Transient receptor potential cation channel, subfamily A, member 1a

Overview
NameTransient receptor potential cation channel, subfamily A, member 1a
Smed IDSMED30005315
Length (bp)3121
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel, subfamily A, member 1a (SMED30005315) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel, subfamily A, member 1a (SMED30005315) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel, subfamily A, member 1a (SMED30005315) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel, subfamily A, member 1a (SMED30005315) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005315

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 28

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30005315SMESG000014208.1 SmedASXL_001621SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005315SMESG000014208.1 SmedASXL_079406SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30005315SMESG000014208.1 dd_Smed_v4_28432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005315SMESG000014208.1 dd_Smed_v4_28432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005315SMESG000014208.1 dd_Smed_v4_28432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005315SMESG000014208.1 dd_Smed_v4_86413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005315SMESG000014208.1 dd_Smed_v4_86413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30005315SMESG000014208.1 dd_Smed_v4_86413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005315SMESG000014208.1 dd_Smed_v4_86413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005315SMESG000014208.1 dd_Smed_v4_59015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005315SMESG000014208.1 dd_Smed_v4_59015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005315SMESG000014208.1 dd_Smed_v4_59015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005315SMESG000014208.1 dd_Smed_v4_59015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005315SMESG000014208.1 dd_Smed_v4_81437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005315SMESG000014208.1 dd_Smed_v4_81437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005315SMESG000014208.1 dd_Smed_v4_81437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005315SMESG000014208.1 dd_Smed_v4_60518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005315SMESG000014208.1 dd_Smed_v4_60518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005315SMESG000014208.1 dd_Smed_v4_60518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005315SMESG000014208.1 dd_Smed_v4_60518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005315SMESG000014208.1 dd_Smed_v4_69068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005315SMESG000014208.1 dd_Smed_v4_69068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005315SMESG000014208.1 dd_Smed_v4_69068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005315SMESG000014208.1 dd_Smed_v6_28432_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005315SMESG000014208.1 dd_Smed_v6_59015_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005315SMESG000014208.1 dd_Smed_v6_81437_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005315SMESG000014208.1 dd_Smed_v6_69068_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005315 dd_Smed_v6_72326_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 226.868 bits (577), Expect = 2.249e-60
Identity = 246/975 (25.23%), Postives = 432/975 (44.31%), Query Frame = 2
Query:  197 IFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EPRSWDI-NTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFR--DINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG---KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQR------YYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXX---XXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            + YA   G +E ++ + +D     L  +D   N + LH AV +NQ + V +LL+   + N+     + P+H+A Q    E++++L + RT+ ++     G TA+ IAC   +S  ++ LL  GA   K        +H  A     E ++I+L +         +G +  +      HI  +N         NG  +             +  A+QN +LE++++CL NGA I+       T  H +A  G  E+ +L+      S DI NT D    T LH A       +   L+ +GAD+N  +   ++P+++A +S      ++ I+ +L+S  + + I+D   +   H  V++       Y ++ +  E + Q+  +++L         +PLHYA + G       LL         +++    +H A   G +N  + LL+   +TR     D++  + +H AA+ G  ++ + L++ G   L+ D  G   L  ++ GG    ++ IL   +   +  D+  NTALHFAA  GH + +  L  H A    N    S    AL N RK+VV   +    W + ++    N    K  I  +I+Y  E    LLD C+     +KS ++  I+Y F  L    +    +  +        AL +MV   ++ LL HP+    L  KW  +G    +++L      ++ +  +   I       +T  +NET+      + T+S  + +  +L   S+I+       G IF +   +R+ F        +I     +   +     IP   +W    + ++  +  FL ++Q   + GI + M   + KTL +  + F  L   FG +FYI+   Q PF   L S +++  M +G+ +Y   F+    +  LA P+L    ++ F +F+P    NL IGLAVGDI  +   A L+   ++VE    +E  L
Sbjct:   67 LHYAAAEGQIELMEKITRDSSLEVLHEMDDYGN-TPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRF------GEEHGYSRQL------HINFMN---------NGKATP------------LHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASA-----SWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQ------PYGLKNLRPEFM-QMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLS-DHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLSSIFGYCK-EAGQIFQQ---KRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKL 990          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 194.512 bits (493), Expect = 2.468e-50
Identity = 227/913 (24.86%), Postives = 394/913 (43.15%), Query Frame = 2
Query:  446 ILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EPRSWDI-NTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFR--DINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG---KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQR------YYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXX---XXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKR 3097
            +L + RT+ ++     G TA+ IAC   +S  ++ LL  GA   K        +H  A     E ++I+L +         +G +  +      HI  +N         NG  +             +  A+QN +LE++++CL NGA I+       T  H +A  G  E+ +L+      S DI NT D    T LH A       +   L+ +GAD+N  +   ++P+++A +S      ++ I+ +L+S  + + I+D   +   H  V++       Y ++ +  E + Q+  +++L         +PLHYA + G       LL         +++    +H A   G +N  + LL+   +TR     D++  + +H AA+ G  ++ + L++ G   L+ D  G   L  ++ GG    ++ IL   +   +  D+  NTALHFAA  GH + +  L  H A    N    S    AL N RK+VV   +    W + ++    N    K  I  +I+Y  E    LLD C+     +KS ++  I+Y F  L    +    +  +        AL +MV   ++ LL HP+    L  KW  +G    +++L      ++ +  +   I       +T  +NET+      + T+S  + +  +L   S+I+       G IF +   +R+ F        +I     +   +     IP   +W    + ++  +  FL ++Q   + GI + M   + KTL +  + F  L   FG +FYI+   Q PF   L S +++  M +G+ +Y   F+    +  LA P+L    ++ F +F+P    NL IGLAVGDI  +   A L+   ++VE    +E  L     R       I  P + R
Sbjct:    1 VLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFG------EEHGYSRQL------HINFMN---------NGKATP------------LHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATAS-----ASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQ------PYGLKNLRPEFM-QMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLS-DHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLSSIFGYCK-EAGQIFQQ---KRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPR 863          

HSP 2 Score: 83.9593 bits (206), Expect = 9.171e-16
Identity = 80/317 (25.24%), Postives = 147/317 (46.37%), Query Frame = 2
Query:  176 ESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNF--SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRR--GHSNMVETLLSYGASVNKL----ESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDT--LNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDI-NTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADV 1093
            E  +   I +A   G  E +K++    +   +  ++T +    ++LH A   +  ++  YL++   D+N + S+   P+ LA       IV +L  K   Q+D  D  G+  LH+  ++  G  N+    +     + +L    ++D  + LH+  R+     +  LL +   +  KS + ++P+  AA  G I     LL+       ++SDT  LNE D+ G + +  A +N + +V+Q+ L  GA   +   +G T  H ++M G+ +  ++I   +    + +D DGNT LH+A        V  LL   AD+
Sbjct:  121 EKGRCTAIHFAATQGATEIVKLMISS-YSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGA-QVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQM-QQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQ-------DISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDH-NGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADI 426          

HSP 3 Score: 65.4698 bits (158), Expect = 4.777e-10
Identity = 86/408 (21.08%), Postives = 161/408 (39.46%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAV---DVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNG--ADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGAD---VNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAEND---HLAIHLATKEGNLNVVK 1495
            LH AV     +++   L     ++ +       IH AA +   EIV+++    +  +D V   D   +T LH A    H  + + L+S GA +NK++S+                                 G++P+++A       ++N LL   K    ++ D      +       + ++N   E +Q+  +     D +N   DG T  H +   G       +   +  I++  +D  +PLH+A     +N   +LL+  +D   +N  +    TP+ +A        N ++ +  L+     L + D    T  H+       +T+K ++ T       +  +  D    + LH+AA+ G  +   +LL   AD  L  +     HLA+H   KE  L +++
Sbjct:   95 LHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSE---------------------------------GRSPLILATASASWNIVNLLLS--KGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDN---DGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLA------AKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTN-----LKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIR 453          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 185.652 bits (470), Expect = 7.489e-47
Identity = 142/534 (26.59%), Postives = 242/534 (45.32%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA-------------------------------CSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG 1813
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA +     D+++ LH  AR   + + +ILL + AP+  K+ NG +P+ +AA   H+  +  LL+   AE  +++       +D  + +  A    +  V ++ L  GA  N++ ++G T  H +       + EL+      I+ V   G TPLH A +   L IV  LL+ GA  N SN   +TP+ +A                               C++ +   N   ++K+L+  N+N  +      T  H      +++T+  L+   + +              +PLH AAK G + + ++LLE  A P    +N    +H+A    NL++VKLLL     + +    N  + +H AA++ + E+ R L++ G    A+   G   L L+A+ G+ ++V  +L  + N NL ++   T LH  A  GH+ V   L +HG
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLN-RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQ-YDAEIDDIT-------LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTN---MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGF------TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHG 724          

HSP 2 Score: 164.081 bits (414), Expect = 3.749e-40
Identity = 153/586 (26.11%), Postives = 261/586 (44.54%), Query Frame = 2
Query:  230 YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENGNV---------SDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLI--EVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLN 1903
            ++KMV + + K  +    T    + LH A    Q +VV  L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q  A +  G T L +A ++GH N+V  L++YG    K+   ++  LH  AR +D     +LL       + S  G TP+ IAA   ++ V   LL +                I +  GNV            +  K  D  + +  A +N ++ + +I L +GA I  K  +G +  H +A     +   L+     +I+ +  D  TPLH A +     +   LL+ GA  N+      TP+ +AC       N+  ++++L+   +++    E   T  H      ++  +K L++  +        N+ ++  ++PLH AA+ G  E+ K LL+  A     A++D   +H A + G+ N+VKLLLE N           + L H AA EG  E    L+  E    C+ K   G   L ++AK G + + E +L+   +PN   +   T LH A    +L+++K L   G       +N  +P   A   ++ +V +  L 
Sbjct:   90 HVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATE-DGFTPLAVALQQGHENVVAHLINYGTK-GKV---RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKK-----NHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASP------NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPL-HIAAREGHVETVLALLEKEASQACMTKK--GFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQ 656          

HSP 3 Score: 156.377 bits (394), Expect = 7.710e-38
Identity = 137/551 (24.86%), Postives = 248/551 (45.01%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       +   LL     +       + PIH+AAQ + ++ V +L +    +ID + +   T LH+A   GH  + + LL  GA  N    +  + LH   +KN + ++++LL   A +   + +G TP+ +A+  GH+ ++  LL++    + NVS+   E      + +  A +  + EV +  L N A +N K  D +T  H +A  G   + +L+   + + N     G+TPLH A     +  V+ LLE  A      +   TP+ VA            + ++L+  +++     +   T  H  V   N+  +K L+    G       N       +PLH AAK   +E+ + LL+ G      +      +HLA +EG+  +V LLL            N+S L  +H  A+EG   +   LI+ G+   A    G   L +++  GNI +V+++L+++ + N   +   + LH AA  GH +++  L ++GA
Sbjct:  267 FTPQNGITPLHIASRRGNVIMVRLL---LDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDA-EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVE------TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKY-----GKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWN-----GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLG---NKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 791          

HSP 4 Score: 154.836 bits (390), Expect = 2.715e-37
Identity = 137/504 (27.18%), Postives = 236/504 (46.83%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLK--TVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIE--VGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            +D+N      +  +HLA++   V++V  L  K  + ++    KG TALHIA   G   +V  L++YGA+VN       + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    NL V Q+ L  GA +N    +G T  H ++  G   +  L+  R   I T  +D  TPLH A  N  + I   LL+ GA +    +   +PI +A        ++ + +++L+  ++   I D  L   T  H      + +  K L+   +        N + L   +PLH A K   + + ++LL+ GA      E+    +H+A+  G+L +VK LL+    +    ++   + +H AA  G  E+ ++L++    ++  AKDD  +  L  +A+ G+ ++V+ +L+N  NPNL     +T LH AA  GH+E +  L
Sbjct:   69 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEII-LETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQG-----DHLDCVRLLLQYDAE--IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKP------NSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGA-SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDD--QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLAL 555          

HSP 5 Score: 152.14 bits (383), Expect = 1.770e-36
Identity = 130/510 (25.49%), Postives = 235/510 (46.08%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            T N  S +H A   +  D V  LL +  +++ +   ++ P+H+AA      + ++L  K   + ++  + G T LHIAC++ H  ++E LL  GAS++ +    ++ LH  +    L ++K LL   A   + +   +TP+ +AA  GH +V  +LL+  KA+       +N K  D  + +  A +  +  ++++ L N A+ N     G T  H +A  G  E    +  +      + + G TPLH A     + +   LLE  A  N + +   TP+ VA        NN +I+K+L+    +         T  H   ++  ++  + L++           N + +   +PLH AA+ G  E+  +LL   A+  L  ++    +HL  +EG++ V  +L++    ++  TR        + +H A+  G  ++ +FL++   D  AK   G + L  +A+ G+ DIV  +LKN  +PN       T L  A   G++ V   L
Sbjct:  335 TKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGA-KPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQN-KAK-------VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHH-----NNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS------ANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGY-----TPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 819          

HSP 6 Score: 120.553 bits (301), Expect = 7.648e-27
Identity = 115/472 (24.36%), Postives = 197/472 (41.74%), Query Frame = 2
Query:  287 VNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENG--NVSDTLNEKDIDGNSC-------ISFAIQNRNLEVLQICLLNGAD---------------------------------INNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRY 1528
            +N F+ LH A  +N   V+  LL     ++ +    + P+H+A+    + IV+ L + R    +  +VK +T LH+A R GH+ + + LL   A VN    D  + LH  AR     M+K+LL   A   + ++ G TP+ IAA EGH++ +  LLEK                + A+ G   V++ L E+D   N+        +  A+ + NL+++++ L  G                                    N + V G T  H +A  G  E+  L+  +  + N  ++ G TPLH       + +   L++ G  V+ + R+  TP+ VA                                   HY     NIK +K+L++  +       +N +     SPLH AA+ G  +I  +LL+ GA P   + +    + +A + G ++V  +L  +  ET +
Sbjct:  402 LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ-RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVAS----------------------------------HY----GNIKLVKFLLQHQAD------VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSF 828          

HSP 7 Score: 114.005 bits (284), Expect = 9.470e-25
Identity = 109/451 (24.17%), Postives = 205/451 (45.45%), Query Frame = 2
Query:  467 LQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
            + I+  +  G   LH+A + GH  MV  LL     +        + LH  A     E+++ L++Y A +  +S  G TP+ +AA E H++V+ FLLE     NG   +   E   DG + ++ A+Q  +  V+   +  G     +L       H +A         ++     + + + + G TPLH A +  +LN+   LL  GA VN + +   TP+ +A         N  ++++L+   + +  + +   T  H      +++  + L+   +       I  +     SP+H AA+   ++  ++LL+  A+      +    +H+A   G+  V K+LL+   +    R +N  + +H A ++    +   L++ G    A  + G   L +++  G++ IV+ +L+   +PN+ + K  T LH AA  GH EV K L ++ A+
Sbjct:   69 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-----NGANQNVATE---DGFTPLAVALQQGHENVVAHLINYGTKGKVRL----PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRR-----GNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAP------IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNS-RALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK 495          

HSP 8 Score: 103.605 bits (257), Expect = 1.311e-21
Identity = 78/281 (27.76%), Postives = 132/281 (46.98%), Query Frame = 2
Query:  197 IFYAVQHGNVE-YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA 1036
            +  A + G+VE  L ++ K+  + C+    T   F+ LH A    +  V   LL      N  G   + P+H+A   N ++IV++L   R     +    G T LHIA ++    +  +LL YG S N      ++ LH  A++   EM+ +LLS +A   + + +G TP+ + A EGH+ V + L+     ++G + D        G + +  A    N+++++  L + AD+N K   G +  H +A  G  ++  L+       N V  DG TPL  A
Sbjct:  540 LHIAAREGHVETVLALLEKEASQACM----TKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-----KHGVMVDATTRM---GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 807          

HSP 9 Score: 98.2117 bits (243), Expect = 5.811e-20
Identity = 93/367 (25.34%), Postives = 165/367 (44.96%), Query Frame = 2
Query:  815 GNSCISF--AIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV--SANSNLLIRD----------EKLKTVFHYLVE-----RINIKTIKYLIR---TISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN 1840
             ++  SF  A ++ NL+     L NG DIN    +G    H ++  G  ++   +  +   + T  + GNT LH A       +V +L+  GA+VN  ++   TP+ +A       +N+ E++K L+   AN N+   D          +  + V  +L+      ++ +  +    R   T +  +L Q     D+  K   +PLH AA   ++ + ++LL  GA      +N    +H+A++ GN+ +V+LLL+   +    +  +E + +H AA  G   I   L++ G    AK   G + + ++A+G ++D V  +L+     +       T LH AA  GH  V K L   GA+      N
Sbjct:   43 ADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ-----ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-KTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALN 403          

HSP 10 Score: 79.337 bits (194), Expect = 3.444e-14
Identity = 50/157 (31.85%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  281 DTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            ++V   + LH A  E   ++VA LL+ + + N+     + P+HL AQ   V + ++L K   + +DA    G T LH+A   G+  +V+ LL + A VN       S LH  A++   +++ +LL   A     SS+G TP+ IA   G+I V + L
Sbjct:  664 ESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 819          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 185.267 bits (469), Expect = 7.642e-47
Identity = 142/534 (26.59%), Postives = 242/534 (45.32%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA-------------------------------CSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG 1813
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA +     D+++ LH  AR   + + +ILL + AP+  K+ NG +P+ +AA   H+  +  LL+   AE  +++       +D  + +  A    +  V ++ L  GA  N++ ++G T  H +       + EL+      I+ V   G TPLH A +   L IV  LL+ GA  N SN   +TP+ +A                               C++ +   N   ++K+L+  N+N  +      T  H      +++T+  L+   + +              +PLH AAK G + + ++LLE  A P    +N    +H+A    NL++VKLLL     + +    N  + +H AA++ + E+ R L++ G    A+   G   L L+A+ G+ ++V  +L  + N NL ++   T LH  A  GH+ V   L +HG
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLN-RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQ-YDAEIDDIT-------LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTN---MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGF------TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHG 691          

HSP 2 Score: 164.081 bits (414), Expect = 3.574e-40
Identity = 153/585 (26.15%), Postives = 261/585 (44.62%), Query Frame = 2
Query:  230 YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENGNV---------SDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLI--EVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFL 1900
            ++KMV + + K  +    T    + LH A    Q +VV  L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q  A +  G T L +A ++GH N+V  L++YG    K+   ++  LH  AR +D     +LL       + S  G TP+ IAA   ++ V   LL +                I +  GNV            +  K  D  + +  A +N ++ + +I L +GA I  K  +G +  H +A     +   L+     +I+ +  D  TPLH A +     +   LL+ GA  N+      TP+ +AC       N+  ++++L+   +++    E   T  H      ++  +K L++  +        N+ ++  ++PLH AA+ G  E+ K LL+  A     A++D   +H A + G+ N+VKLLLE N           + L H AA EG  E    L+  E    C+ K   G   L ++AK G + + E +L+   +PN   +   T LH A    +L+++K L   G       +N  +P   A   ++ +V +  L
Sbjct:   57 HVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATE-DGFTPLAVALQQGHENVVAHLINYGTK-GKV---RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKK-----NHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASP------NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPL-HIAAREGHVETVLALLEKEASQACMTKK--GFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLL 622          

