BLAST of SMED30005324 vs. Planmine SMEST
Match: SMESG000025291.1 (SMESG000025291.1)

HSP 1 Score: 1407.89 bits (3643), Expect = 0.000e+0
Identity = 758/786 (96.44%), Postives = 759/786 (96.56%), Query Frame = 3
Query:   42 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK------------------------IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKVSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVSTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTXXXXXXXXXXXXXXXAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCXXXXXXXXXXXXXXXGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISXXXXXXXXXXXXXXXXXXXXXIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVXXXXXXXXXXXXXXXXXSIKTGCKFKK 2327
            MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK                        IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIK SIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDV TWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIK+ VIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK
Sbjct:    1 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKKVSFTKLMTYFSQSFVKYYFGLELNIEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKFSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVLTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIKVNVIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK 786          

HSP 2 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct:  813 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 959          

HSP 3 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1003 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1149          

HSP 4 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1368 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1514          

HSP 5 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1558 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1704          

HSP 6 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1923 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2069          

HSP 7 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2113 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2259          

HSP 8 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2303 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2449          

HSP 9 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2493 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2639          

HSP 10 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2683 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2829          

HSP 11 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2873 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3019          

HSP 12 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3063 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3209          

HSP 13 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3425 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3571          

HSP 14 Score: 278.87 bits (712), Expect = 1.411e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3615 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3761          

HSP 15 Score: 261.536 bits (667), Expect = 7.566e-72
Identity = 134/138 (97.10%), Postives = 137/138 (99.28%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKV 2820
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKK 
Sbjct: 3253 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKA 3390          

HSP 16 Score: 247.284 bits (630), Expect = 3.099e-67
Identity = 131/147 (89.12%), Postives = 134/147 (91.16%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFK             DGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3805 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFK-------------DGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3938          

HSP 17 Score: 239.195 bits (609), Expect = 1.304e-64
Identity = 131/147 (89.12%), Postives = 131/147 (89.12%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTI                KVTMKFEVTKV
Sbjct: 3982 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTI----------------KVTMKFEVTKV 4112          

HSP 18 Score: 234.958 bits (598), Expect = 3.425e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1193 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1324          

HSP 19 Score: 234.958 bits (598), Expect = 3.425e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1748 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1879          

HSP 20 Score: 216.468 bits (550), Expect = 3.317e-57
Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK 2739
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK
Sbjct: 4265 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK 4375          

HSP 21 Score: 151.754 bits (382), Expect = 7.967e-37
Identity = 77/82 (93.90%), Postives = 82/82 (100.00%), Query Frame = 1
Query: 2590 QKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFE 2835
            ++KPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFE
Sbjct: 4167 RRKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFE 4248          
BLAST of SMED30005324 vs. Planmine SMEST
Match: SMESG000025291.1 (SMESG000025291.1)

HSP 1 Score: 1407.51 bits (3642), Expect = 0.000e+0
Identity = 758/786 (96.44%), Postives = 759/786 (96.56%), Query Frame = 3
Query:   42 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK------------------------IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKVSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVSTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTXXXXXXXXXXXXXXXAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCXXXXXXXXXXXXXXXGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISXXXXXXXXXXXXXXXXXXXXXIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVXXXXXXXXXXXXXXXXXSIKTGCKFKK 2327
            MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKK                        IEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIK SIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDV TWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIK+ VIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK
Sbjct:    1 MRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKIIDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVRPRVAIDLTEGGIYPPVYVKKVSFTKLMTYFSQSFVKYYFGLELNIEIFGNVAELRSWIKHYLSAVTSLDEACQVKLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNCDDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQHETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESRLIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKFSIFGCFERIKGCKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKNRQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVLTWIKHKFDEEEHLLTQSVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCFYDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILDVECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSIEKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIKVNVIGCIFKMKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEKEEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKKIKLRIISKRKLTLRLSIKTGCKFKK 786          

HSP 2 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct:  813 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 959          

HSP 3 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1003 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1149          

HSP 4 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1368 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1514          

HSP 5 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1558 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1704          

HSP 6 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1923 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2069          

HSP 7 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2113 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2259          