HSP 3 Score: 156.377 bits (394), Expect = 7.807e-38
Identity = 137/551 (24.86%), Postives = 248/551 (45.01%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       +   LL     +       + PIH+AAQ + ++ V +L +    +ID + +   T LH+A   GH  + + LL  GA  N    +  + LH   +KN + ++++LL   A +   + +G TP+ +A+  GH+ ++  LL++    + NVS+   E      + +  A +  + EV +  L N A +N K  D +T  H +A  G   + +L+   + + N     G+TPLH A     +  V+ LLE  A      +   TP+ VA            + ++L+  +++     +   T  H  V   N+  +K L+    G       N       +PLH AAK   +E+ + LL+ G      +      +HLA +EG+  +V LLL            N+S L  +H  A+EG   +   LI+ G+   A    G   L +++  GNI +V+++L+++ + N   +   + LH AA  GH +++  L ++GA
Sbjct:  234 FTPQNGITPLHIASRRGNVIMVRLL---LDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDA-EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVE------TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKY-----GKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWN-----GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLG---NKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 758          

HSP 4 Score: 154.836 bits (390), Expect = 2.163e-37
Identity = 138/505 (27.33%), Postives = 239/505 (47.33%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVE-IVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLK--TVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIE--VGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            +D+N      +  +HLA++   V+ +VE+L K+  + ++    KG TALHIA   G   +V  L++YGA+VN       + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    NL V Q+ L  GA +N    +G T  H ++  G   +  L+  R   I T  +D  TPLH A  N  + I   LL+ GA +    +   +PI +A        ++ + +++L+  ++   I D  L   T  H      + +  K L+   +        N + L   +PLH A K   + + ++LL+ GA      E+    +H+A+  G+L +VK LL+    +    ++   + +H AA  G  E+ ++L++    ++  AKDD  +  L  +A+ G+ ++V+ +L+N  NPNL     +T LH AA  GH+E +  L
Sbjct:   36 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKE--IILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQG-----DHLDCVRLLLQYDAE--IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKP------NSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGA-SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDD--QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLAL 522          

HSP 5 Score: 120.939 bits (302), Expect = 7.432e-27
Identity = 115/472 (24.36%), Postives = 197/472 (41.74%), Query Frame = 2
Query:  287 VNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENG--NVSDTLNEKDIDGNSC-------ISFAIQNRNLEVLQICLLNGAD---------------------------------INNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRY 1528
            +N F+ LH A  +N   V+  LL     ++ +    + P+H+A+    + IV+ L + R    +  +VK +T LH+A R GH+ + + LL   A VN    D  + LH  AR     M+K+LL   A   + ++ G TP+ IAA EGH++ +  LLEK                + A+ G   V++ L E+D   N+        +  A+ + NL+++++ L  G                                    N + V G T  H +A  G  E+  L+  +  + N  ++ G TPLH       + +   L++ G  V+ + R+  TP+ VA                                   HY     NIK +K+L++  +       +N +     SPLH AA+ G  +I  +LL+ GA P   + +    + +A + G ++V  +L  +  ET +
Sbjct:  369 LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ-RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVAS----------------------------------HY----GNIKLVKFLLQHQAD------VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSF 795          

HSP 6 Score: 114.005 bits (284), Expect = 8.600e-25
Identity = 109/451 (24.17%), Postives = 205/451 (45.45%), Query Frame = 2
Query:  467 LQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
            + I+  +  G   LH+A + GH  MV  LL     +        + LH  A     E+++ L++Y A +  +S  G TP+ +AA E H++V+ FLLE     NG   +   E   DG + ++ A+Q  +  V+   +  G     +L       H +A         ++     + + + + G TPLH A +  +LN+   LL  GA VN + +   TP+ +A         N  ++++L+   + +  + +   T  H      +++  + L+   +       I  +     SP+H AA+   ++  ++LL+  A+      +    +H+A   G+  V K+LL+   +    R +N  + +H A ++    +   L++ G    A  + G   L +++  G++ IV+ +L+   +PN+ + K  T LH AA  GH EV K L ++ A+
Sbjct:   36 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-----NGANQNVATE---DGFTPLAVALQQGHENVVAHLINYGTKGKVRL----PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRR-----GNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAP------IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNS-RALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK 462          

HSP 7 Score: 103.605 bits (257), Expect = 1.286e-21
Identity = 78/281 (27.76%), Postives = 132/281 (46.98%), Query Frame = 2
Query:  197 IFYAVQHGNVE-YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA 1036
            +  A + G+VE  L ++ K+  + C+    T   F+ LH A    +  V   LL      N  G   + P+H+A   N ++IV++L   R     +    G T LHIA ++    +  +LL YG S N      ++ LH  A++   EM+ +LLS +A   + + +G TP+ + A EGH+ V + L+     ++G + D        G + +  A    N+++++  L + AD+N K   G +  H +A  G  ++  L+       N V  DG TPL  A
Sbjct:  507 LHIAAREGHVETVLALLEKEASQACM----TKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-----KHGVMVDATTRM---GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 8 Score: 99.7525 bits (247), Expect = 2.168e-20
Identity = 92/369 (24.93%), Postives = 165/369 (44.72%), Query Frame = 2
Query:  803 KDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV--SANSNLLIRD----------EKLKTVFHYLVE-----RINIKTIKYLIR---TISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN 1840
            ++ D  +    A ++ NL+     L NG DIN    +G    H ++  G  ++   +  +   + T  + GNT LH A       +V +L+  GA+VN  ++   TP+ +A       +N+ E++K L+   AN N+   D          +  + V  +L+      ++ +  +    R   T +  +L Q     D+  K   +PLH AA   ++ + ++LL  GA      +N    +H+A++ GN+ +V+LLL+   +    +  +E + +H AA  G   I   L++ G    AK   G + + ++A+G ++D V  +L+     +       T LH AA  GH  V K L   GA+      N
Sbjct:    8 READAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ-----ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-KTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALN 370          

HSP 9 Score: 79.7221 bits (195), Expect = 3.054e-14
Identity = 50/157 (31.85%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  281 DTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            ++V   + LH A  E   ++VA LL+ + + N+     + P+HL AQ   V + ++L K   + +DA    G T LH+A   G+  +V+ LL + A VN       S LH  A++   +++ +LL   A     SS+G TP+ IA   G+I V + L
Sbjct:  631 ESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 185.267 bits (469), Expect = 9.820e-47
Identity = 142/534 (26.59%), Postives = 242/534 (45.32%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA-------------------------------CSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG 1813
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA +     D+++ LH  AR   + + +ILL + AP+  K+ NG +P+ +AA   H+  +  LL+   AE       +++  +D  + +  A    +  V ++ L  GA  N++ ++G T  H +       + EL+      I+ V   G TPLH A +   L IV  LL+ GA  N SN   +TP+ +A                               C++ +   N   ++K+L+  N+N  +      T  H      +++T+  L+   + +              +PLH AAK G + + ++LLE  A P    +N    +H+A    NL++VKLLL     + +    N  + +H AA++ + E+ R L++ G    A+   G   L L+A+ G+ ++V  +L  + N NL ++   T LH  A  GH+ V   L +HG
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLN-RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQ-YDAE-------IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTN---MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGF------TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHG 691          

HSP 2 Score: 163.696 bits (413), Expect = 4.466e-40
Identity = 152/586 (25.94%), Postives = 261/586 (44.54%), Query Frame = 2
Query:  230 YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENGNV---------SDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLI--EVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLN 1903
            ++KMV + + K  +    T    + LH A    Q +VV  L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q  A +  G T L +A ++GH N+V  L++YG    K+   ++  LH  AR +D     +LL       + S  G TP+ IAA   ++ V   LL +                I +  GNV            +  K  D  + +  A +N ++ + +I L +GA I  K  +G +  H +A     +   L+     +I+ +  D  TPLH A +     +   LL+ GA  N+      TP+ +AC       N+  ++++L+   +++    E   T  H      ++  +K L++  +        N+ ++  ++PLH AA+ G  E+ K LL+  A     A++D   +H A + G+ N+VKLLLE N           + L H AA EG  E    L+  E    C+ K  +    L ++AK G + + E +L+   +PN   +   T LH A    +L+++K L   G       +N  +P   A   ++ +V +  L 
Sbjct:   57 HVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATE-DGFTPLAVALQQGHENVVAHLINYGTK-GKV---RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKK-----NHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASP------NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPL-HIAAREGHVETVLALLEKEASQACMTKKGF--TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQ 623          

HSP 3 Score: 155.992 bits (393), Expect = 9.343e-38
Identity = 137/551 (24.86%), Postives = 248/551 (45.01%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       +   LL     +       + PIH+AAQ + ++ V +L +    +ID + +   T LH+A   GH  + + LL  GA  N    +  + LH   +KN + ++++LL   A +   + +G TP+ +A+  GH+ ++  LL++    + NVS+   E      + +  A +  + EV +  L N A +N K  D +T  H +A  G   + +L+   + + N     G+TPLH A     +  V+ LLE  A      +   TP+ VA            + ++L+  +++     +   T  H  V   N+  +K L+    G       N       +PLH AAK   +E+ + LL+ G      +      +HLA +EG+  +V LLL            N+S L  +H  A+EG   +   LI+ G+   A    G   L +++  GNI +V+++L+++ + N   +   + LH AA  GH +++  L ++GA
Sbjct:  234 FTPQNGITPLHIASRRGNVIMVRLL---LDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDA-EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVE------TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKY-----GKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWN-----GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLG---NKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 758          

HSP 4 Score: 154.836 bits (390), Expect = 2.749e-37
Identity = 138/505 (27.33%), Postives = 239/505 (47.33%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVE-IVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLK--TVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIE--VGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            +D+N      +  +HLA++   V+ +VE+L K+  + ++    KG TALHIA   G   +V  L++YGA+VN       + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    NL V Q+ L  GA +N    +G T  H ++  G   +  L+  R   I T  +D  TPLH A  N  + I   LL+ GA +    +   +PI +A        ++ + +++L+  ++   I D  L   T  H      + +  K L+   +        N + L   +PLH A K   + + ++LL+ GA      E+    +H+A+  G+L +VK LL+    +    ++   + +H AA  G  E+ ++L++    ++  AKDD  +  L  +A+ G+ ++V+ +L+N  NPNL     +T LH AA  GH+E +  L
Sbjct:   36 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKE--IILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQG-----DHLDCVRLLLQYDAE--IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKP------NSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGA-SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDD--QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLAL 522          

HSP 5 Score: 120.939 bits (302), Expect = 6.652e-27
Identity = 115/473 (24.31%), Postives = 197/473 (41.65%), Query Frame = 2
Query:  287 VNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENG--NVSDTLNEKDIDGNSC-------ISFAIQNRNLEVLQICLLNGAD---------------------------------INNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYF 1531
            +N F+ LH A  +N   V+  LL     ++ +    + P+H+A+    + IV+ L + R    +  +VK +T LH+A R GH+ + + LL   A VN    D  + LH  AR     M+K+LL   A   + ++ G TP+ IAA EGH++ +  LLEK                + A+ G   V++ L E+D   N+        +  A+ + NL+++++ L  G                                    N + V G T  H +A  G  E+  L+  +  + N  ++ G TPLH       + +   L++ G  V+ + R+  TP+ VA                                   HY     NIK +K+L++  +       +N +     SPLH AA+ G  +I  +LL+ GA P   + +    + +A + G ++V  +L  +  ET + 
Sbjct:  369 LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ-RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVAS----------------------------------HY----GNIKLVKFLLQHQAD------VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFV 796          

HSP 6 Score: 113.62 bits (283), Expect = 1.109e-24
Identity = 109/452 (24.12%), Postives = 205/452 (45.35%), Query Frame = 2
Query:  467 LQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF 1822
            + I+  +  G   LH+A + GH  MV  LL     +        + LH  A     E+++ L++Y A +  +S  G TP+ +AA E H++V+ FLLE     NG   +   E   DG + ++ A+Q  +  V+   +  G     +L       H +A         ++     + + + + G TPLH A +  +LN+   LL  GA VN + +   TP+ +A         N  ++++L+   + +  + +   T  H      +++  + L+   +       I  +     SP+H AA+   ++  ++LL+  A+      +    +H+A   G+  V K+LL+   +    R +N  + +H A ++    +   L++ G    A  + G   L +++  G++ IV+ +L+   +PN+ + K  T LH AA  GH EV K L ++ A+ 
Sbjct:   36 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-----NGANQNVATE---DGFTPLAVALQQGHENVVAHLINYGTKGKVRL----PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRR-----GNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAP------IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNS-RALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV 463          

HSP 7 Score: 103.605 bits (257), Expect = 1.376e-21
Identity = 78/281 (27.76%), Postives = 132/281 (46.98%), Query Frame = 2
Query:  197 IFYAVQHGNVE-YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA 1036
            +  A + G+VE  L ++ K+  + C+    T   F+ LH A    +  V   LL      N  G   + P+H+A   N ++IV++L   R     +    G T LHIA ++    +  +LL YG S N      ++ LH  A++   EM+ +LLS +A   + + +G TP+ + A EGH+ V + L+     ++G + D        G + +  A    N+++++  L + AD+N K   G +  H +A  G  ++  L+       N V  DG TPL  A
Sbjct:  507 LHIAAREGHVETVLALLEKEASQACM----TKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-----KHGVMVDATTRM---GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 8 Score: 99.3673 bits (246), Expect = 2.420e-20
Identity = 92/369 (24.93%), Postives = 165/369 (44.72%), Query Frame = 2
Query:  803 KDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV--SANSNLLIRD----------EKLKTVFHYLVE-----RINIKTIKYLIR---TISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN 1840
            ++ D  +    A ++ NL+     L NG DIN    +G    H ++  G  ++   +  +   + T  + GNT LH A       +V +L+  GA+VN  ++   TP+ +A       +N+ E++K L+   AN N+   D          +  + V  +L+      ++ +  +    R   T +  +L Q     D+  K   +PLH AA   ++ + ++LL  GA      +N    +H+A++ GN+ +V+LLL+   +    +  +E + +H AA  G   I   L++ G    AK   G + + ++A+G ++D V  +L+     +       T LH AA  GH  V K L   GA+      N
Sbjct:    8 READAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ-----ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-KTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALN 370          

HSP 9 Score: 79.337 bits (194), Expect = 3.106e-14
Identity = 50/157 (31.85%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  281 DTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            ++V   + LH A  E   ++VA LL+ + + N+     + P+HL AQ   V + ++L K   + +DA    G T LH+A   G+  +V+ LL + A VN       S LH  A++   +++ +LL   A     SS+G TP+ IA   G+I V + L
Sbjct:  631 ESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Celegans
Match: trpa-1 (Transient receptor potential cation channel subfamily A member 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18297])

HSP 1 Score: 192.971 bits (489), Expect = 6.559e-50
Identity = 250/1064 (23.50%), Postives = 450/1064 (42.29%), Query Frame = 2
Query:  197 IFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYA-------------VNENQKD-----------VVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSN-----GQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTI-FHTSAMTGFGELFE-LIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYE-IIKILVSANSNLLIRDEKLKTVFHYLVERINIKT-IKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEY-------RHENG-----KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAG------PDDPSSSG----------------------------QRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEF------VLKLNSA----IYSLTLFRLGIIFIKLLTERSRFFQDQYCF-----SFIFCALYVFLFIKNLRNIPCLN--------EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPT---------KYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQR 3052
            + YA ++GN + +K++   + KN L         + LH A             ++E+Q D           ++  L++   +++ +    + P+H AA ++    +  L K +   +DA D    T L +AC  G   +++ L+   ++V K +    +V H  A + + E +++++ +     IK+ N      +TP+ +A    H + L  +L+  K  +    D   EK++     I FA +   LEVL+  +  G +  N+L + K +  H +A     E+   LIE    +I+ VD  G TPL  AV +     V  L+   A++  +++  +TP+ +      N  ++ E I+  L   N                  ER  +K+  +  +R +S ++   ++N+ D    +P+H  A  G +E+ ++L + GA      E++  A+H A   G    V+ LLE ++     +D   +S +H AA  G     + L++ G D  AK+ Y +  L ++   G ++  + ++            K T LH AA  G+  +++     G    + +    + FD A  N  KDV + FL  D WK  M         +H N      ++   +L+    E+   ++D CI E    ++D    + Y F  LD         DD +                                +Y+ L  M   +KL+LL HPLS  LL+ KW + G       L +Y+++I+++            T  V  T       N+ S    DSE+        ++N+     ++ + +  L +   ++L E  + FQ ++ +     ++I C +Y    I       C          +W  A + +F  +   L+ I+ +P  GI V MF  + KT  + F  F      F  +FY+I +++  F  I  S LK+ VM +GEF++   F    T          ++  A  L  +F + M     NL +GLAV DI  +  +AEL+   ++V+ V ++E +L   IQR
Sbjct:   87 LHYAARYGNYDAVKLL---LSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKA-DVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMD--REKEL-----IHFAAEKGFLEVLKALVEAGGN-KNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAK--FNALSSVEYILDHLRKKNKE---------------TERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIESSSDTK-TVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCI-EKSKEETDSTQSVAYNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSL------------TQYVRHTKAPYNVWNEESY--YDSEYFDENETCPQINTTKPDVVWKIIIQTLAV--CQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQR 1103          

HSP 2 Score: 113.235 bits (282), Expect = 4.783e-25
Identity = 120/506 (23.72%), Postives = 214/506 (42.29%), Query Frame = 2
Query:  497 QTALHIACRRGHSNMV-ETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAA--IEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPL----------------------------------HYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYIL-----KNKINP------------------------NLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            ++ +H + R G+ N + E LL    +VN  + D ++ LH+ AR  + + +K+LLS  A    K+  G TP+ IA+  I G+  + + ++++ +A++    +T  +K I+       A+ + N E                                            I+ V++   TPLHYA   ++ + +  L+++ ADV+  +    TP+++AC        + EII+ L+ ANSN+  RD++L TVFH +  R   + ++ ++     E + + +NL +   K+PL                                  H+AA+ G +E+ K L+EAG +     E   + +H+A +   L VV  L+E   +     D    + +  A      +   +LI    +    D   R  + + AK   +  VEYIL     KNK                           N+ D+ +NT +H  AS G+LE+++ L +HGA
Sbjct:   50 RSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICS-IIDEDQADSARKYNTATKKIIN-------ALVSENAE--------------------------------------------IDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLAC-----VHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAI-KALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGA 497          

HSP 3 Score: 64.6994 bits (156), Expect = 3.590e-10
Identity = 57/223 (25.56%), Postives = 96/223 (43.05%), Query Frame = 2
Query: 1322 INLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATK---------------------EGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG---ARFQDNLFN---LSPFDEALANSRKDVVKYFLN 1903
            +N QD  F +PLHYAA+ G+ +  K+LL   A P          +H+A+K                     + N    K++  +  E      +N+  L  +H+AA +  +     LI++  D  A+DD     L+L+   G+ +I++ ++K   N    DQ+ NT  H  A  G  E ++ +  H    A    NLFN    +P   A+  +  + +K  L 
Sbjct:   76 VNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQ 298          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Celegans
Match: trpa-1 (Transient receptor potential cation channel subfamily A member 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18297])

HSP 1 Score: 192.971 bits (489), Expect = 8.465e-50
Identity = 250/1064 (23.50%), Postives = 450/1064 (42.29%), Query Frame = 2
Query:  197 IFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYA-------------VNENQKD-----------VVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSN-----GQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTI-FHTSAMTGFGELFE-LIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYE-IIKILVSANSNLLIRDEKLKTVFHYLVERINIKT-IKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEY-------RHENG-----KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAG------PDDPSSSG----------------------------QRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEF------VLKLNSA----IYSLTLFRLGIIFIKLLTERSRFFQDQYCF-----SFIFCALYVFLFIKNLRNIPCLN--------EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPT---------KYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQR 3052
            + YA ++GN + +K++   + KN L         + LH A             ++E+Q D           ++  L++   +++ +    + P+H AA ++    +  L K +   +DA D    T L +AC  G   +++ L+   ++V K +    +V H  A + + E +++++ +     IK+ N      +TP+ +A    H + L  +L+  K  +    D   EK++     I FA +   LEVL+  +  G +  N+L + K +  H +A     E+   LIE    +I+ VD  G TPL  AV +     V  L+   A++  +++  +TP+ +      N  ++ E I+  L   N                  ER  +K+  +  +R +S ++   ++N+ D    +P+H  A  G +E+ ++L + GA      E++  A+H A   G    V+ LLE ++     +D   +S +H AA  G     + L++ G D  AK+ Y +  L ++   G ++  + ++            K T LH AA  G+  +++     G    + +    + FD A  N  KDV + FL  D WK  M         +H N      ++   +L+    E+   ++D CI E    ++D    + Y F  LD         DD +                                +Y+ L  M   +KL+LL HPLS  LL+ KW + G       L +Y+++I+++            T  V  T       N+ S    DSE+        ++N+     ++ + +  L +   ++L E  + FQ ++ +     ++I C +Y    I       C          +W  A + +F  +   L+ I+ +P  GI V MF  + KT  + F  F      F  +FY+I +++  F  I  S LK+ VM +GEF++   F    T          ++  A  L  +F + M     NL +GLAV DI  +  +AEL+   ++V+ V ++E +L   IQR
Sbjct:   88 LHYAARYGNYDAVKLL---LSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKA-DVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMD--REKEL-----IHFAAEKGFLEVLKALVEAGGN-KNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAK--FNALSSVEYILDHLRKKNKE---------------TERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIESSSDTK-TVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCI-EKSKEETDSTQSVAYNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSL------------TQYVRHTKAPYNVWNEESY--YDSEYFDENETCPQINTTKPDVVWKIIIQTLAV--CQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQR 1104          

HSP 2 Score: 112.849 bits (281), Expect = 5.486e-25
Identity = 120/506 (23.72%), Postives = 214/506 (42.29%), Query Frame = 2
Query:  497 QTALHIACRRGHSNMV-ETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAA--IEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPL----------------------------------HYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYIL-----KNKINP------------------------NLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            ++ +H + R G+ N + E LL    +VN  + D ++ LH+ AR  + + +K+LLS  A    K+  G TP+ IA+  I G+  + + ++++ +A++    +T  +K I+       A+ + N E                                            I+ V++   TPLHYA   ++ + +  L+++ ADV+  +    TP+++AC        + EII+ L+ ANSN+  RD++L TVFH +  R   + ++ ++     E + + +NL +   K+PL                                  H+AA+ G +E+ K L+EAG +     E   + +H+A +   L VV  L+E   +     D    + +  A      +   +LI    +    D   R  + + AK   +  VEYIL     KNK                           N+ D+ +NT +H  AS G+LE+++ L +HGA
Sbjct:   51 RSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICS-IIDEDQADSARKYNTATKKIIN-------ALVSENAE--------------------------------------------IDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLAC-----VHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAI-KALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGA 498          

HSP 3 Score: 64.6994 bits (156), Expect = 3.843e-10
Identity = 57/223 (25.56%), Postives = 96/223 (43.05%), Query Frame = 2
Query: 1322 INLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATK---------------------EGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG---ARFQDNLFN---LSPFDEALANSRKDVVKYFLN 1903
            +N QD  F +PLHYAA+ G+ +  K+LL   A P          +H+A+K                     + N    K++  +  E      +N+  L  +H+AA +  +     LI++  D  A+DD     L+L+   G+ +I++ ++K   N    DQ+ NT  H  A  G  E ++ +  H    A    NLFN    +P   A+  +  + +K  L 
Sbjct:   77 VNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQ 299          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 169.474 bits (428), Expect = 3.448e-42
Identity = 150/570 (26.32%), Postives = 254/570 (44.56%), Query Frame = 2
Query:  278 LDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRT--------LQI--------------------DAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK-----IKAENG-------------NVSDTL-------NEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            + +VN F+ L+ A  EN ++VV YLL    +  +       P+ +A Q+    +V +L +  +        L I                    D     G T LHIA   GH N+ + LL  GA+VN      IS LH   +     M  +LLS  A +  ++ +  TP+  AA  GH +V++ L+ +      K +NG             + + TL       ++  +D  + +  A    ++ V ++ L   AD N++ ++G T  H +      ++ EL+      I      G TPLH A +   +NIVI LL+ GA+ +      +TP+ +A  +     N  +++++L+   + +  +  +L+T  H      N   +  L++  +          +D Y  SPLH AAK G  E+  +LL+  AD  L  +     +HLA+K GNL VV+LLLE    +++E +     N+ + +H AA     ++   L+E G    A    G   L ++AK   ++I   +L+ K +PN   +   T LH +A  GH E+   L  +G+
Sbjct:  127 VQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARA-----NQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN----ATTRDNY--SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK-----NQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS 680          

HSP 2 Score: 169.474 bits (428), Expect = 4.164e-42
Identity = 144/571 (25.22%), Postives = 259/571 (45.36%), Query Frame = 2
Query:  290 NNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGEL--FELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTD-----------------NNY------------EIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLND 1906
            + F+ LH A +   ++V   LL    +VN     N+ P+H+A +     +  +L  +  + ID+      T LH A R GH  +V+ L+  GA ++    + ++ LH  A+ + ++  + LL ++AP+   + +  TP+ +AA  GH++V   LL++        S   N + ++G + +  A +   ++V+++ L   A I      G T  H +A  G   +  + L +  + D+ TV   G TPLH A      ++V  L+  GA V+   R  QTP+ +A S L NTD                 +NY            E+  IL+  N++  +  +K  T  H   +  N++ ++ L+   +       ++++     +PLH AA   + ++  +LLE GA  K  A+N +  +H+A K+  + +   LL+   +         + L H +A+EG  EI   LIE G D  AK + G   + L A+  ++ + + +  N    N       T LH A   G L ++K L  +GA   +    + +P  +A      + V+Y L +
Sbjct:  226 SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI-IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR--------SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR--GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIA-SRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPL-HLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN 777          

HSP 3 Score: 157.147 bits (396), Expect = 2.299e-38
Identity = 147/563 (26.11%), Postives = 253/563 (44.94%), Query Frame = 2
Query:  341 VAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLY--FKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLF-NLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKY-NEEITIELLDK 2011
            V  LL    D+N   +  +  +HLA++    E+V  L K R  Q+DA   KG TALHIA   G S +V  L+  GA+VN    +  + L+  A++N  E++K LL + A   + + +G TP+ +A  +GH +V+  LLE        +         D  +  +  +QN           +  D+ +K   G T  H +A  G   + +L+  +  ++N   R   +PLH A      N+   LL  GA +++  +   TP+  A  S      + +++ +LV   + +  + +      H   +  ++   + L        L+    + D+   + +PLH AA  G + + K+LL+  ADP   A N    +H+A K+  + VV+LLL+            ES L  +H AA  G   I  +L++ G +   +   G   L L+A+    D+V  +++N    +   ++  T LH A+  G+ +++  L + GA        N SP   A    +++V    L D N  KT+  +      H+ S  KY N E+   LL++
Sbjct:   49 VLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIK-RQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNE----------HNPDVTSK--SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARS-----GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL--------LYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA---IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL-DHNADKTLLTKKGFTPLHLAS--KYGNLEVVRLLLER 579          

HSP 4 Score: 144.821 bits (364), Expect = 1.444e-34
Identity = 132/530 (24.91%), Postives = 233/530 (43.96%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISG---------------------EILFQLINLQ-DLYFKS-----PLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL----EINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            LH A       VV  L+     ++      + P+H+AAQ + V+    L   R   +D V V   T LH+A   GH  + + LL   A  N    +  + LH   +KN ++++++LL Y+A +   + +G TP+ +AA  G I ++ +LL++    N +V      + + G + +  A +    +V+++ + NGA ++ +  + +T  H ++  G  ++  L+     + N   RD  +PLH A       +   LL+  AD     +   TP+ +A         N E++++L+   + + I  +   T  H      N K    L+   +                      EI   L+  + D   KS     PLH +A+ G  EI  +L+E G+D    A N   A+HL  +E ++ V ++L     EIN +T         + +H A   G+  + +FL+E G D   K       L  +A+ G+ + V Y+L+N  +PN       T L  A   G++ V++ L
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ--GANPDV------ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKY-----GNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTN-----AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 113.62 bits (283), Expect = 5.781e-25
Identity = 105/409 (25.67%), Postives = 180/409 (44.01%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCIS---FAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLL 1501
            T +  + LH A      ++V YLL    + ++   +   P+HLAA+ N  ++V +L +    ++DA   + QT LHIA R G++++V  LL  GA+ N    D  S LH  A++   E+  ILL + A   + +  G TP+ +A+  G+++V+  LLE+               DI+G + ++    A    N +V  + L NGA       +G T  H +A     E+   +     D N   R G TPLH +       I   L+E G+DV        T +      L   +++  + +IL +  + +  +     T  H       +  +K+L+   +       +  +     +PLH AA+ G     + LLE GA P          + +A + G ++VV+ L
Sbjct:  422 TESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGA-KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER-----------GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAM-----HLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGAD------VGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 100.138 bits (248), Expect = 7.266e-21
Identity = 104/407 (25.55%), Postives = 174/407 (42.75%), Query Frame = 2
Query:  812 DGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIR--------------------TISGEILFQLINLQDLYFKS---PLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG 1948
            +G++    A +  +LE +   L  G DIN    +G    H ++  G  E+   +  R   ++   R GNT LH A       IV  L+E GA+VN  +    TP+ +A       +N+ E++K L+   +N  +  E   T     +++ + + +  L+                     T +  +L Q  +  D+  KS   PLH AA  G   + ++LLE GA+    A ++   +H+ATK G  N+  LLL     I+  T+     +  + +H AA  G  ++   L+  G    AK   G   L ++A+G ++D    +L ++   +       T LH AA  GH+ V K L    A       N  +P   A   +R  VV+  L    ++  +E   E+G
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-----ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK-----DLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESG 425          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 169.474 bits (428), Expect = 3.448e-42
Identity = 150/570 (26.32%), Postives = 254/570 (44.56%), Query Frame = 2
Query:  278 LDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRT--------LQI--------------------DAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK-----IKAENG-------------NVSDTL-------NEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            + +VN F+ L+ A  EN ++VV YLL    +  +       P+ +A Q+    +V +L +  +        L I                    D     G T LHIA   GH N+ + LL  GA+VN      IS LH   +     M  +LLS  A +  ++ +  TP+  AA  GH +V++ L+ +      K +NG             + + TL       ++  +D  + +  A    ++ V ++ L   AD N++ ++G T  H +      ++ EL+      I      G TPLH A +   +NIVI LL+ GA+ +      +TP+ +A  +     N  +++++L+   + +  +  +L+T  H      N   +  L++  +          +D Y  SPLH AAK G  E+  +LL+  AD  L  +     +HLA+K GNL VV+LLLE    +++E +     N+ + +H AA     ++   L+E G    A    G   L ++AK   ++I   +L+ K +PN   +   T LH +A  GH E+   L  +G+
Sbjct:  127 VQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARA-----NQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN----ATTRDNY--SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK-----NQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS 680          

HSP 2 Score: 169.474 bits (428), Expect = 4.164e-42
Identity = 144/571 (25.22%), Postives = 259/571 (45.36%), Query Frame = 2
Query:  290 NNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGEL--FELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTD-----------------NNY------------EIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLND 1906
            + F+ LH A +   ++V   LL    +VN     N+ P+H+A +     +  +L  +  + ID+      T LH A R GH  +V+ L+  GA ++    + ++ LH  A+ + ++  + LL ++AP+   + +  TP+ +AA  GH++V   LL++        S   N + ++G + +  A +   ++V+++ L   A I      G T  H +A  G   +  + L +  + D+ TV   G TPLH A      ++V  L+  GA V+   R  QTP+ +A S L NTD                 +NY            E+  IL+  N++  +  +K  T  H   +  N++ ++ L+   +       ++++     +PLH AA   + ++  +LLE GA  K  A+N +  +H+A K+  + +   LL+   +         + L H +A+EG  EI   LIE G D  AK + G   + L A+  ++ + + +  N    N       T LH A   G L ++K L  +GA   +    + +P  +A      + V+Y L +
Sbjct:  226 SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI-IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR--------SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR--GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIA-SRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP------VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPL-HLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN 777          

HSP 3 Score: 157.147 bits (396), Expect = 2.299e-38
Identity = 147/563 (26.11%), Postives = 253/563 (44.94%), Query Frame = 2
Query:  341 VAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLY--FKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLF-NLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKY-NEEITIELLDK 2011
            V  LL    D+N   +  +  +HLA++    E+V  L K R  Q+DA   KG TALHIA   G S +V  L+  GA+VN    +  + L+  A++N  E++K LL + A   + + +G TP+ +A  +GH +V+  LLE        +         D  +  +  +QN           +  D+ +K   G T  H +A  G   + +L+  +  ++N   R   +PLH A      N+   LL  GA +++  +   TP+  A  S      + +++ +LV   + +  + +      H   +  ++   + L        L+    + D+   + +PLH AA  G + + K+LL+  ADP   A N    +H+A K+  + VV+LLL+            ES L  +H AA  G   I  +L++ G +   +   G   L L+A+    D+V  +++N    +   ++  T LH A+  G+ +++  L + GA        N SP   A    +++V    L D N  KT+  +      H+ S  KY N E+   LL++
Sbjct:   49 VLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIK-RQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNE----------HNPDVTSK--SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARS-----GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL--------LYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA---IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL-DHNADKTLLTKKGFTPLHLAS--KYGNLEVVRLLLER 579          

HSP 4 Score: 144.821 bits (364), Expect = 1.444e-34
Identity = 132/530 (24.91%), Postives = 233/530 (43.96%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISG---------------------EILFQLINLQ-DLYFKS-----PLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL----EINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            LH A       VV  L+     ++      + P+H+AAQ + V+    L   R   +D V V   T LH+A   GH  + + LL   A  N    +  + LH   +KN ++++++LL Y+A +   + +G TP+ +AA  G I ++ +LL++    N +V      + + G + +  A +    +V+++ + NGA ++ +  + +T  H ++  G  ++  L+     + N   RD  +PLH A       +   LL+  AD     +   TP+ +A         N E++++L+   + + I  +   T  H      N K    L+   +                      EI   L+  + D   KS     PLH +A+ G  EI  +L+E G+D    A N   A+HL  +E ++ V ++L     EIN +T         + +H A   G+  + +FL+E G D   K       L  +A+ G+ + V Y+L+N  +PN       T L  A   G++ V++ L
Sbjct:  297 LHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ--GANPDV------ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKY-----GNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTN-----AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 113.62 bits (283), Expect = 5.781e-25
Identity = 105/409 (25.67%), Postives = 180/409 (44.01%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCIS---FAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLL 1501
            T +  + LH A      ++V YLL    + ++   +   P+HLAA+ N  ++V +L +    ++DA   + QT LHIA R G++++V  LL  GA+ N    D  S LH  A++   E+  ILL + A   + +  G TP+ +A+  G+++V+  LLE+               DI+G + ++    A    N +V  + L NGA       +G T  H +A     E+   +     D N   R G TPLH +       I   L+E G+DV        T +      L   +++  + +IL +  + +  +     T  H       +  +K+L+   +       +  +     +PLH AA+ G     + LLE GA P          + +A + G ++VV+ L
Sbjct:  422 TESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGA-KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER-----------GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAM-----HLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGAD------VGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 100.138 bits (248), Expect = 7.266e-21
Identity = 104/407 (25.55%), Postives = 174/407 (42.75%), Query Frame = 2
Query:  812 DGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIR--------------------TISGEILFQLINLQDLYFKS---PLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG 1948
            +G++    A +  +LE +   L  G DIN    +G    H ++  G  E+   +  R   ++   R GNT LH A       IV  L+E GA+VN  +    TP+ +A       +N+ E++K L+   +N  +  E   T     +++ + + +  L+                     T +  +L Q  +  D+  KS   PLH AA  G   + ++LLE GA+    A ++   +H+ATK G  N+  LLL     I+  T+     +  + +H AA  G  ++   L+  G    AK   G   L ++A+G ++D    +L ++   +       T LH AA  GH+ V K L    A       N  +P   A   +R  VV+  L    ++  +E   E+G
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-----ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK-----DLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESG 425          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 167.548 bits (423), Expect = 9.518e-42
Identity = 144/571 (25.22%), Postives = 259/571 (45.36%), Query Frame = 2
Query:  290 NNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGEL--FELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTD-----------------NNY------------EIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLND 1906
            + F+ LH A +   ++V   LL    +VN     N+ P+H+A +     +  +L  +  + ID+      T LH A R GH  +V+ L+  GA ++    + ++ LH  A+ + ++  + LL ++AP+   + +  TP+ +AA  GH++V   LL++        S   N + ++G + +  A +   ++V+++ L   A I      G T  H +A  G   +  + L +  + D+ TV   G TPLH A      ++V  L+  GA V+   R  QTP+ +A S L NTD                 +NY            E+  IL+  N++  +  +K  T  H   +  N++ ++ L+   +       ++++     +PLH AA   + ++  +LLE GA  K  A+N +  +H+A K+  + +   LL+   +         + L H +A+EG  EI   LIE G D  AK + G   + L A+  ++ + + +  N    N       T LH A   G L ++K L  +GA   +    + +P  +A      + V+Y L +
Sbjct:  226 SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI-IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR--------SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR--GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIA-SRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGT------PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPL-HLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN 777          

HSP 2 Score: 164.851 bits (416), Expect = 6.308e-41
Identity = 148/578 (25.61%), Postives = 254/578 (43.94%), Query Frame = 2
Query:  278 LDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCK---KRTLQIDAVDV-------------------------KGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINT---------------------------------VDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            + +VN F+ L+ A  EN ++VV YLL    +  +       P+ +A Q+    +V +L +   K  +++ A+ +                          G T LHIA   GH N+ + LL  GA+VN      IS LH   +     M  +LLS  A +  ++ +  TP+  AA  GH +V++ L+ +           ++ K  +G + +  A Q  +++  +  L + A +++  VD  T  H +A  G   + +L+  RS D N+                                     G TPLH A +   +NIVI LL+ GA+ +      +TP+ +A  +     N  +++++L+   + +  +  +L+T  H      N   +  L++  +          +D Y  SPLH AAK G  E+  +LL+  AD  L  +     +HLA+K GNL VV+LLLE    +++E +     N+ + +H AA     ++   L+E G    A    G   L ++AK   ++I   +L+ K +PN   +   T LH +A  GH E+   L  +G+
Sbjct:  127 VQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQ--------GAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARA-----NQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN----ATTRDNY--SPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGK-----NQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS 680          