HSP 8 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2303 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2449          

HSP 9 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2493 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2639          

HSP 10 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2683 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 2829          

HSP 11 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 2873 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3019          

HSP 12 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3063 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3209          

HSP 13 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3425 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3571          

HSP 14 Score: 278.87 bits (712), Expect = 1.348e-77
Identity = 144/147 (97.96%), Postives = 147/147 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 3615 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 3761          

HSP 15 Score: 261.536 bits (667), Expect = 7.161e-72
Identity = 134/138 (97.10%), Postives = 137/138 (99.28%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKV 2820
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKK 
Sbjct: 3253 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKA 3390          

HSP 16 Score: 234.958 bits (598), Expect = 3.303e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1193 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1324          

HSP 17 Score: 234.958 bits (598), Expect = 3.303e-63
Identity = 129/147 (87.76%), Postives = 132/147 (89.80%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKS               VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFEVTKV
Sbjct: 1748 LKPCAVKLVIKDKQLTGITVTPKISKS---------------VDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFEVTKV 1879          

HSP 18 Score: 226.868 bits (577), Expect = 1.573e-60
Identity = 125/147 (85.03%), Postives = 125/147 (85.03%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFEVTKV 2847
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTI                      KKVTMKFEVTKV
Sbjct: 3981 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTI----------------------KKVTMKFEVTKV 4105          

HSP 19 Score: 216.468 bits (550), Expect = 3.172e-57
Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK 2739
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK
Sbjct: 4258 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKK 4368          

HSP 20 Score: 151.754 bits (382), Expect = 8.605e-37
Identity = 77/82 (93.90%), Postives = 82/82 (100.00%), Query Frame = 1
Query: 2590 QKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFE 2835
            ++KPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFE
Sbjct: 4160 RRKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFE 4241          

HSP 21 Score: 150.984 bits (380), Expect = 1.503e-36
Identity = 88/143 (61.54%), Postives = 102/143 (71.33%), Query Frame = 1
Query: 2407 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQGVDFKRGKHTIVVKIMKGTRQKKPNRITAAGLKVINVNPGDKLSKYFKSVTIVITKEKFTRDGKRKTVKKTIKVPLKTIVDDLKNVLRKPHHYVKKVTMKFE 2835
            LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQ  D +R +        + T+Q   +R  +            ++ +  +       + KFTRDGKRKTVKKTIKVPLKTIVDDL+NVL+KP+HYVKKVTMKFE
Sbjct: 3805 LKPCAVKLVIKDKQLTGITVTPKISKSDVKKLRPDWKHPKQ--DHERHQ-------TEETKQNHSSRFESH-----QCQSRRQIEQILQVRYNCNYERKFTRDGKRKTVKKTIKVPLKTIVDDLRNVLKKPYHYVKKVTMKFE 3933          

HSP 22 Score: 105.531 bits (262), Expect = 1.319e-22
Identity = 47/58 (81.03%), Postives = 50/58 (86.21%), Query Frame = 3
Query: 2568 QDHERHQTEETKQNHSSRFESHQCQSRRQIEQILQVRYNCNYERKIHKRWKTKDCQEN 2741
            QDHERHQTEETKQNHSSRFESHQCQSRRQIEQILQVRYNCNYERK  +  K K  ++ 
Sbjct: 3845 QDHERHQTEETKQNHSSRFESHQCQSRRQIEQILQVRYNCNYERKFTRDGKRKTVKKT 3902          
The following BLAST results are available for this feature:
BLAST of SMED30005324 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005324 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025291.11.097e-7796.44SMESG000025291.1[more]
SMESG000025291.11.118e-7796.44SMESG000025291.1[more]
SMESG000025291.11.411e-7796.44SMESG000025291.1[more]
SMESG000025291.11.411e-7796.44SMESG000025291.1[more]
SMESG000025291.11.348e-7796.44SMESG000025291.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005324 ID=SMED30005324|Name=SMED30005324|organism=Schmidtea mediterranea sexual|type=transcript|length=2848bp
TTTCAGTTATTTTTGAAATCTACAGTGTTGAAAAGTTGTTCATGCGTCAA
GTGACTAAAATATTACATGGAAATTGTTATGCTGCTTTTATTATTTTATT
TCTTACAACATTCTCCAGTGCTCTGAATCTAAAAAATTCAGAATGCAAAA
TCATTGATGGACTTCAAAGACCCGACATAATATCAGAAAAATATATTTAT
GGAGGCCCAAACAACTGCACAAAGCTTCCTGAACAGATAAGAGACCGCGG
ATCGTTTTGGACGACTTATGTTACAGACGAAGACCTGATAAATAATGTGC
GACCTCGAGTGGCAATTGATTTGACTGAAGGGGGTATCTATCCTCCAGTT
TATGTCAAGAAAATTGAGATTTTTGGAAATGTCGCCGAATTGCGTTCTTG
GATAAAGCACTATTTATCTGCTGTAACGTCTCTAGATGAAGCTTGTCAGG
TAAAGTTAAAAAATGGAAACCATACGATCGAAATCAACAAGAAAGTCAGT
TGGTTGCAATTTGAGTTGATAAGTCGATTTGGTGAATCTTCAGTCGAGGA
AGGCGGCCTTTTTAAGCTGTACTTTAAAATTTGGGGCTGTTTTTACAATT
GTGATGATAAACCGCGACTATCATTGCCTGGTAATTGTGAAATTAAAAAT
ATCTTCGAAACAAACTCTATTGACGAAAGCGATGTATTTATCAACAATAA
AACATCAAAGGAATTCATAAAAACTAAGGGAACATTGCATATAGATTGCC
AACATGAGACATCTTTAGATTTGGATCTCACTCAAAATGGTCAAAATTTT
CACAGCTACATAAGTGAAATAAAAATCAACGACTGGGCTGGTTACATTCA
AGCAAAATACAAAAGCAATATAAAAAGTGCCTATCGATTCTTAGAAAGTC
GATTGATAAAGCGTTGTAAGTCTGATACTCAGCGAATTGTTTTCAACAGT
CAAGCTTCAATAATTAAACTTCGCTTCTTTTCTTCGCACTGTTCTCAGAA
AATCAAAACTATTAAAGTTTCAATATTCGGATGCTTTGAACGAATTAAAG
GTTGCAAGCTCGTAGATGGCTTAGCTTTAAAACACATGATCCCAAACGAT
TTCATTTACGGCGGGCCCCGAAATTCCGATCAAATTGGTCTACTCATCCG
AGACAATCAACAAGGCTGGTCCTCAACAATTTCGATGTTAGACATTAAAA
ATCGCCAACGACCGAACTTTGTCGTTGATTTAACTCACGGCAATCTTCAT
TCACCGCCTTTCATTCGACAGGTTGATATTGTTGGAAATGTTGTTGACGT
TTCTACTTGGATCAAACACAAATTCGATGAGGAAGAACATCTACTCACCC
AATCGGTTAAGAATGAATATGGTGGGAAATTAGTCATCAATATCGATCAG
AAAATCAGTTGGATCAGAATCGAAATCAGAAAACTTTTCACTCCATCTGG
AATCAGCGAAATTGGAAAATTCAAAGTCAATAGTAAAATCTGGGGATGCT
TCTATGACTGTCACAGCAAGTCACGTAATTTCGGAGGTTGCAAATTACAA
AGTCTTCTGAAAAAAAATGGAGCAATATCAATAAAAAACATAAAATCAAG
GATGAGTGGTGTCAACAAAAAATTAACCAATAACAATGGATTAATACTGG
ATGTAGAATGTGGAAAATCCGTTAATTTACATCTAAGCACGGTTGGAGAA
ACAGGATTCCCGACATTCATAAGTGAAATGACAATAGTTGGAAAAGTCAA
AATATTGAAAGTCCTGAATAAACTTAATGCTCACGATACGATTAATTCAA
TTGAAAAAGTTATTATTTGCCAAAAGAAAAAAAGAATAATTTTTAGAAAA
CATTCAACATCAATGGATATACGAATGCGTACAAATAAATGCAAAGACAA
TGTAAAAAATAGAATTCGAATAAAAATAAAGGTCATCGGATGTATTTTCA
AAATGAAAGATTGCCAAAACGAAAATACCGATCAGACAACAAAACTAATA
AAGGTAAGACCAGGTAAAAATAAATTTGAAATACCGATAAAAAATGATTT
TGTCAAAAAGCTTATAAGCGAGATTAATATAGAAAAGACAACAATTGAAA
AAGAAGAACAAGAAATACAAAAATTGACAACAATAATAGAATTTAAAAAT
CCAAAAAATGGTAAAATACAAAAATATGTTATAAGAATGAAACGCGTGAG
TACGCGAGAAAAATTTAATTTAATATGCGTTTTACTGCAAAATGTTAAAA
AGATAAAGTTAAGAATAATAAGTAAACGTAAACTAACTCTAAGATTATCT
ATAAAAACAGGATGCAAATTCAAAAAAAGTAATCACGAAGCCAACAACTA
AACCTACTGGAACTAGACCAGGAAAGACAACAACTACAACTAGAAGAACA
ACGACTCTGAAACCATGTGCCGTGAAACTGGTAATCAAAGATAAACAATT
GACAGGAATTACAGTGACACCAAAGATTTCCAAGAGTGATGTTAAAAAAT
TGAGACCTGATTGGAAACATCCTAAACAAGGTGTTGACTTCAAACGTGGA
AAACACACAATTGTTGTCAAGATCATGAAAGGCACCAGACAGAAGAAACC
AAACAGAATCACAGCAGCCGGTTTGAAAGTCATCAATGTCAATCCAGGCG
ACAAATTGAGCAAATACTTCAAGTCCGTTACAATTGTAATTACGAAAGAA
AAATTCACAAGAGATGGAAAACGAAAGACTGTCAAGAAAACGATTAAAGT
ACCATTGAAAACGATTGTTGACGATTTGAAAAACGTTTTGAGAAAACCAC
ATCATTATGTGAAGAAAGTGACTATGAAATTTGAAGTGACGAAAGTTG
back to top