HSP 3 Score: 152.91 bits (385), Expect = 3.520e-37
Identity = 139/534 (26.03%), Postives = 240/534 (44.94%), Query Frame = 2
Query:  341 VAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLY--FKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLF-NLSPFDEALANSRKDVVKYFLNDDNWKKTM 1927
            V  LL    D+N   +  +  +HLA++    E+V  L K R  Q+DA   KG TALHIA   G S +V  L+  GA+VN    +  + L+  A++N  E++K LL + A   + + +G TP+ +A  +GH +V+  LLE        +         D  +  +  +QN           +  D+ +K   G T  H +A  G   + +L+  +  ++N   R   +PLH A      N+   LL  GA +++  +   TP+  A  S      + +++ +LV   + +  + +      H   +  ++   + L        L+    + D+   + +PLH AA  G + + K+LL+  ADP   A N    +H+A K+  + VV+LLL+            ES L  +H AA  G   I  +L++ G +   +   G   L L+A+    D+V  +++N    +   ++  T LH A+  G+ +++  L + GA        N SP   A    +++V    L D N  KT+
Sbjct:   49 VLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIK-RQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNE----------HNPDVTSK--SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARS-----GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL--------LYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRA---AIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL-DHNADKTL 552          

HSP 4 Score: 143.665 bits (361), Expect = 2.397e-34
Identity = 132/533 (24.77%), Postives = 234/533 (43.90%), Query Frame = 2
Query:  296 FSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISG---------------------EILFQLINLQ-DLYFKS-----PLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLL----LEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
             + LH A       VV  L+     ++      + P+H+AAQ + V+    L   R   +D V V   T LH+A   GH  + + LL   A  N    +  + LH   +KN ++++++LL Y+A +   + +G TP+ +AA  G I ++ +LL++    N +V      + + G + +  A +    +V+++ + NGA ++ +  + +T  H ++  G  ++  L+     + N   RD  +PLH A       +   LL+  AD     +   TP+ +A         N E++++L+   + + I  +   T  H      N K    L+   +                      EI   L+  + D   KS     PLH +A+ G  EI  +L+E G+D    A N   A+HL  +E ++ V ++L     EIN +T         + +H A   G+  + +FL+E G D   K       L  +A+ G+ + V Y+L+N  +PN       T L  A   G++ V++ L
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA-PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ--GANPDV------ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKY-----GNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGY-----TPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 5 Score: 113.62 bits (283), Expect = 4.722e-25
Identity = 104/411 (25.30%), Postives = 177/411 (43.07%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCIS---FAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE 1507
            T +  + LH A      ++V YLL    + ++   +   P+HLAA+ N  ++V +L +    ++DA   + QT LHIA R G++++V  LL  GA+ N    D  S LH  A++   E+  ILL + A   + +  G TP+ +A+  G+++V+  LLE+               DI+G + ++    A    N +V  + L NGA                                       ++G TPLH A     + I   LL+  AD N  +R   TP+ ++       + + EI  +L+   S++  +     T  H   +  ++   + L    +       IN +     +PLH A   G + + K L+E GAD        +  +H A ++G+ N V+ LLE
Sbjct:  422 TESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER-----------GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGA---------------------------------SAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQ-----EGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGA------EINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE 776          

HSP 6 Score: 100.908 bits (250), Expect = 3.065e-21
Identity = 104/407 (25.55%), Postives = 173/407 (42.51%), Query Frame = 2
Query:  812 DGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIR--------------------TISGEILFQLINLQDLYFKS---PLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG 1948
            +G++    A +  +LE +   L  G DIN    +G    H ++  G  E+   +  R   ++   R GNT LH A       IV  L+E GA+VN  +    TP+ +A       +N+ E++K L+   +N  +  E   T     +++ + + +  L+                     T +  +L Q  +  D+  KS   PLH AA  G   + ++LLE GA+    A ++   +H+ATK G  N+  LLL     I+  T+        + +H AA  G  ++   L+  G    AK   G   L ++A+G ++D    +L ++   +       T LH AA  GH+ V K L    A       N  +P   A   +R  VV+  L    ++  +E   E+G
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-----ENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLL-----TPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESG 425          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331823)

HSP 1 Score: 182.57 bits (462), Expect = 2.067e-46
Identity = 165/673 (24.52%), Postives = 295/673 (43.83%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKR-TLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EP--RSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKT--IKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINES-----SLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQ---KKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-----------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 2239
            LH AV  +  D + YLL+  +D  ++  K   P+HLA + N V+ + ++ + R  + I      G+TALH+A    H      L++                                 + A      +NG  P+  AA     K +    +  +       + ++  D +GN  +  A+   +++ +++CL +GA I+ +  D  T  H +   G  ++ +L+   +P  +   ++  D    TPLH A      +IV  L+  GAD+N  ++  ++P+++A S      + ++ + +L+   + + ++D   + V H+++      T   + +    +   L  L+N +D    SPLHYA++ G I   + L+  GA   L   N+   +H A + G  N V+ LL+   E   F  INES     + +H ++++G   + + L+  G   L +D  GRN L L+A  G  + +E  L + ++ +L DQ     NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F  L             G    ++S     AL +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  162 LHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILIT--------------------------------EFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASR-----SGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLD--SEKGSF-IINESDGAGMTPLHISSQQGHTRVVQLLLNRGA-LLHRDHTGRNPLQLAAMSGYTETIE--LLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 791          

HSP 2 Score: 65.855 bits (159), Expect = 1.879e-10
Identity = 63/189 (33.33%), Postives = 96/189 (50.79%), Query Frame = 2
Query: 2570 WTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINR---DQAP----FRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK 3103
            ++ A + +F S+   L F+Q     GI V MF  + +TL KV + F  L   FG AFYI+     D  P    F +I  S L++  M +GE D+V  ++ +  +  L  P    +++  F++ MP    NL IGLAVGDI+S+   A+L+   ++V    E+E  L  V  +     E IE P E + K
Sbjct:  927 YSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPNETKCK 1115          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331825)

HSP 1 Score: 182.185 bits (461), Expect = 2.447e-46
Identity = 165/673 (24.52%), Postives = 295/673 (43.83%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKR-TLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EP--RSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKT--IKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINES-----SLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQ---KKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-----------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 2239
            LH AV  +  D + YLL+  +D  ++  K   P+HLA + N V+ + ++ + R  + I      G+TALH+A    H      L++                                 + A      +NG  P+  AA     K +    +  +       + ++  D +GN  +  A+   +++ +++CL +GA I+ +  D  T  H +   G  ++ +L+   +P  +   ++  D    TPLH A      +IV  L+  GAD+N  ++  ++P+++A S      + ++ + +L+   + + ++D   + V H+++      T   + +    +   L  L+N +D    SPLHYA++ G I   + L+  GA   L   N+   +H A + G  N V+ LL+   E   F  INES     + +H ++++G   + + L+  G   L +D  GRN L L+A  G  + +E  L + ++ +L DQ     NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F  L             G    ++S     AL +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  127 LHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILIT--------------------------------EFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASR-----SGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLD--SEKGSF-IINESDGAGMTPLHISSQQGHTRVVQLLLNRGA-LLHRDHTGRNPLQLAAMSGYTETIE--LLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 756          

HSP 2 Score: 66.2402 bits (160), Expect = 1.670e-10
Identity = 63/189 (33.33%), Postives = 96/189 (50.79%), Query Frame = 2
Query: 2570 WTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINR---DQAP----FRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK 3103
            ++ A + +F S+   L F+Q     GI V MF  + +TL KV + F  L   FG AFYI+     D  P    F +I  S L++  M +GE D+V  ++ +  +  L  P    +++  F++ MP    NL IGLAVGDI+S+   A+L+   ++V    E+E  L  V  +     E IE P E + K
Sbjct:  892 YSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPNETKCK 1080          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331826)

HSP 1 Score: 181.03 bits (458), Expect = 4.774e-46
Identity = 163/672 (24.26%), Postives = 293/672 (43.60%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKR-TLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EP--RSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKT--IKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINES-----SLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQ---KKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPD----------DPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 2239
            LH AV  +  D + YLL+  +D  ++  K   P+HLA + N V+ + ++ + R  + I      G+TALH+A    H      L++                                 + A      +NG  P+  AA     K +    +  +       + ++  D +GN  +  A+   +++ +++CL +GA I+ +  D  T  H +   G  ++ +L+   +P  +   ++  D    TPLH A      +IV  L+  GAD+N  ++  ++P+++A S      + ++ + +L+   + + ++D   + V H+++      T   + +    +   L  L+N +D    SPLHYA++ G I   + L+  GA   L   N+   +H A + G  N V+ LL+   E   F  INES     + +H ++++G   + + L+  G   L +D  GRN L L+A  G  + +E  L + ++ +L DQ     NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F      P+          DP         + +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  127 LHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILIT--------------------------------EFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASR-----SGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLD--SEKGSF-IINESDGAGMTPLHISSQQGHTRVVQLLLNRGA-LLHRDHTGRNPLQLAAMSGYTETIE--LLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTPEQIEAKRKEFNDPKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 755          

HSP 2 Score: 65.855 bits (159), Expect = 2.135e-10
Identity = 63/189 (33.33%), Postives = 96/189 (50.79%), Query Frame = 2
Query: 2570 WTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINR---DQAP----FRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK 3103
            ++ A + +F S+   L F+Q     GI V MF  + +TL KV + F  L   FG AFYI+     D  P    F +I  S L++  M +GE D+V  ++ +  +  L  P    +++  F++ MP    NL IGLAVGDI+S+   A+L+   ++V    E+E  L  V  +     E IE P E + K
Sbjct:  891 YSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPNETKCK 1079          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331824)

HSP 1 Score: 181.03 bits (458), Expect = 5.186e-46
Identity = 163/672 (24.26%), Postives = 293/672 (43.60%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKR-TLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EP--RSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKT--IKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINES-----SLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQ---KKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPD----------DPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 2239
            LH AV  +  D + YLL+  +D  ++  K   P+HLA + N V+ + ++ + R  + I      G+TALH+A    H      L++                                 + A      +NG  P+  AA     K +    +  +       + ++  D +GN  +  A+   +++ +++CL +GA I+ +  D  T  H +   G  ++ +L+   +P  +   ++  D    TPLH A      +IV  L+  GAD+N  ++  ++P+++A S      + ++ + +L+   + + ++D   + V H+++      T   + +    +   L  L+N +D    SPLHYA++ G I   + L+  GA   L   N+   +H A + G  N V+ LL+   E   F  INES     + +H ++++G   + + L+  G   L +D  GRN L L+A  G  + +E  L + ++ +L DQ     NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F      P+          DP         + +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  162 LHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILIT--------------------------------EFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASR-----SGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLD--SEKGSF-IINESDGAGMTPLHISSQQGHTRVVQLLLNRGA-LLHRDHTGRNPLQLAAMSGYTETIE--LLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTPEQIEAKRKEFNDPKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 790          

HSP 2 Score: 65.4698 bits (158), Expect = 2.403e-10
Identity = 63/189 (33.33%), Postives = 96/189 (50.79%), Query Frame = 2
Query: 2570 WTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINR---DQAP----FRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK 3103
            ++ A + +F S+   L F+Q     GI V MF  + +TL KV + F  L   FG AFYI+     D  P    F +I  S L++  M +GE D+V  ++ +  +  L  P    +++  F++ MP    NL IGLAVGDI+S+   A+L+   ++V    E+E  L  V  +     E IE P E + K
Sbjct:  926 YSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPNETKCK 1114          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 170.629 bits (431), Expect = 1.245e-42
Identity = 159/571 (27.85%), Postives = 260/571 (45.53%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV-SANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE---------------INMETRY-----------------FRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKN--TALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLNDD 1909
            LH A  +N  +    LL    + +I+      P+H+AA    V+I  +L   +   ++ V     T LH+AC+ G  ++   LL  GA ++    D ++ LH  +R   +E+IK LL   AP++ K+ NG + + +AA   H +  + LL+  KA        ++E  +D  + +  A    +++V ++ L   A+ N + ++G T  H +      ++ EL+     +I      G TPLH A +   +NIVI LL+  A  +      +TP+ +A  +     N  +II+IL+ SA  + + R+ +  T  H      NI  I  L++  +       IN Q     S LH AAK G   I +VLLE GA+     +     +HLA K G  NVV++LL+               +++ T Y                     N    IH A ++   EI   L++ G D       G + L L+A+GGN+D+V+ +L+  +   +    KN  T LH AA  GH+ V + L  HGA   +   N  +P   A      D+VK+F+ +D
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKA-DVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDN-KAP-------VDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARA-----NQADIIRILLRSAKVDAIAREGQ--TPLHVASRLGNINIIMLLLQHGAE------INAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV---ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIEND 750          

HSP 2 Score: 166.007 bits (419), Expect = 3.645e-41
Identity = 146/542 (26.94%), Postives = 260/542 (47.97%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE--------KIKAENG-NVSDTLNEKDI---------------DGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV--SANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQL------INLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            T +  + LH A      +V+ +LL     +       +  +H+AAQ    E   +L   +   +D V V   TALH+A   GH  + + LL Y A+ N    +  + LH   +KN ++M+++L+ + A +   + +G TP+ +A+  G I ++ +LL+         I+ E   +++   N+ DI               +G + +  A +  N+ ++ + L +GA+IN +  D  +  H +A  G   + +++     + N V + G TPLH A      N+V  LL+ GA ++   +   TP+ VA        NN  I+++L+   ++ NL  R+   +   H   ++       YL      EI  QL      +N+      SPLH AA+ G++++ ++LLE G      A+N    +H+A +EG++ V ++LLE    I+  TR     N  + +H AA  G  ++ +F IE   D     + G   L  +A+ G+I I+  +L++K NPN   +  NTALH A++ G++ V++ L
Sbjct:  297 TRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKA-PVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHY-----NNPSIVELLLKNGSSPNLCARNG--QCAIHIACKK------NYL------EIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVI-SAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTR-----NGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 3 Score: 142.51 bits (358), Expect = 6.751e-34
Identity = 152/610 (24.92%), Postives = 282/610 (46.23%), Query Frame = 2
Query:  296 FSLLHYAVNENQKDVVAYLLTFKI-DVNIMGSKNVRPIHLAAQRNLVEIV-EILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGN---SCISFAIQNRNLEVLQICLLN--GADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVE---------------RINIKTIKYL----IRTISGEILFQLI--------NLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVG-IDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLF---NLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDK 2011
             S L  A + + K V+ +L   +I D+N   +  +  +HLAA+   V+I  E+L  +R ++ID    KG TALHIA   G  +++  L+ Y A+VN    +  + L+  A++N     + LL+  A   + + +G TP+ +A  +GH K++  LL               E D+ G      +  A +  ++   ++ L +   ADI +K   G T  H +A  G  ++  L+     D+N V +   TPLH A     L++   LL  GA ++ + R   TP+  A  S      + E+IK L+  N+ +L + +   +  H   +                ++  T+ YL    +    G +    +        N + L   +PLH A K   I++ ++L++ GA+     E+    +H+A+  G +N+V  LL+ +  +     I   + +H AA   + +I R L+    +D +A++  G+  L ++++ GNI+I+  +L++    N     K +ALH AA  G   +++ L  +GA  ++N       +P   A    +++VV+  L +     +++++ +N  + +     YN    +ELL K
Sbjct:   40 ISFLRAARSGDIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELL--RRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLL---------------ENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSK--SGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRS-----GHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQ-HEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE--GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGA--ENNAVTKKGFTPLHLACKYGKQNVVQILLQNG---ASIDFQGKNDVTPLHVATHYNNPSIVELLLK 617          

HSP 4 Score: 139.043 bits (349), Expect = 7.715e-33
Identity = 148/577 (25.65%), Postives = 248/577 (42.98%), Query Frame = 2
Query:  278 LDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAK-------------GGNID--------------------IVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN---LSPFDEALANSRKDVVKYFL 1900
            L T + F+ L  A+ +    +VA LL    + ++ G   +  +H+AA++N V   ++L +      D V   G T LHIA   G+ ++   LL+  A VN +    I+ LH   +   L +  +LL   A +   + +G TP+  A+  GH++V+  LL++        +  +  K  +G S +  A Q  + E   + L N A ++   VD  T  H +A  G  ++ +L+     + N    +G TPLH A     + +V  L++ GA++  +     TP+ VA  S +        I I++                  YL++          + TI GE              +PLH AA+    +I ++LL + A     A      +H+A++ GN+N++ LLL+   E     + ++ S +H AA+EG+  I + L+E G +  A    G   L L+ K             G +ID                    IVE +LKN  +PNL  +    A+H A    +LE+   L +HGA    N+ +    SP   A      D+V+  L
Sbjct:  167 LSTEDGFTPLAVAMQQGHDKIVAVLL----ENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDP-NADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQ--------NAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVA--SFMGC------INIVI------------------YLLQH----EASADLPTIRGE--------------TPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSN-DKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADV--NIISKSGFSPLHLAAQGGNVDMVQLLL 682          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Zebrafish
Match: trpa1a (transient receptor potential cation channel, subfamily A, member 1a [Source:ZFIN;Acc:ZDB-GENE-050105-6])

HSP 1 Score: 238.424 bits (607), Expect = 2.444e-64
Identity = 261/1002 (26.05%), Postives = 461/1002 (46.01%), Query Frame = 2
Query:  173 DESNQV-MQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNF--SLLHYAVNENQKDVVAYLLTF--KIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDA--VDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESD--KISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EPRSWD-INTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYL-IRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVL--LEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH--IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSG-------QRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTS----SGNLDSEFVLKLNSA--IYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKN-LRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYF 3058
            DESNQ+   +F   + GN   L+       KN  + LDT +N   S LHYA       ++ +++      ++N+   +   P+H A Q++      +L    +L  D   ++   Q  +H+A   G + ++E L+S+  +   LE D     V+   A  N  E + IL  + A    +++ G  P+  AA  G  K +  +L K +    ++   +N  D   +S +  A++  NL+++++C+  GA I+ +  D  T  H +   G  E+ +++    P+  D IN  D    TPLH AV      +   L+  GA+++  +    +P+++A S        +  + +L+S  ++L  +D+      H  +  +  + +K L    +  E + +L+N +D+   +PLHYA +LG  +  K +  LE   D K  ++    A+H A + G +N    LLE+  +TR   + +E  L  +H A+ EG  ++   L+  G   L   DY G + L  +A  G    ++ +L + I   N  D   NTALH AA  GH+  ++ L   GA+   N  + S   EA+ N+R++V    +  D  ++ M     N      +  +I++  E    LLD CI E   + +  N  I+Y F  L     +   +G       +   AL +MV F ++NLL HP+  + L+ KW  +G+   L+++ +Y L +  +++             VN     V S N TS      +L  +  L  +S   + ++ ++ +G   +++  +R  + +D   +     A+   LF+   L N+     W    +    S+   L ++Q     GI V MF  + +TL  + + FF L  GF  +FY +  +Q  F  +  S L++ VM +GE +Y + F+    +  L  P L     ++FVL +P    NL IGLAVGDI  + + A L+    R+    E+ TNL + +  +F
Sbjct:   37 DESNQISANVFEWTKQGNAAALE-------KNS-RYLDTRDNIGASPLHYASANGHFRIIRHIVQIVGHQELNVRDEEGNTPLHWAVQKDQPGSCSVLL---SLGADPNVLNNSHQAPIHMAVSLGKNFVLEQLVSHKQTDVNLEGDLGNTPVILSAALDNH-EALGILYKHGAKFCRQNNLGHFPIHAAAFSGAKKSMEVILLKGEEAGLSIDAHINYVDKSCSSPLHLAVRGGNLDIIKLCIGYGAKIDQQQCDKSTALHFACSQGATEVVKIMLSSYPKVCDLINITDGANQTPLHKAVIFDHFELSEYLMSQGANIDFVDCKGHSPLLLATSC-----GAWRTVNLLLSHGADLTKKDKSGCNFLHLAI--LQPRGLKNLPTEVLQHESVRELLNDEDIEGCTPLHYACRLGIPDSVKNMLGLEVSLDQK--SKEKKSALHFAAEFGRINTCHRLLEMVTDTRLLNEGDEKGLTPLHLASREGHVKVVELLLRKG--ALFHSDYRGWSGLHHAASEGYTQTMDTLLTSNIKLLNKTDGDGNTALHLAARAGHVAAVRLLLYRGAKIILNKNDASFLHEAVHNARREVTNMVIESDRCEEAMTTYKPNSTKRCIVMDMIEFLPESFKHLLDTCIRESEEDVNCTNYYIEYNFRWLQHPLQNLKKTGMEKDMAYKPLSALNAMVNFNRVNLLTHPVCKKYLEMKWSAYGIKAHLLNMTVYALGVFPLTYL-----------IVNLKPTLVTSRNVTSVNMVCTSLYKQSYLTTSSMLLVLAMNMYAVGKEILQMFQQRLNYLRDLSNYMDWAAAICALLFVVPLLMNLKSSWHWQAGALAALTSWLNLLLYLQRFERIGIYVVMFREISRTLLSIIVLFFYLILGFALSFYALMIEQQHFGRMFLSLLQTFVMMVGEMNYQDNFMKPYLQGDLPFPDLTLAIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLK----RIAMQIELHTNLEERLPYWF 1000          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 235.728 bits (600), Expect = 1.587e-63
Identity = 249/981 (25.38%), Postives = 453/981 (46.18%), Query Frame = 2
Query:  176 ESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEIL--CKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTL--NEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEP---RSWDINTVDRDG--NTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTI-SGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKK---NTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNL-RNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            + N    + YA   GN++ ++++   V    L   D     + LH+AV ++Q+   A LL    D NI+ +  + P+HLA  +    + E+L  C K    ++  D+ G T + +AC    SN                             N+ + ++IL+   A + I++  G  P+   A  G  + +  +L KI  E G VS TL  N  D   ++ +  A++  N+EV+++C+L GA +        T  H +   G  E  +++     R+ DI  + RDG   TPLH A     + +   L+  GA++++ +    +P+++A S      + ++ +  L+S  ++  I+++  +   H+++  +  K +K L  T+     + ++++ +D+   +PLHYA KLG  +  K +L         +     A+H A + G +N    LLE   +++   D +E  L  +H A+  G  ++   L+  G   L + DY G   L  +A  G    ++ +L    N  L D+K    NTALH AA  GH+  +  L   GA    N  + S   EA+ N R++VV   +  +   ++M       +  +  +I++  E    LLD+CITE   + + Q+  I Y F  L A          D + + Q   AL +MV + +L LL HPLS + L+ KW  +G     ++L +Y+L ++ +++ I  + P ++    N T+  ++  + +    L S  ++     +  + ++ +    ++L  +R  +F D    +    A+   +F+  +  ++    +W      +  S+  FL + Q     GI V MF  + +TL  + + F  L   FG AFY +   +  F  I  +  ++ VMT+GE +Y + F+ S  +  +A P    ++ ++FVL MP    NL IGLAVGDI  +   AEL+   ++++    +E  L
Sbjct:   56 DENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDE-QGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEG-DL-GNTPVMLAC----SN-----------------------------NNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVL-KIGEELG-VSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNI-RDGANRTPLHRATLFDHVELAEYLISKGAEIDSIDCKGLSPLLLASSC-----SAWKTVAYLLSIGADFKIKEKTGRNFLHFVI--LQPKGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKG--ALFQSDYKGWTCLHHAAAEGYTQTMKILLA--ANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRPSQDFSKGNGTSVIMVPVSFSEQQYLISVCII----MVIVMNVYSICKEVVQLAQQRVNYFTDFSNPADWSAAISALVFVVPMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGHMAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKL 982          

HSP 2 Score: 81.2629 bits (199), Expect = 4.732e-15
Identity = 56/228 (24.56%), Postives = 106/228 (46.49%), Query Frame = 2
Query: 1172 IIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILK--------NKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDN 1831
            I +++     +L +RDE   ++ HY     N+  I+ ++  +  E+L    N+QD   ++PLH+A +    + C VLL+ GADP +        +HLA  +   ++ ++LL  +           ++ +  A      +  + LI+ G     ++  G   +   A  G  + +E +LK        + ++ N  D+ K+T LH A  GG++EVIK     GA+ + +
Sbjct:   41 IDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVL----NVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQH 264          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 235.728 bits (600), Expect = 1.587e-63
Identity = 249/981 (25.38%), Postives = 453/981 (46.18%), Query Frame = 2
Query:  176 ESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEIL--CKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTL--NEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEP---RSWDINTVDRDG--NTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTI-SGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKK---NTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNL-RNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            + N    + YA   GN++ ++++   V    L   D     + LH+AV ++Q+   A LL    D NI+ +  + P+HLA  +    + E+L  C K    ++  D+ G T + +AC    SN                             N+ + ++IL+   A + I++  G  P+   A  G  + +  +L KI  E G VS TL  N  D   ++ +  A++  N+EV+++C+L GA +        T  H +   G  E  +++     R+ DI  + RDG   TPLH A     + +   L+  GA++++ +    +P+++A S      + ++ +  L+S  ++  I+++  +   H+++  +  K +K L  T+     + ++++ +D+   +PLHYA KLG  +  K +L         +     A+H A + G +N    LLE   +++   D +E  L  +H A+  G  ++   L+  G   L + DY G   L  +A  G    ++ +L    N  L D+K    NTALH AA  GH+  +  L   GA    N  + S   EA+ N R++VV   +  +   ++M       +  +  +I++  E    LLD+CITE   + + Q+  I Y F  L A          D + + Q   AL +MV + +L LL HPLS + L+ KW  +G     ++L +Y+L ++ +++ I  + P ++    N T+  ++  + +    L S  ++     +  + ++ +    ++L  +R  +F D    +    A+   +F+  +  ++    +W      +  S+  FL + Q     GI V MF  + +TL  + + F  L   FG AFY +   +  F  I  +  ++ VMT+GE +Y + F+ S  +  +A P    ++ ++FVL MP    NL IGLAVGDI  +   AEL+   ++++    +E  L
Sbjct:   56 DENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDE-QGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEG-DL-GNTPVMLAC----SN-----------------------------NNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVL-KIGEELG-VSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNI-RDGANRTPLHRATLFDHVELAEYLISKGAEIDSIDCKGLSPLLLASSC-----SAWKTVAYLLSIGADFKIKEKTGRNFLHFVI--LQPKGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKG--ALFQSDYKGWTCLHHAAAEGYTQTMKILLA--ANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRPSQDFSKGNGTSVIMVPVSFSEQQYLISVCII----MVIVMNVYSICKEVVQLAQQRVNYFTDFSNPADWSAAISALVFVVPMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGHMAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKL 982          

HSP 2 Score: 81.2629 bits (199), Expect = 4.732e-15
Identity = 56/228 (24.56%), Postives = 106/228 (46.49%), Query Frame = 2
Query: 1172 IIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILK--------NKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDN 1831
            I +++     +L +RDE   ++ HY     N+  I+ ++  +  E+L    N+QD   ++PLH+A +    + C VLL+ GADP +        +HLA  +   ++ ++LL  +           ++ +  A      +  + LI+ G     ++  G   +   A  G  + +E +LK        + ++ N  D+ K+T LH A  GG++EVIK     GA+ + +
Sbjct:   41 IDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVL----NVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQH 264          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 227.254 bits (578), Expect = 1.189e-60
Identity = 252/995 (25.33%), Postives = 456/995 (45.83%), Query Frame = 2
Query:  176 ESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEIL--CKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTL--NEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEP---RSWDINTVDRDG--NTPLHYAVY--------------NTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTI-SGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKK---NTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNL-RNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            + N    + YA   GN++ ++++   V    L   D     + LH+AV ++Q+   A LL    D NI+ +  + P+HLA  +    + E+L  C K    ++  D+ G T + +AC    SN                             N+ + ++IL+   A + I++  G  P+   A  G  + +  +L KI  E G VS TL  N  D   ++ +  A++  N+EV+++C+L GA +        T  H +   G  E  +++     R+ DI  + RDG   TPLH A                NT L++ +  L  GA++++ +    +P+++A S      + ++ +  L+S  ++  I+++  +   H+++  +  K +K L  T+     + ++++ +D+   +PLHYA KLG  +  K +L         +     A+H A + G +N    LLE   +++   D +E  L  +H A+  G  ++   L+  G   L + DY G   L  +A  G    ++ +L    N  L D+K    NTALH AA  GH+  +  L   GA    N  + S   EA+ N R++VV   +  +   ++M       +  +  +I++  E    LLD+CITE   + + Q+  I Y F  L A          D + + Q   AL +MV + +L LL HPLS + L+ KW  +G     ++L +Y+L ++ +++ I  + P ++    N T+  ++  + +    L S  ++     +  + ++ +    ++L  +R  +F D    +    A+   +F+  +  ++    +W      +  S+  FL + Q     GI V MF  + +TL  + + F  L   FG AFY +   +  F  I  +  ++ VMT+GE +Y + F+ S  +  +A P    ++ ++FVL MP    NL IGLAVGDI  +   AEL+   ++++    +E  L
Sbjct:   56 DENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDE-QGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEG-DL-GNTPVMLAC----SN-----------------------------NNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVL-KIGEELG-VSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNI-RDGANRTPLHRATLFDHVELAEYLISKPNT-LSLDLICLGKGAEIDSIDCKGLSPLLLASSC-----SAWKTVAYLLSIGADFKIKEKTGRNFLHFVI--LQPKGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKG--ALFQSDYKGWTCLHHAAAEGYTQTMKILLA--ANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRPSQDFSKGNGTSVIMVPVSFSEQQYLISVCII----MVIVMNVYSICKEVVQLAQQRVNYFTDFSNPADWSAAISALVFVVPMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGHMAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKL 995          

HSP 2 Score: 81.2629 bits (199), Expect = 5.178e-15
Identity = 56/228 (24.56%), Postives = 106/228 (46.49%), Query Frame = 2
Query: 1172 IIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILK--------NKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDN 1831
            I +++     +L +RDE   ++ HY     N+  I+ ++  +  E+L    N+QD   ++PLH+A +    + C VLL+ GADP +        +HLA  +   ++ ++LL  +           ++ +  A      +  + LI+ G     ++  G   +   A  G  + +E +LK        + ++ N  D+ K+T LH A  GG++EVIK     GA+ + +
Sbjct:   41 IDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVL----NVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQH 264          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 183.726 bits (465), Expect = 1.051e-46
Identity = 148/584 (25.34%), Postives = 261/584 (44.69%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIR--------TISGEILFQLI---------------NLQDLYFK----SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR-FQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLI 1972
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA ++    D+++ LH  AR   + +++ILL   APL  K+ NG +P+ +AA   H+  +  LL+     N  + D      +D  + +  A    +  ++++ L  GA  N + ++G T  H +         +L+   S  +  V   G TPLH A +   LNIV  LL+ GA  N SN   +TP+ +A  +      + E+ + L+  N+ +  + +  +T  H      + + +K L+         T +G     +                N Q         +PLH A K G +++ ++LLE GA+P    +N    +H+A    NL+VVKLL+     + +    N  + +H AA++ + E+   L++ G +  ++   G   L L+++ G  D+V  ++  + N NL ++   T LH  A  GH+ +   L + GA  +  +    +P   A       +VK+ L         +  H N K+ +  L+
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLN-RGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQY----NAEIDDI----TLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARA-----GHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQ--------QQAHVNSKTRVSVLL 770          

HSP 2 Score: 158.688 bits (400), Expect = 7.894e-39
Identity = 138/533 (25.89%), Postives = 241/533 (45.22%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIR--------TISG-------------EILFQLI------NLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            + LH A    Q+ VVA L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q    +  G T L +A ++GH N+V  L++YG    K+   ++  LH  AR +D     +LL       + S  G TP+ IAA   ++ V   LL        N    +N    +G + +  A +  N+ ++++ L  GA I+ K  D  T  H +A  G   + E++  +   +    ++G +P+H A     ++ V QLL+  A+++       TP+ VA         ++ ++K+L+   +    R     T  H   ++ +++++  L++        T SG              I+  L+      N  ++  ++PLH AA+ G  E+ + LL+  A     A++D   +H A + G+  +VKLL+E             + L H AA EG  +  R L++           G   L ++ K G +D+VE +L+   NPN   +   T LH A    +L+V+K L   G 
Sbjct:  113 TALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTE-DGFTPLAVALQQGHENVVALLINYGTK-GKV---RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLL--------NRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHC-----GHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPL-HIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGG 626          

HSP 3 Score: 158.303 bits (399), Expect = 9.706e-39
Identity = 143/584 (24.49%), Postives = 247/584 (42.29%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPN--------LFD---------------------------QKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       VV  LL     +       + PIH+AAQ + ++ V  L +    +ID + +   T LH+A   GH  MV+ LL  GA  N    +  + LH   +KN +  + +LL + A L   + +G TP+ +AA  GH+ ++  LL++  + N +        ++   + +  A +  + EV Q  L N A ++ K  D +T  H +A  G  EL +L+     + ++    G+TPLH A           LL+  A      +   TP+ VAC          +++++L+   +N     +   T  H  V   N+  +K L+ +  G       N       + LH AAK   +E+   LL+ GA+    +      +HLA++EG  ++V LL+          + N  + +H  A+EG   I   L++ G    A    G   L ++   GNI +V+++L+ + + N        L D                           Q   T LH AA  GH +++  L +HGA
Sbjct:  267 FTPKNGITPLHIASRRGNVIMVRLL---LDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNA-EIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNAS--------NVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKY-----GKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSPHSTARN-----GYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVN-LGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGA 826          

HSP 4 Score: 155.221 bits (391), Expect = 1.008e-37
Identity = 146/540 (27.04%), Postives = 250/540 (46.30%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVEIV-EILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLK--TVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIE--VGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLF--NLSPFDEALANSRKDVVKYFL 1900
            ID+NI     +  +HLA++   V++V E+L     + ++    KG TALHIA   G   +V  L++YGA+VN       S L+  A++N LE++K LL + A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    NL V Q+ L  GA++N    +G T  H ++  G   +  L+  R   I+   +D  TPLH A  N  + +V  LL+ GA +    +   +PI +A        ++ + ++ L+  N+   I D  L   T  H      + + +K L+   +        N + L   +PLH A K   +    +LL+  A  +   E+    +H+A   G+LN+VK LL+         ++   + +H AA  G  E+ +FL++    +D  AKDD  +  L  +A+ G+ ++V+ ++++K NP+      +T LH AA  GH +  + L    A+ Q  +     +P   A    + DVV+  L
Sbjct:   69 IDINIANQNGLNGLHLASKEGHVKMVLELL--HNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQG-----DHMDCVRQLLQYNAE--IDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKA------NARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNA-SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDD--QTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLL 589          

HSP 5 Score: 124.02 bits (310), Expect = 3.702e-28
Identity = 112/446 (25.11%), Postives = 199/446 (44.62%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK-----IKAENG----NVSDTLNEKDI----------------DGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANS--------NLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMET 1522
            T +  + LH A      ++V  LL      N    K   P+H+AA+    E+ + L +    Q+DA     QT LH A R GH  +V+ L+ + A+ +   +   + LH  AR+   +  +ILL   A     +  G TP+ +A   G + V+  LLE+        +NG    +V+   N  D+                +G + +  A +   LEV    L  GA+ N++ + G T  H ++  G  ++  L+  +  ++N  +++G TPLH       + I   L++ GA V  ++R+  TP+ VAC        N +++K L+   +        ++L+ D     +F      +++ T++    + S   LFQL         +PLH AA+ G  +I  +LL+ GA P     N    + +A + G ++V+ +L  +  E+
Sbjct:  434 TESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNA-QVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHY-----GNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLF-----SVSVCTLRTFAFSFSLIFLFQL-------GYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEES 861          

HSP 6 Score: 98.9821 bits (245), Expect = 2.097e-20
Identity = 92/371 (24.80%), Postives = 166/371 (44.74%), Query Frame = 2
Query:  812 DGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGEL-FELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIR--------------------TISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL----EINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN 1840
            D  +    A ++ NLE     + NG DIN    +G    H ++  G  ++  EL+     D+ T  + GNT LH A       +V +L+  GA+VN  ++   +P+ +A       +N+ E++K L+   +N  +  E   T     +++ +   +  LI                     T +  +L Q     D+  K   +PLH AA   ++ + ++LL  GA+     +N    +H+A++ GN+ +V+LLL    +I+ +T+     +E + +H AA  G   +   L++ G    AK   G + + ++A+G ++D V  +L+     +       T LH AA  GH  ++K L   GA+      N
Sbjct:   44 DATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLH-NGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQ-----ENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTK-----DELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALN 403          

HSP 7 Score: 96.2857 bits (238), Expect = 1.294e-19
Identity = 119/527 (22.58%), Postives = 214/527 (40.61%), Query Frame = 2
Query:  677 IKSSNGQTPVMIAAIEGHIKVLNFLL-------------------------EKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFEL----------------IEPRSWDINT-------------VDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLI--------RTISG-------------EILFQLIN----LQDLYFK--SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQD-NLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELL 2005
            I + NG   + +A+ EGH+K++  LL                         EK+ AE  N    +N +   G S +  A Q  +LEV++  L +GA+ +    DG T    +   G   +  L                I  R+ D  T             + + G TPLH A +  +L++   LL  GA+VN + +   TP+ +A         N  ++++L+   + +  + +   T  H      +++ ++ L+        +T +G             + + QL+     + D+     +PLH AA  G   + KVLL+ GA     A N    +H+A K+ ++  + LLL+    +     + ES L  +H AA  G   I + L++ G    A +      L ++A+ G+ ++ +++L+N    +   +   T LH AA  GH E++K L  H A          +P   A         +  L+++  +  M  +   G + +    KY +   +ELL
Sbjct:   73 IANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRR-----GNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK---HSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKK---GFTPLHVACKYGKVDVVELL 588          