protein sequence of SMED30005324-orf-1

>SMED30005324-orf-1 ID=SMED30005324-orf-1|Name=SMED30005324-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=783bp
SVIFEIYSVEKLFMRQVTKILHGNCYAAFIILFLTTFSSALNLKNSECKI
IDGLQRPDIISEKYIYGGPNNCTKLPEQIRDRGSFWTTYVTDEDLINNVR
PRVAIDLTEGGIYPPVYVKKIEIFGNVAELRSWIKHYLSAVTSLDEACQV
KLKNGNHTIEINKKVSWLQFELISRFGESSVEEGGLFKLYFKIWGCFYNC
DDKPRLSLPGNCEIKNIFETNSIDESDVFINNKTSKEFIKTKGTLHIDCQ
HETSLDLDLTQNGQNFHSYISEIKINDWAGYIQAKYKSNIKSAYRFLESR
LIKRCKSDTQRIVFNSQASIIKLRFFSSHCSQKIKTIKVSIFGCFERIKG
CKLVDGLALKHMIPNDFIYGGPRNSDQIGLLIRDNQQGWSSTISMLDIKN
RQRPNFVVDLTHGNLHSPPFIRQVDIVGNVVDVSTWIKHKFDEEEHLLTQ
SVKNEYGGKLVINIDQKISWIRIEIRKLFTPSGISEIGKFKVNSKIWGCF
YDCHSKSRNFGGCKLQSLLKKNGAISIKNIKSRMSGVNKKLTNNNGLILD
VECGKSVNLHLSTVGETGFPTFISEMTIVGKVKILKVLNKLNAHDTINSI
EKVIICQKKKRIIFRKHSTSMDIRMRTNKCKDNVKNRIRIKIKVIGCIFK
MKDCQNENTDQTTKLIKVRPGKNKFEIPIKNDFVKKLISEINIEKTTIEK
EEQEIQKLTTIIEFKNPKNGKIQKYVIRMKRVSTREKFNLICVLLQNVKK
IKLRIISKRKLTLRLSIKTGCKFKKSNHEANN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 684..711
NoneNo IPR availableTMHMMTMhelixcoord: 20..42