HSP 8 Score: 90.5077 bits (223), Expect = 7.399e-18
Identity = 91/344 (26.45%), Postives = 158/344 (45.93%), Query Frame = 2
Query:  260 KNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNK------LVDGK--TIFHTSAMT--GFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERI 1261
            +N  +   T   F+ LH A    + DVV  LL    + N  G   + P+H+A   N +++V++L  K      +    G TALHIA ++    +  +LL YGA+ N      I+ LH  +++   +M+ +L+S +A + + + NG TP+ + A EGH+ + + L+++          ++      G + +  A    N+++++  L   A +N+K      L+D     +F  S  T   F   F LI         + + G TPLH A      +IV  LL+ GA  N       +P+ +A    L   +  +++K LV+  S  +I  EK +  F   V+ I
Sbjct:  558 ENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGG-SPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQ--------GASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLI--------FLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA--KRLGYISVIDVLK-LVTEESVSMITTEKHRMSFPETVDEI 881          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 225.328 bits (573), Expect = 6.690e-60
Identity = 246/1000 (24.60%), Postives = 451/1000 (45.10%), Query Frame = 2
Query:  176 ESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFE-LIEPRSWDINTVD-RDGN--TPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLV-ERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAE--NDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQR----YY----ALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG------------LGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTG--CVISANQTSSGNL----DSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITS----PTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            + ++   + +A + GN++ + M+  +  +  +  LD+  N + LH+AV +N+ D +  LL    D NI     + P+HLA Q     I E L    T  I+     G T +  AC + +   +  LL  GA +               ++N L                   G  P+ + A  G +K ++ +L+K +     +   +N  + + +S +  A+QN N++V++ C+  GA I+ +  D  T  H +A  G  E+ + ++   S D   VD  DGN  TPLH +V    + +   L+  GA++++ ++  +TP+++A S      + ++ + +L+S  +++ ++D   +   H +V +   +K +      +  E + +L++ +D    +PLHYA + G       LL  G +  L+++  N    +H A   G  N  + LL    + R   D +E  +  +H AAE G +E   FL+      L  D  G   L  +A  G    ++ +L+  I   +  D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E    LLD+C+TE   +K   +  ++Y F  L   P     + +R    +Y     L +MV  ++++LL HP+    L  KW  +G            LG + + L++           I     +K TD  N +    C   AN +   +L    D+++       ++ ++LF +    ++L  ++  +  D    + I  ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW + +TL ++   FF L   FG +FY+    Q  F     + ++S  M +G+ +Y   F+        +Y     I +I F L +P    NL IGLAVGDI  +   A L+   ++V     +E  L
Sbjct:   66 DDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGN-TPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKL--------------CKQNKL-------------------GCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSC-----SAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNS--EFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLL--GLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENG-HEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAIIEECEHLKRTDFYNSSMKQEC---ANVSRKLDLLQLKDTQYTRVCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGS--NIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKL 1015          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 215.698 bits (548), Expect = 6.477e-57
Identity = 230/919 (25.03%), Postives = 431/919 (46.90%), Query Frame = 2
Query:  401 PIHLAAQRNLVEIVEILCKKRTLQ-IDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPAR--KNDLEMIKIL---------LSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFE-LIEPRSWDINTVD-RDGN--TPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLV-ERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAE--NDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQR----YY----ALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITS----PTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            P+H AA+   ++++ ++  +   + I+A+D +G T LH A ++   + ++ LL  GA  N     ++S LH   +   N +  ++           L   A L  ++  G  P+ + A  G +K ++ +L+K +     +   +N  + + +S +  A+QN N++V++ C+  GA I+ +  D  T  H +A  G  E+ + ++   S D   VD  DGN  TPLH +V    + +   L+  GA++++ ++  +TP+++A S      + ++ + +L+S  +++ ++D   +   H +V +   +K +      +  E + +L++ +D    +PLHYA + G       LL  G +  L+++  N    +H A   G  N  + LL    + R   D +E  +  +H AAE G +E   FL+      L  D  G   L  +A  G    ++ +L+  I   +  D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E    LLD+C+TE   +K   +  ++Y F  L   P     + +R    +Y     L +MV  ++++LL HP+    L  KW  +G    L++L +Y L +I                     T  +I+A +  S  LD+++       ++ ++LF +    ++L  ++  +  D    + I  ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW + +TL ++   FF L   FG +FY+    Q  F     + ++S  M +G+ +Y   F+        +Y     I +I F L +P    NL IGLAVGDI  +   A L+   ++V     +E  L
Sbjct:   50 PLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEVRFFQGICFSLRTLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSC-----SAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNS--EFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLL--GLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENG-HEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLI-------------------PLTLLIINAVRPES--LDTQYTRVCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGS--NIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKL 934          

HSP 2 Score: 100.138 bits (248), Expect = 1.100e-20
Identity = 127/532 (23.87%), Postives = 224/532 (42.11%), Query Frame = 2
Query:  176 ESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEI------------------LCKKRTLQ---------------IDAVDVKGQ------------------TALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAP----LMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFH-----TSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPI-MVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEA--GADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGK 1582
            + ++   + +A + GN++ + M+  +  +  +  LD+  N + LH+AV +N+ D +  LL    D NI     + P+HLA Q     I E+                  LCK+  L                +D +  KG+                  + LH+A + G+ ++V+  +SYGA ++  +SD  + LH  A +   E++K ++S  +     + +   N +TP+  + +  H+++  +L+    +E  N+    + +D +  + +  A      + + + L  GAD+  K   G+   H        +      F  +E     ++  D +G TPLHYA  +   N V  LL +   + + ++  ++P+   AC    NT    + +   +S    L   DEK  T  H   E  + K +  L++  +       + L D    + LHYAA  G     K LLE   G   K   E +  A+HLA +EG+   V LLLE         + N +S IH A   GK
Sbjct:   44 DDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGN-TPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEVRFFQGICFSLRTLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLI----SEGANI----DSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNT---CQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIVFLLLKRGA-------LLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQN-TAMHLAGREGHAKAVSLLLENG--ASILLNANGASYIHEAIRFGK 553          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 212.616 bits (540), Expect = 7.621e-56
Identity = 231/943 (24.50%), Postives = 437/943 (46.34%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKID--VNIMGSKNVRPIHLAAQRNLVEIVEIL-CKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESD-KISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFE-LIEPRSWDINTVD-RDGN--TPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLV-ERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAE--NDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQR----YY----ALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITS----PTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            LH+A      D++  ++    +  +N + S+   P+H A Q+N ++ +++L C+     I   +    + LH+A +  H N +  +L     +N LE D   + +     K++ E + +LL   A L  ++  G  P+ + A  G +K ++ +L+K +     +   +N  + + +S +  A+QN N++V++ C+  GA I+ +  D  T  H +A  G  E+ + ++   S D   VD  DGN  TPLH +V    + +   L+  GA++++ ++  +TP+++A S      + ++ + +L+S  +++ ++D   +   H +V +   +K +      +  E + +L++ +D    +PLHYA + G       LL  G +  L+++  N    +H A   G  N  + LL    + R   D +E  +  +H AAE G +E   FL+      L  D  G   L  +A  G    ++ +L+  I   +  D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E    LLD+C+TE   +K   +  ++Y F  L   P     + +R    +Y     L +MV  ++++LL HP+    L  KW  +G    L++L +Y                         + G +      S+   D+++       ++ ++LF +    ++L  ++  +  D    + I  ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW + +TL ++   FF L   FG +FY+    Q  F     + ++S  M +G+ +Y   F+        +Y     I +I F L +P    NL IGLAVGDI  +   A L+   ++V     +E  L
Sbjct:   73 LHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQ--NCYRLSPLHLAIQLFH-NSIALILHSTTDIN-LEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSC-----SAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNS--EFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLL--GLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENG-HEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIY-------------------------SLGLIPLTLMISNDFYDTQYTRVCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGS--NIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKL 973          

HSP 2 Score: 71.633 bits (174), Expect = 6.806e-12
Identity = 95/405 (23.46%), Postives = 171/405 (42.22%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQ---IDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIE-GHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGAD---VNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVV 1492
            S LH AV     DVV   +++   +++  S N   +H AA +   EIV+ +    +     +D  D   +T LH +    H  + E L+S GA+++  + +  + L      +  + + +LLS  A + +K   G+  + +  ++ G +K LN   E ++ E  N+   ++++D +G + + +A ++               +NN L    +++  S                       ++  +PLH+A      N   +LL   +D   +N  +    TP+ +A       +N +E I  L+     LL+ D +  T  HY       +TIK L+ T  G     LI+  D    + +H A + G  +   +LLE GA   L A N    IH A + G  + V
Sbjct:  245 SPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNS--EFLQME--NIKKLVSDEDCEGCTPLHYACRHGVPN----------SVNNLLGLNMSLYSKS-----------------------KNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLA------AENGHEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIG-----LIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNA-NGASYIHEAIRFGKKDTV 600          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 206.453 bits (524), Expect = 6.846e-54
Identity = 236/984 (23.98%), Postives = 444/984 (45.12%), Query Frame = 2
Query:  176 ESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFE-LIEPRSWDINTVD-RDGN--TPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLV-ERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAE--NDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKY-NEEITIELLD---------KCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITS----PTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            + ++   + +A + GN++ + M+  +  +  +  LD+  N + LH+AV +N+ D +  LL    D NI     + P+HLA Q     I E L    T  I+     G T +  AC + +   +  LL  GA +               ++N L                   G  P+ + A  G +K ++ +L+K +     +   +N  + + +S +  A+QN N++V++ C+  GA I+ +  D  T  H +A  G  E+ + ++   S D   VD  DGN  TPLH +V    + +   L+  GA++++ ++  +TP+++A S      + ++ + +L+S  +++ ++D   +   H +V +   +K +      +  E + +L++ +D    +PLHYA + G       LL  G +  L+++  N    +H A   G  N  + LL    + R   D +E  +  +H AAE G +E   FL+      L  D  G   L  +A  G    ++ +L+  I   +  D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E   + +L+         +C          +NN + Y          +P ++      L +MV  ++++LL HP+    L  KW  +G    L++L +Y L +I ++  I      ++   + E     +      + ++  EF + L   ++ ++LF +    ++L  ++  +  D    + I  ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW + +TL ++   FF L   FG +FY+    Q  F     + ++S  M +G+ +Y   F+        +Y     I +I F L +P    NL IGLAVGDI  +   A L+   ++V     +E  L
Sbjct:   66 DDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGN-TPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKL--------------CKQNKL-------------------GCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSC-----SAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNS--EFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLL--GLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENG-HEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKVGILNVSQYNFTYLQCPLSFRKAHKRENN-VHY----------EPLTT------LNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAIIEECEH--LKRTDFYNSSMKQEFCMGL---VFCMSLFGIVKEAVQLCQQKLAYIGDGS--NIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKL 981          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 206.068 bits (523), Expect = 7.769e-54
Identity = 232/945 (24.55%), Postives = 433/945 (45.82%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKID--VNIMGSKNVRPIHLAAQRNLVEIVEIL-CKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESD-KISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFE-LIEPRSWDINTVD-RDGN--TPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLV-ERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAE--NDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQR----YY----ALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGII--FIKLLTERSRFFQDQYCFSFIFCALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITS----PTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            LH+A      D++  ++    +  +N + S+   P+H A Q+N ++ +++L C+     I   +    + LH+A +  H N +  +L     +N LE D   + +     K++ E + +LL   A L  ++  G  P+ + A  G +K ++ +L+K +     +   +N  + + +S +  A+QN N++V++ C+  GA I+ +  D  T  H +A  G  E+ + ++   S D   VD  DGN  TPLH +V    + +   L+  GA++++ ++  +TP+++A S      + ++ + +L+S  +++ ++D   +   H +V +   +K +      +  E + +L++ +D    +PLHYA + G       LL  G +  L+++  N    +H A   G  N  + LL    + R   D +E  +  +H AAE G +E   FL+      L  D  G   L  +A  G    ++ +L+  I   +  D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E    LLD+C+TE   +K   +  ++Y F  L   P     + +R    +Y     L +MV  ++++LL HP+    L  KW  +G    L++L +Y                         + G +                L +++  Y L     GI+   ++L  ++  +  D    + I  ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW + +TL ++   FF L   FG +FY+    Q  F     + ++S  M +G+ +Y   F+        +Y     I +I F L +P    NL IGLAVGDI  +   A L+   ++V     +E  L
Sbjct:   51 LHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQ--NCYRLSPLHLAIQLFH-NSIALILHSTTDIN-LEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSC-----SAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNS--EFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLL--GLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENG-HEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQC-PLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIY-------------------------SLGLI-------------PLTLMISNDFYVLIQLLFGIVKEAVQLCQQKLAYIGDGS--NIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLKPLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKL 940          

HSP 2 Score: 71.633 bits (174), Expect = 5.968e-12
Identity = 95/405 (23.46%), Postives = 171/405 (42.22%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQ---IDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIE-GHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGAD---VNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVV 1492
            S LH AV     DVV   +++   +++  S N   +H AA +   EIV+ +    +     +D  D   +T LH +    H  + E L+S GA+++  + +  + L      +  + + +LLS  A + +K   G+  + +  ++ G +K LN   E ++ E  N+   ++++D +G + + +A ++               +NN L    +++  S                       ++  +PLH+A      N   +LL   +D   +N  +    TP+ +A       +N +E I  L+     LL+ D +  T  HY       +TIK L+ T  G     LI+  D    + +H A + G  +   +LLE GA   L A N    IH A + G  + V
Sbjct:  223 SPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNS--EFLQME--NIKKLVSDEDCEGCTPLHYACRHGVPN----------SVNNLLGLNMSLYSKS-----------------------KNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLA------AENGHEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIG-----LIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNA-NGASYIHEAIRFGKKDTV 578          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 214.927 bits (546), Expect = 1.202e-56
Identity = 252/1011 (24.93%), Postives = 449/1011 (44.41%), Query Frame = 2
Query:  155 KFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDT-LNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI----EPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFR--DINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH---IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA-----------LMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDS--EFVLKLNSAIYSL-TLFRLGIIFIKLLTERSRFFQDQ--------YCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYF 3058
            K  K+ DE+  +  + +A   G VE ++++        L  +D   N + LH A  +NQ + V +LL+   + N+     + P+H+A      E++++L + +   I+     G TAL   C + +S                                 E ++ILL   A L   +  G  PV  AA  G  K +  +L     +NG   +T +N  +    S +  A+Q+ +L+++++CL NGA I+          H +A  G  ++ +L+       S  +N VD +  T LH A      ++   L+ +GAD+N+++   ++P+++A +S      ++ I+ +L+   + + I+D   +   H  V++       Y +R +  E + Q+ ++++L         +PLHYA + G       LL         +++    +H A   G +N  + LL+   +TR     D++  + +H AA+ G  ++ + L++ G   L+ D  G   L  ++ GG    ++ IL   +   +  D++ NTALHFAA  GH + +  L  + A    N    S    AL N RK+VV   + +  W + ++    N  S+   I  +++Y  E    LLD C+     +KS Q+  I+Y F  L      P S  ++              L  MV   ++ LL HP+    L  KW  +G    +++L  Y L +I ++  +  I           +TG +   + T    +D+   F +K+   +  L ++F      I++  ++  +F D         Y  S IF  L +FL      NIP   +W    + +F  +  FL ++Q   + GI + M   +FKTL +    F  L   FG +FY++   Q  F   L S +++  M +G+ +Y + F+    +  LA P+L    +I F +F+P    NL IGLAVGDI  +   A L+   ++V    E+ TNL K +  ++
Sbjct:   56 KLSKYEDEN--LCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGN-TPLHCAAEKNQVESVKFLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNS---------------------------------EALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELIL-AYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASA-----SWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQ------PYGLRNLRPEFM-QMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLS-DHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQC----PLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKI----QPGMAFNSTGIINGTSSTHEERIDTLNSFPIKICMILVFLSSIFGYCKEVIQIFQQKRNYFLDYNNALEWVIYTTSIIF-VLPLFL------NIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQV----ELHTNLEKKLPLWY 997          

HSP 2 Score: 52.7582 bits (125), Expect = 2.933e-6
Identity = 46/195 (23.59%), Postives = 84/195 (43.08%), Query Frame = 2
Query:   47 MSLNNKISPPPNYANHSNVTIAIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASV--NKLESDKISVLHHPARK 625
            M  +N    P +YA    V +++ + L F   + S          ++   + +A  +G +   + + +D+    L     ++  + LH A  +N  D V  LL  K  + +        +H A+     + ++++        D +D +G TALH A R GH+  V  LLSY A +  NK ++  + +  H  RK
Sbjct:  408 MDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHS-------KSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAA-KNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRK 594          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 210.305 bits (534), Expect = 2.829e-55
Identity = 245/1003 (24.43%), Postives = 438/1003 (43.67%), Query Frame = 2
Query:  155 KFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDT-LNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI----EPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFR--DINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH---IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA-----------LMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXX---XXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYF 3058
            K  K+ DE+  +  + +A   G VE ++++        L  +D   N + LH A  +NQ + V +LL+   + N+     + P+H+A      E++++L + +   I+     G TAL   C + +S                                 E ++ILL   A L   +  G  PV  AA  G  K +  +L     +NG   +T +N  +    S +  A+Q+ +L+++++CL NGA I+          H +A  G  ++ +L+       S  +N VD +  T LH A      ++   L+ +GAD+N+++   ++P+++A +S      ++ I+ +L+   + + I+D   +   H  V++       Y +R +  E + Q+ ++++L         +PLHYA + G       LL         +++    +H A   G +N  + LL+   +TR     D++  + +H AA+ G  ++ + L++ G   L+ D  G   L  ++ GG    ++ IL   +   +  D++ NTALHFAA  GH + +  L  + A    N    S    AL N RK+VV   + +  W + ++    N  S+   I  +++Y  E    LLD C+     +KS Q+  I+Y F  L      P S  ++              L  MV   ++ LL HP+    L  KW  +G    +++L      ++ +  +   I       +T  +N T+    S ++     L   + L  N+A+    ++   IIF+                      L +FL      NIP   +W    + +F  +  FL ++Q   + GI + M   +FKTL +    F  L   FG +FY++   Q  F   L S +++  M +G+ +Y + F+    +  LA P+L    +I F +F+P    NL IGLAVGDI  +   A L+   ++V    E+ TNL K +  ++
Sbjct:   56 KLSKYEDEN--LCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGN-TPLHCAAEKNQVESVKFLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNS---------------------------------EALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELIL-AYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASA-----SWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQ------PYGLRNLRPEFM-QMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLS-DHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQC----PLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAFNSTGIINGTS----STHEERIDTLKRNYFLDYNNAL-EWVIYTTSIIFV----------------------LPLFL------NIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQV----ELHTNLEKKLPLWY 967          

HSP 2 Score: 52.7582 bits (125), Expect = 2.915e-6
Identity = 46/195 (23.59%), Postives = 84/195 (43.08%), Query Frame = 2
Query:   47 MSLNNKISPPPNYANHSNVTIAIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASV--NKLESDKISVLHHPARK 625
            M  +N    P +YA    V +++ + L F   + S          ++   + +A  +G +   + + +D+    L     ++  + LH A  +N  D V  LL  K  + +        +H A+     + ++++        D +D +G TALH A R GH+  V  LLSY A +  NK ++  + +  H  RK
Sbjct:  408 MDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHS-------KSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAA-KNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRK 594          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 179.874 bits (455), Expect = 2.461e-45
Identity = 140/530 (26.42%), Postives = 236/530 (44.53%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK---------------------------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG 1813
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA +     D+++ LH  AR   + + +ILL + AP+  K+ NG +P+ +AA   H+  +  LL+     N  + D      +D  + +  A    +  V ++ L  GA  N++ ++G T  H +       + EL+      I+ V   G TPLH A +   L IV  LL+ GA  N SN   +TP+ +A  +      + E+ K L+   +    + +  +T  H      +   +K L+   +   L        L+                             +PLH AAK G + + ++LLE  A P    +N    +H+A    NL++VKLLL     + +    N  + +H AA++ + E+ R L++ G    A+   G   L L+A+ G+ ++V  +L  + N NL ++   T LH  +  GH+ V   L +HG
Sbjct:  181 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLN-RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQY----NAEIDDIT----LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARA-----GHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHG 695          

HSP 2 Score: 158.303 bits (399), Expect = 1.469e-38
Identity = 151/613 (24.63%), Postives = 269/613 (43.88%), Query Frame = 2
Query:  230 YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYG---------------------ASV--------NKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENGNV---------SDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLN 1903
            ++KMV + + K  +    T    + LH A    Q +VV  L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q  A +  G T L +A ++GH N+V  L++YG                     A+V        + L     + LH  A   +L + ++LL+  A +     NG TP+ IA+  G++ ++  LL++                  A NG+V            +  K  +G S I  A Q  +L+ +++ L   A+I++  +D  T  H +A  G   + +++  +    N+   +G TPLH A     + ++  LL+ GA ++       TP+ VA  S +    +  I+K L+   ++  + + K++T  H      + +  KYL++  +        +      ++PLH AA++G   + K+LLE GA P L     H  +H A +EG+++    LLE             + L H AA+ GK  +   L+E      A    G   L ++    N+DIV+ +L    +P+       T LH AA    +EV + L ++G     +++  ++P   A      ++V   L+
Sbjct:   61 HVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATE-DGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVA--SFM---GHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDD------QTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPL-HVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLS 660          

HSP 3 Score: 151.369 bits (381), Expect = 2.004e-36
Identity = 129/506 (25.49%), Postives = 231/506 (45.65%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            T N  S +H A   +  D V  LL +  +++ +   ++ P+H+AA      + ++L  K   + ++  + G T LHIAC++ H  ++E LL  GAS++ +    ++ LH  +    L ++K LL   A   + +   +TP+ +AA  GH +V  +LL+             N K  D  + +  A +  +  ++++ L NGA  N     G T  HT+A  G  +    +  +      + + G TPLH A     + +   LLE  A  N + +   TP+ VA        NN +I+K+L+    +         T  H   ++  I+  + L++           N + +   +PLH AA+ G  E+  +LL   A+  L  ++    +HL ++EG++ V  +L++  +       +  + L H A+  G  ++ +FL++   D  AK   G + L  +A+ G+ DIV  +LKN  +PN       T L  A   G++ V   L
Sbjct:  306 TKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGA-KPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA--------KANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHH-----NNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGS------ANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPL-HVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 790          

HSP 4 Score: 146.747 bits (369), Expect = 5.035e-35
Identity = 144/562 (25.62%), Postives = 244/562 (43.42%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA-------CSSLL---NTD------------------NNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFL 1900
            +D+N      +  +HLA++   V++V  L  K  + ++    KG TALHIA   G   +V  L++YGA+VN       + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    NL V Q+ L  GA +N    +G T  H ++  G   +  L+  R   I T  +D  TPLH A  N  + I   LL+ GA +    +   +PI +A       C  LL   N +                   ++ + K+L+   +    R     T  H   ++ +I+ ++ L++T +       I+       +PLH A+ +G + I K LL+ GA P +        +H+A + G+  V K LL+   +       +++ L H AA  G   + + L+E G         G   L  +A+ G++D    +L+ + +     +K  T LH AA  G + + + L  H A       N L+P   A+ ++  D+VK  L
Sbjct:   40 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEII-LETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGAS------IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL-HCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 593          

HSP 5 Score: 145.591 bits (366), Expect = 1.204e-34
Identity = 136/551 (24.68%), Postives = 245/551 (44.46%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       +   LL     +       + PIH+AAQ + ++ V +L +    +ID + +   T LH+A   GH  + + LL  GA  N    +  + LH   +KN + ++++LL   A +   + +G TP+ +A+  GH+ ++  LL++    + NVS+   E      + +  A +  + EV +  L N A  N K  D +T  H +A  G   + +L+       N     G+TPLH A     ++  + LLE  A      +   TP+ VA            + ++L+  +++     +   T  H  V   N+  +K L+    G       N       +PLH AAK   IE+ + LL+ G      +      +HLA +EG+  +V LLL            N+S L  +H  ++EG   +   LI+ G+   A    G   L +++  GNI +V+++L+++ + N   +   + LH AA  GH +++  L ++GA
Sbjct:  238 FTPQNGITPLHIASRRGNVIMVRLL---LDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNA-EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVE------TPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKY-----GKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWN-----GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG---NKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 762          

HSP 6 Score: 100.908 bits (250), Expect = 5.827e-21
Identity = 95/370 (25.68%), Postives = 166/370 (44.86%), Query Frame = 2
Query:  806 DIDGNSCISF--AIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV--SANSNLLIRD----------EKLKTVFHYLVE-----RINIKTIKYLIR---TISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN 1840
            D   ++  SF  A ++ NL+     L NG DIN    +G    H ++  G  ++   +  +   + T  + GNT LH A       +V +L+  GA+VN  ++   TP+ +A       +N+ E++K L+   AN N+   D          +  + V  +L+      ++ +  +    R   T +  +L Q     D+  K   +PLH AA   ++ + ++LL  GA      +N    +H+A++ GN+ +V+LLL+   +    R  +E + +H AA  G   I   L++ G    AK   G + + ++A+G ++D V  +L+     +       T LH AA  GH  V K L   GA+      N
Sbjct:   11 DPAADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ-----ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-RTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALN 374          

HSP 7 Score: 97.4413 bits (241), Expect = 6.590e-20
Identity = 74/281 (26.33%), Postives = 131/281 (46.62%), Query Frame = 2
Query:  197 IFYAVQHGNVE-YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA 1036
            +  A + G+V+  L ++ K+  + C+    T   F+ LH A    +  +   LL      N  G   + P+H+A   N ++IV++L   R     +    G T LHIA ++    +  +LL YG S N      ++ LH  A++   EM+ +LLS +A   + + +G TP+ + + EGH+ V + L+     ++G   D        G + +  A    N+++++  L + AD+N K   G +  H +A  G  ++  L+       N V  +G TPL  A
Sbjct:  511 LHTAAREGHVDTALALLEKEASQACM----TKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLI-----KHGVTVDATTRM---GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 778          

HSP 8 Score: 79.337 bits (194), Expect = 2.125e-14
Identity = 50/157 (31.85%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  281 DTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            ++V   + LH A  E   ++VA LL+ + + N+     + P+HL +Q   V + ++L K   + +DA    G T LH+A   G+  +V+ LL + A VN       S LH  A++   +++ +LL   A     SSNG TP+ IA   G+I V + L
Sbjct:  635 ESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIK-HGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 790          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 179.874 bits (455), Expect = 2.493e-45
Identity = 140/530 (26.42%), Postives = 236/530 (44.53%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK---------------------------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG 1813
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA +     D+++ LH  AR   + + +ILL + AP+  K+ NG +P+ +AA   H+  +  LL+     N  + D      +D  + +  A    +  V ++ L  GA  N++ ++G T  H +       + EL+      I+ V   G TPLH A +   L IV  LL+ GA  N SN   +TP+ +A  +      + E+ K L+   +    + +  +T  H      +   +K L+   +   L        L+                             +PLH AAK G + + ++LLE  A P    +N    +H+A    NL++VKLLL     + +    N  + +H AA++ + E+ R L++ G    A+   G   L L+A+ G+ ++V  +L  + N NL ++   T LH  +  GH+ V   L +HG
Sbjct:  173 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLN-RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQY----NAEIDDIT----LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARA-----GHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHG 687          

HSP 2 Score: 157.918 bits (398), Expect = 1.765e-38
Identity = 151/613 (24.63%), Postives = 269/613 (43.88%), Query Frame = 2
Query:  230 YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYG---------------------ASV--------NKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENGNV---------SDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLN 1903
            ++KMV + + K  +    T    + LH A    Q +VV  L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q  A +  G T L +A ++GH N+V  L++YG                     A+V        + L     + LH  A   +L + ++LL+  A +     NG TP+ IA+  G++ ++  LL++                  A NG+V            +  K  +G S I  A Q  +L+ +++ L   A+I++  +D  T  H +A  G   + +++  +    N+   +G TPLH A     + ++  LL+ GA ++       TP+ VA  S +    +  I+K L+   ++  + + K++T  H      + +  KYL++  +        +      ++PLH AA++G   + K+LLE GA P L     H  +H A +EG+++    LLE             + L H AA+ GK  +   L+E      A    G   L ++    N+DIV+ +L    +P+       T LH AA    +EV + L ++G     +++  ++P   A      ++V   L+
Sbjct:   53 HVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATE-DGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVA--SFM---GHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDD------QTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPL-HVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLS 652          

HSP 3 Score: 150.984 bits (380), Expect = 2.267e-36
Identity = 129/506 (25.49%), Postives = 231/506 (45.65%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            T N  S +H A   +  D V  LL +  +++ +   ++ P+H+AA      + ++L  K   + ++  + G T LHIAC++ H  ++E LL  GAS++ +    ++ LH  +    L ++K LL   A   + +   +TP+ +AA  GH +V  +LL+             N K  D  + +  A +  +  ++++ L NGA  N     G T  HT+A  G  +    +  +      + + G TPLH A     + +   LLE  A  N + +   TP+ VA        NN +I+K+L+    +         T  H   ++  I+  + L++           N + +   +PLH AA+ G  E+  +LL   A+  L  ++    +HL ++EG++ V  +L++  +       +  + L H A+  G  ++ +FL++   D  AK   G + L  +A+ G+ DIV  +LKN  +PN       T L  A   G++ V   L
Sbjct:  298 TKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGA-KPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA--------KANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHH-----NNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGS------ANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPL-HVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 782          

HSP 4 Score: 146.747 bits (369), Expect = 5.094e-35
Identity = 144/562 (25.62%), Postives = 244/562 (43.42%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA-------CSSLL---NTD------------------NNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFL 1900
            +D+N      +  +HLA++   V++V  L  K  + ++    KG TALHIA   G   +V  L++YGA+VN       + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    NL V Q+ L  GA +N    +G T  H ++  G   +  L+  R   I T  +D  TPLH A  N  + I   LL+ GA +    +   +PI +A       C  LL   N +                   ++ + K+L+   +    R     T  H   ++ +I+ ++ L++T +       I+       +PLH A+ +G + I K LL+ GA P +        +H+A + G+  V K LL+   +       +++ L H AA  G   + + L+E G         G   L  +A+ G++D    +L+ + +     +K  T LH AA  G + + + L  H A       N L+P   A+ ++  D+VK  L
Sbjct:   32 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEII-LETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGAS------IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL-HCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 585          

HSP 5 Score: 145.206 bits (365), Expect = 1.547e-34
Identity = 136/551 (24.68%), Postives = 245/551 (44.46%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       +   LL     +       + PIH+AAQ + ++ V +L +    +ID + +   T LH+A   GH  + + LL  GA  N    +  + LH   +KN + ++++LL   A +   + +G TP+ +A+  GH+ ++  LL++    + NVS+   E      + +  A +  + EV +  L N A  N K  D +T  H +A  G   + +L+       N     G+TPLH A     ++  + LLE  A      +   TP+ VA            + ++L+  +++     +   T  H  V   N+  +K L+    G       N       +PLH AAK   IE+ + LL+ G      +      +HLA +EG+  +V LLL            N+S L  +H  ++EG   +   LI+ G+   A    G   L +++  GNI +V+++L+++ + N   +   + LH AA  GH +++  L ++GA
Sbjct:  230 FTPQNGITPLHIASRRGNVIMVRLL---LDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNA-EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVE------TPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKY-----GKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWN-----GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG---NKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 754          

HSP 6 Score: 99.7525 bits (247), Expect = 1.422e-20
Identity = 94/367 (25.61%), Postives = 165/367 (44.96%), Query Frame = 2
Query:  815 GNSCISF--AIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV--SANSNLLIRD----------EKLKTVFHYLVE-----RINIKTIKYLIR---TISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN 1840
             ++  SF  A ++ NL+     L NG DIN    +G    H ++  G  ++   +  +   + T  + GNT LH A       +V +L+  GA+VN  ++   TP+ +A       +N+ E++K L+   AN N+   D          +  + V  +L+      ++ +  +    R   T +  +L Q     D+  K   +PLH AA   ++ + ++LL  GA      +N    +H+A++ GN+ +V+LLL+   +    R  +E + +H AA  G   I   L++ G    AK   G + + ++A+G ++D V  +L+     +       T LH AA  GH  V K L   GA+      N
Sbjct:    6 ADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ-----ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-RTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALN 366          

HSP 7 Score: 97.4413 bits (241), Expect = 7.247e-20
Identity = 74/281 (26.33%), Postives = 131/281 (46.62%), Query Frame = 2
Query:  197 IFYAVQHGNVE-YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA 1036
            +  A + G+V+  L ++ K+  + C+    T   F+ LH A    +  +   LL      N  G   + P+H+A   N ++IV++L   R     +    G T LHIA ++    +  +LL YG S N      ++ LH  A++   EM+ +LLS +A   + + +G TP+ + + EGH+ V + L+     ++G   D        G + +  A    N+++++  L + AD+N K   G +  H +A  G  ++  L+       N V  +G TPL  A
Sbjct:  503 LHTAAREGHVDTALALLEKEASQACM----TKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLI-----KHGVTVDATTRM---GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 770          

HSP 8 Score: 79.7221 bits (195), Expect = 2.006e-14
Identity = 50/157 (31.85%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  281 DTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            ++V   + LH A  E   ++VA LL+ + + N+     + P+HL +Q   V + ++L K   + +DA    G T LH+A   G+  +V+ LL + A VN       S LH  A++   +++ +LL   A     SSNG TP+ IA   G+I V + L
Sbjct:  627 ESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIK-HGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 782          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 179.874 bits (455), Expect = 2.566e-45
Identity = 140/530 (26.42%), Postives = 236/530 (44.53%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK---------------------------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG 1813
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA +     D+++ LH  AR   + + +ILL + AP+  K+ NG +P+ +AA   H+  +  LL+     N  + D      +D  + +  A    +  V ++ L  GA  N++ ++G T  H +       + EL+      I+ V   G TPLH A +   L IV  LL+ GA  N SN   +TP+ +A  +      + E+ K L+   +    + +  +T  H      +   +K L+   +   L        L+                             +PLH AAK G + + ++LLE  A P    +N    +H+A    NL++VKLLL     + +    N  + +H AA++ + E+ R L++ G    A+   G   L L+A+ G+ ++V  +L  + N NL ++   T LH  +  GH+ V   L +HG
Sbjct:  181 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLN-RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQY----NAEIDDIT----LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARA-----GHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHG 695          

HSP 2 Score: 158.303 bits (399), Expect = 1.467e-38
Identity = 151/613 (24.63%), Postives = 269/613 (43.88%), Query Frame = 2
Query:  230 YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYG---------------------ASV--------NKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENGNV---------SDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLN 1903
            ++KMV + + K  +    T    + LH A    Q +VV  L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q  A +  G T L +A ++GH N+V  L++YG                     A+V        + L     + LH  A   +L + ++LL+  A +     NG TP+ IA+  G++ ++  LL++                  A NG+V            +  K  +G S I  A Q  +L+ +++ L   A+I++  +D  T  H +A  G   + +++  +    N+   +G TPLH A     + ++  LL+ GA ++       TP+ VA  S +    +  I+K L+   ++  + + K++T  H      + +  KYL++  +        +      ++PLH AA++G   + K+LLE GA P L     H  +H A +EG+++    LLE             + L H AA+ GK  +   L+E      A    G   L ++    N+DIV+ +L    +P+       T LH AA    +EV + L ++G     +++  ++P   A      ++V   L+
Sbjct:   61 HVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATE-DGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVA--SFM---GHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDD------QTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPL-HVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLS 660          

HSP 3 Score: 151.369 bits (381), Expect = 2.107e-36
Identity = 128/506 (25.30%), Postives = 230/506 (45.45%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            T N  S +H A   +  D V  LL +  +++ +   ++ P+H+AA      + ++L  K   + ++  + G T LHIAC++ H  ++E LL  GAS++ +    ++ LH  +    L ++K LL   A   + +   +TP+ +AA  GH +V  +LL+     N    D          + +  A +  +  ++++ L NGA  N     G T  HT+A  G  +    +  +      + + G TPLH A     + +   LLE  A  N + +   TP+ VA        NN +I+K+L+    +         T  H   ++  I+  + L++           N + +   +PLH AA+ G  E+  +LL   A+  L  ++    +HL ++EG++ V  +L++  +       +  + L H A+  G  ++ +FL++   D  AK   G + L  +A+ G+ DIV  +LKN  +PN       T L  A   G++ V   L
Sbjct:  306 TKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGA-KPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDD--------QTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHH-----NNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGS------ANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPL-HVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 790          

HSP 4 Score: 146.747 bits (369), Expect = 4.987e-35
Identity = 145/563 (25.75%), Postives = 247/563 (43.87%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVE-IVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA-------CSSLL---NTD------------------NNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFL 1900
            +D+N      +  +HLA++   V+ +VE+L K+  + ++    KG TALHIA   G   +V  L++YGA+VN       + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    NL V Q+ L  GA +N    +G T  H ++  G   +  L+  R   I T  +D  TPLH A  N  + I   LL+ GA +    +   +PI +A       C  LL   N +                   ++ + K+L+   +    R     T  H   ++ +I+ ++ L++T +       I+       +PLH A+ +G + I K LL+ GA P +        +H+A + G+  V K LL+   +       +++ L H AA  G   + + L+E G         G   L  +A+ G++D    +L+ + +     +K  T LH AA  G + + + L  H A       N L+P   A+ ++  D+VK  L
Sbjct:   40 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKE--IILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGAS------IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL-HCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 593          

HSP 5 Score: 145.591 bits (366), Expect = 1.344e-34
Identity = 136/551 (24.68%), Postives = 245/551 (44.46%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       +   LL     +       + PIH+AAQ + ++ V +L +    +ID + +   T LH+A   GH  + + LL  GA  N    +  + LH   +KN + ++++LL   A +   + +G TP+ +A+  GH+ ++  LL++    + NVS+   E      + +  A +  + EV +  L N A  N K  D +T  H +A  G   + +L+       N     G+TPLH A     ++  + LLE  A      +   TP+ VA            + ++L+  +++     +   T  H  V   N+  +K L+    G       N       +PLH AAK   IE+ + LL+ G      +      +HLA +EG+  +V LLL            N+S L  +H  ++EG   +   LI+ G+   A    G   L +++  GNI +V+++L+++ + N   +   + LH AA  GH +++  L ++GA
Sbjct:  238 FTPQNGITPLHIASRRGNVIMVRLL---LDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNA-EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVE------TPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKY-----GKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWN-----GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG---NKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 762          

HSP 6 Score: 100.908 bits (250), Expect = 5.872e-21
Identity = 95/370 (25.68%), Postives = 166/370 (44.86%), Query Frame = 2
Query:  806 DIDGNSCISF--AIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV--SANSNLLIRD----------EKLKTVFHYLVE-----RINIKTIKYLIR---TISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN 1840
            D   ++  SF  A ++ NL+     L NG DIN    +G    H ++  G  ++   +  +   + T  + GNT LH A       +V +L+  GA+VN  ++   TP+ +A       +N+ E++K L+   AN N+   D          +  + V  +L+      ++ +  +    R   T +  +L Q     D+  K   +PLH AA   ++ + ++LL  GA      +N    +H+A++ GN+ +V+LLL+   +    R  +E + +H AA  G   I   L++ G    AK   G + + ++A+G ++D V  +L+     +       T LH AA  GH  V K L   GA+      N
Sbjct:   11 DPAADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ-----ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-RTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALN 374          

HSP 7 Score: 97.4413 bits (241), Expect = 6.586e-20
Identity = 74/281 (26.33%), Postives = 131/281 (46.62%), Query Frame = 2
Query:  197 IFYAVQHGNVE-YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA 1036
            +  A + G+V+  L ++ K+  + C+    T   F+ LH A    +  +   LL      N  G   + P+H+A   N ++IV++L   R     +    G T LHIA ++    +  +LL YG S N      ++ LH  A++   EM+ +LLS +A   + + +G TP+ + + EGH+ V + L+     ++G   D        G + +  A    N+++++  L + AD+N K   G +  H +A  G  ++  L+       N V  +G TPL  A
Sbjct:  511 LHTAAREGHVDTALALLEKEASQACM----TKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLI-----KHGVTVDATTRM---GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 778          

HSP 8 Score: 79.337 bits (194), Expect = 2.161e-14
Identity = 50/157 (31.85%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  281 DTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            ++V   + LH A  E   ++VA LL+ + + N+     + P+HL +Q   V + ++L K   + +DA    G T LH+A   G+  +V+ LL + A VN       S LH  A++   +++ +LL   A     SSNG TP+ IA   G+I V + L
Sbjct:  635 ESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIK-HGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 790          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. UniProt/SwissProt
Match: sp|O75762|TRPA1_HUMAN (Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=TRPA1 PE=1 SV=3)

HSP 1 Score: 226.868 bits (577), Expect = 1.080e-59
Identity = 246/975 (25.23%), Postives = 432/975 (44.31%), Query Frame = 2
Query:  197 IFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EPRSWDI-NTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFR--DINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG---KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQR------YYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXX---XXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            + YA   G +E ++ + +D     L  +D   N + LH AV +NQ + V +LL+   + N+     + P+H+A Q    E++++L + RT+ ++     G TA+ IAC   +S  ++ LL  GA   K        +H  A     E ++I+L +         +G +  +      HI  +N         NG  +             +  A+QN +LE++++CL NGA I+       T  H +A  G  E+ +L+      S DI NT D    T LH A       +   L+ +GAD+N  +   ++P+++A +S      ++ I+ +L+S  + + I+D   +   H  V++       Y ++ +  E + Q+  +++L         +PLHYA + G       LL         +++    +H A   G +N  + LL+   +TR     D++  + +H AA+ G  ++ + L++ G   L+ D  G   L  ++ GG    ++ IL   +   +  D+  NTALHFAA  GH + +  L  H A    N    S    AL N RK+VV   +    W + ++    N    K  I  +I+Y  E    LLD C+     +KS ++  I+Y F  L    +    +  +        AL +MV   ++ LL HP+    L  KW  +G    +++L      ++ +  +   I       +T  +NET+      + T+S  + +  +L   S+I+       G IF +   +R+ F        +I     +   +     IP   +W    + ++  +  FL ++Q   + GI + M   + KTL +  + F  L   FG +FYI+   Q PF   L S +++  M +G+ +Y   F+    +  LA P+L    ++ F +F+P    NL IGLAVGDI  +   A L+   ++VE    +E  L
Sbjct:   67 LHYAAAEGQIELMEKITRDSSLEVLHEMDDYGN-TPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRF------GEEHGYSRQL------HINFMN---------NGKATP------------LHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASA-----SWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQ------PYGLKNLRPEFM-QMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLS-DHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLSSIFGYCK-EAGQIFQQ---KRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKL 990          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. UniProt/SwissProt
Match: sp|Q6RI86|TRPA1_RAT (Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Trpa1 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 4.789e-57
Identity = 250/1011 (24.73%), Postives = 453/1011 (44.81%), Query Frame = 2
Query:  155 KFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI----EPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFR--DINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHE--NGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA-----------LMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXX---XXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSL-TLFRLGIIFIKLLTERSRFFQDQ--------YCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYF 3058
            K  K+ DE+  +  + +A   G VE ++++        L  +D   N + LH+A  +NQ + V +LL+   + N+     + P+H+A Q    E++++L + +   I+     G TAL   C + +S  ++ LL  GA + K  S+K                                G  PV  AA  G  + +  +L   +    +    +N  +    S +  A+Q+ +L+++++CL +GA I+          H +A  G  ++ +L+       S  +N VD +  T LH A      ++   L+ +GAD+N+++   ++P+++A +S      ++ I+ +L+S  + + I+D   +   H  V++       Y +R +  E L Q+ ++++L         +PLHYA + G       LL         +++    +H A   G +N  + LL+   +TR     D++  + +H AA+ G  ++ + L++ G   L+ D  G   L  ++ GG    ++ IL   +   +  D++ NTALHFAA  GH + +  L  + A    N    S    AL N RK+VV   +    W + ++ + H+  + +  I  +++Y  E    LLD C+     +KS Q+  I+Y F  L      P S  ++              L  MV   ++ LL HP+    L  KW  +G    +++L      ++ +  +   I       +T  +NET    IS ++     L+S F LK+   +  L ++F      +++  ++  +F D         Y  S IF  L +FL      +IP   +W    + +F  +  FL ++Q   + GI + M   +FKTL +    F  L   FG +FY++   Q  F   L S +++  M +G+ +Y + F+    +  LA P+L    +I F +F+P    NL IGLAVGDI  +   A L+   ++V    E+ TNL K +  ++
Sbjct:   56 KLSKYEDEN--LCLLHHAAAEGQVELMQLIINGSSCEALNVMDDYGN-TPLHWAAEKNQVESVKFLLSQGANPNLRNRNMMAPLHIAVQGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCK--SNKW-------------------------------GDYPVHQAAFSGAKRCMELILAYGEKTGYSREAHINFVNHKKASPLHLAVQSGDLDMIKMCLDSGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLADYLISVGADINSTDSEGRSPLILATASA-----SWNIVNLLLSKGAKVDIKDHLGRNFLHLTVQQ------PYGLRNLRPEFL-QMQHIKELVMDEDNDGCTPLHYACRQGAPVSVNNLLRFNVSVHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLS-DHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRSKRWDECLQVFTHDSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQC----PLSMTKKVTPTQDVIYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAFNSTGIINET----ISTHEERINTLNS-FPLKICMILVFLSSIFGYCKEVVQIFQQKRNYFLDYNNALEWVIYTTSMIF-VLPLFL------DIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQV----ELHTNLEKKLPFWY 997          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. UniProt/SwissProt
Match: sp|Q8BLA8|TRPA1_MOUSE (Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus OX=10090 GN=Trpa1 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 8.411e-56
Identity = 252/1011 (24.93%), Postives = 449/1011 (44.41%), Query Frame = 2
Query:  155 KFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDT-LNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI----EPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFR--DINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH---IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA-----------LMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDS--EFVLKLNSAIYSL-TLFRLGIIFIKLLTERSRFFQDQ--------YCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYF 3058
            K  K+ DE+  +  + +A   G VE ++++        L  +D   N + LH A  +NQ + V +LL+   + N+     + P+H+A      E++++L + +   I+     G TAL   C + +S                                 E ++ILL   A L   +  G  PV  AA  G  K +  +L     +NG   +T +N  +    S +  A+Q+ +L+++++CL NGA I+          H +A  G  ++ +L+       S  +N VD +  T LH A      ++   L+ +GAD+N+++   ++P+++A +S      ++ I+ +L+   + + I+D   +   H  V++       Y +R +  E + Q+ ++++L         +PLHYA + G       LL         +++    +H A   G +N  + LL+   +TR     D++  + +H AA+ G  ++ + L++ G   L+ D  G   L  ++ GG    ++ IL   +   +  D++ NTALHFAA  GH + +  L  + A    N    S    AL N RK+VV   + +  W + ++    N  S+   I  +++Y  E    LLD C+     +KS Q+  I+Y F  L      P S  ++              L  MV   ++ LL HP+    L  KW  +G    +++L  Y L +I ++  +  I           +TG +   + T    +D+   F +K+   +  L ++F      I++  ++  +F D         Y  S IF  L +FL      NIP   +W    + +F  +  FL ++Q   + GI + M   +FKTL +    F  L   FG +FY++   Q  F   L S +++  M +G+ +Y + F+    +  LA P+L    +I F +F+P    NL IGLAVGDI  +   A L+   ++V    E+ TNL K +  ++
Sbjct:   56 KLSKYEDEN--LCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGN-TPLHCAAEKNQVESVKFLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNS---------------------------------EALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELIL-AYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASA-----SWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQ------PYGLRNLRPEFM-QMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLS-DHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQC----PLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKI----QPGMAFNSTGIINGTSSTHEERIDTLNSFPIKICMILVFLSSIFGYCKEVIQIFQQKRNYFLDYNNALEWVIYTTSIIF-VLPLFL------NIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLEPLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQV----ELHTNLEKKLPLWY 997          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. UniProt/SwissProt
Match: sp|Q18297|TRPA1_CAEEL (Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans OX=6239 GN=trpa-1 PE=2 SV=5)

HSP 1 Score: 192.971 bits (489), Expect = 1.077e-48
Identity = 250/1064 (23.50%), Postives = 450/1064 (42.29%), Query Frame = 2
Query:  197 IFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYA-------------VNENQKD-----------VVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSN-----GQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTI-FHTSAMTGFGELFE-LIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYE-IIKILVSANSNLLIRDEKLKTVFHYLVERINIKT-IKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEY-------RHENG-----KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAG------PDDPSSSG----------------------------QRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEF------VLKLNSA----IYSLTLFRLGIIFIKLLTERSRFFQDQYCF-----SFIFCALYVFLFIKNLRNIPCLN--------EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPT---------KYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQR 3052
            + YA ++GN + +K++   + KN L         + LH A             ++E+Q D           ++  L++   +++ +    + P+H AA ++    +  L K +   +DA D    T L +AC  G   +++ L+   ++V K +    +V H  A + + E +++++ +     IK+ N      +TP+ +A    H + L  +L+  K  +    D   EK++     I FA +   LEVL+  +  G +  N+L + K +  H +A     E+   LIE    +I+ VD  G TPL  AV +     V  L+   A++  +++  +TP+ +      N  ++ E I+  L   N                  ER  +K+  +  +R +S ++   ++N+ D    +P+H  A  G +E+ ++L + GA      E++  A+H A   G    V+ LLE ++     +D   +S +H AA  G     + L++ G D  AK+ Y +  L ++   G ++  + ++            K T LH AA  G+  +++     G    + +    + FD A  N  KDV + FL  D WK  M         +H N      ++   +L+    E+   ++D CI E    ++D    + Y F  LD         DD +                                +Y+ L  M   +KL+LL HPLS  LL+ KW + G       L +Y+++I+++            T  V  T       N+ S    DSE+        ++N+     ++ + +  L +   ++L E  + FQ ++ +     ++I C +Y    I       C          +W  A + +F  +   L+ I+ +P  GI V MF  + KT  + F  F      F  +FY+I +++  F  I  S LK+ VM +GEF++   F    T          ++  A  L  +F + M     NL +GLAV DI  +  +AEL+   ++V+ V ++E +L   IQR
Sbjct:   88 LHYAARYGNYDAVKLL---LSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKA-DVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMD--REKEL-----IHFAAEKGFLEVLKALVEAGGN-KNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAK--FNALSSVEYILDHLRKKNKE---------------TERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIESSSDTK-TVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCI-EKSKEETDSTQSVAYNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSL------------TQYVRHTKAPYNVWNEESY--YDSEYFDENETCPQINTTKPDVVWKIIIQTLAV--CQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQR 1104          

HSP 2 Score: 112.849 bits (281), Expect = 6.978e-24
Identity = 120/506 (23.72%), Postives = 214/506 (42.29%), Query Frame = 2
Query:  497 QTALHIACRRGHSNMV-ETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAA--IEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPL----------------------------------HYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYIL-----KNKINP------------------------NLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            ++ +H + R G+ N + E LL    +VN  + D ++ LH+ AR  + + +K+LLS  A    K+  G TP+ IA+  I G+  + + ++++ +A++    +T  +K I+       A+ + N E                                            I+ V++   TPLHYA   ++ + +  L+++ ADV+  +    TP+++AC        + EII+ L+ ANSN+  RD++L TVFH +  R   + ++ ++     E + + +NL +   K+PL                                  H+AA+ G +E+ K L+EAG +     E   + +H+A +   L VV  L+E   +     D    + +  A      +   +LI    +    D   R  + + AK   +  VEYIL     KNK                           N+ D+ +NT +H  AS G+LE+++ L +HGA
Sbjct:   51 RSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICS-IIDEDQADSARKYNTATKKIIN-------ALVSENAE--------------------------------------------IDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLAC-----VHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAI-KALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGA 498          

HSP 3 Score: 64.6994 bits (156), Expect = 4.889e-9
Identity = 57/223 (25.56%), Postives = 96/223 (43.05%), Query Frame = 2
Query: 1322 INLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATK---------------------EGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG---ARFQDNLFN---LSPFDEALANSRKDVVKYFLN 1903
            +N QD  F +PLHYAA+ G+ +  K+LL   A P          +H+A+K                     + N    K++  +  E      +N+  L  +H+AA +  +     LI++  D  A+DD     L+L+   G+ +I++ ++K   N    DQ+ NT  H  A  G  E ++ +  H    A    NLFN    +P   A+  +  + +K  L 
Sbjct:   77 VNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQ 299          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 185.267 bits (469), Expect = 3.670e-46
Identity = 142/534 (26.59%), Postives = 242/534 (45.32%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA-------------------------------CSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHG 1813
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA +     D+++ LH  AR   + + +ILL + AP+  K+ NG +P+ +AA   H+  +  LL+   AE  +++       +D  + +  A    +  V ++ L  GA  N++ ++G T  H +       + EL+      I+ V   G TPLH A +   L IV  LL+ GA  N SN   +TP+ +A                               C++ +   N   ++K+L+  N+N  +      T  H      +++T+  L+   + +              +PLH AAK G + + ++LLE  A P    +N    +H+A    NL++VKLLL     + +    N  + +H AA++ + E+ R L++ G    A+   G   L L+A+ G+ ++V  +L  + N NL ++   T LH  A  GH+ V   L +HG
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLN-RGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQ-YDAEIDDIT-------LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTN---MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGF------TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGG-SPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHG 691          

HSP 2 Score: 164.081 bits (414), Expect = 1.716e-39
Identity = 153/585 (26.15%), Postives = 261/585 (44.62%), Query Frame = 2
Query:  230 YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENGNV---------SDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLI--EVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFL 1900
            ++KMV + + K  +    T    + LH A    Q +VV  L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q  A +  G T L +A ++GH N+V  L++YG    K+   ++  LH  AR +D     +LL       + S  G TP+ IAA   ++ V   LL +                I +  GNV            +  K  D  + +  A +N ++ + +I L +GA I  K  +G +  H +A     +   L+     +I+ +  D  TPLH A +     +   LL+ GA  N+      TP+ +AC       N+  ++++L+   +++    E   T  H      ++  +K L++  +        N+ ++  ++PLH AA+ G  E+ K LL+  A     A++D   +H A + G+ N+VKLLLE N           + L H AA EG  E    L+  E    C+ K   G   L ++AK G + + E +L+   +PN   +   T LH A    +L+++K L   G       +N  +P   A   ++ +V +  L
Sbjct:   57 HVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATE-DGFTPLAVALQQGHENVVAHLINYGTK-GKV---RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKK-----NHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASP------NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPL-HIAAREGHVETVLALLEKEASQACMTKK--GFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLL 622          

HSP 3 Score: 156.377 bits (394), Expect = 3.749e-37
Identity = 137/551 (24.86%), Postives = 248/551 (45.01%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       +   LL     +       + PIH+AAQ + ++ V +L +    +ID + +   T LH+A   GH  + + LL  GA  N    +  + LH   +KN + ++++LL   A +   + +G TP+ +A+  GH+ ++  LL++    + NVS+   E      + +  A +  + EV +  L N A +N K  D +T  H +A  G   + +L+   + + N     G+TPLH A     +  V+ LLE  A      +   TP+ VA            + ++L+  +++     +   T  H  V   N+  +K L+    G       N       +PLH AAK   +E+ + LL+ G      +      +HLA +EG+  +V LLL            N+S L  +H  A+EG   +   LI+ G+   A    G   L +++  GNI +V+++L+++ + N   +   + LH AA  GH +++  L ++GA
Sbjct:  234 FTPQNGITPLHIASRRGNVIMVRLL---LDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDA-EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR--GASPNVSNVKVE------TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKY-----GKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWN-----GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLG---NKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA 758          

HSP 4 Score: 154.836 bits (390), Expect = 1.039e-36
Identity = 138/505 (27.33%), Postives = 239/505 (47.33%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVE-IVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLK--TVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIE--VGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            +D+N      +  +HLA++   V+ +VE+L K+  + ++    KG TALHIA   G   +V  L++YGA+VN       + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    NL V Q+ L  GA +N    +G T  H ++  G   +  L+  R   I T  +D  TPLH A  N  + I   LL+ GA +    +   +PI +A        ++ + +++L+  ++   I D  L   T  H      + +  K L+   +        N + L   +PLH A K   + + ++LL+ GA      E+    +H+A+  G+L +VK LL+    +    ++   + +H AA  G  E+ ++L++    ++  AKDD  +  L  +A+ G+ ++V+ +L+N  NPNL     +T LH AA  GH+E +  L
Sbjct:   36 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKE--IILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQG-----DHLDCVRLLLQYDAE--IDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKP------NSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGA-SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDD--QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLAL 522          

HSP 5 Score: 120.939 bits (302), Expect = 3.569e-26
Identity = 115/472 (24.36%), Postives = 197/472 (41.74%), Query Frame = 2
Query:  287 VNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK----------------IKAENG--NVSDTLNEKDIDGNSC-------ISFAIQNRNLEVLQICLLNGAD---------------------------------INNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRY 1528
            +N F+ LH A  +N   V+  LL     ++ +    + P+H+A+    + IV+ L + R    +  +VK +T LH+A R GH+ + + LL   A VN    D  + LH  AR     M+K+LL   A   + ++ G TP+ IAA EGH++ +  LLEK                + A+ G   V++ L E+D   N+        +  A+ + NL+++++ L  G                                    N + V G T  H +A  G  E+  L+  +  + N  ++ G TPLH       + +   L++ G  V+ + R+  TP+ VA                                   HY     NIK +K+L++  +       +N +     SPLH AA+ G  +I  +LL+ GA P   + +    + +A + G ++V  +L  +  ET +
Sbjct:  369 LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ-RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVAS----------------------------------HY----GNIKLVKFLLQHQAD------VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSF 795          

HSP 6 Score: 114.005 bits (284), Expect = 4.130e-24
Identity = 109/451 (24.17%), Postives = 205/451 (45.45%), Query Frame = 2
Query:  467 LQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
            + I+  +  G   LH+A + GH  MV  LL     +        + LH  A     E+++ L++Y A +  +S  G TP+ +AA E H++V+ FLLE     NG   +   E   DG + ++ A+Q  +  V+   +  G     +L       H +A         ++     + + + + G TPLH A +  +LN+   LL  GA VN + +   TP+ +A         N  ++++L+   + +  + +   T  H      +++  + L+   +       I  +     SP+H AA+   ++  ++LL+  A+      +    +H+A   G+  V K+LL+   +    R +N  + +H A ++    +   L++ G    A  + G   L +++  G++ IV+ +L+   +PN+ + K  T LH AA  GH EV K L ++ A+
Sbjct:   36 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-----NGANQNVATE---DGFTPLAVALQQGHENVVAHLINYGTKGKVRL----PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRR-----GNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAP------IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNS-RALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK 462          

HSP 7 Score: 103.605 bits (257), Expect = 6.175e-21
Identity = 78/281 (27.76%), Postives = 132/281 (46.98%), Query Frame = 2
Query:  197 IFYAVQHGNVE-YLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA 1036
            +  A + G+VE  L ++ K+  + C+    T   F+ LH A    +  V   LL      N  G   + P+H+A   N ++IV++L   R     +    G T LHIA ++    +  +LL YG S N      ++ LH  A++   EM+ +LLS +A   + + +G TP+ + A EGH+ V + L+     ++G + D        G + +  A    N+++++  L + AD+N K   G +  H +A  G  ++  L+       N V  DG TPL  A
Sbjct:  507 LHIAAREGHVETVLALLEKEASQACM----TKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP-RGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-----KHGVMVDATTRM---GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 8 Score: 99.7525 bits (247), Expect = 1.041e-19
Identity = 92/369 (24.93%), Postives = 165/369 (44.72%), Query Frame = 2
Query:  803 KDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV--SANSNLLIRD----------EKLKTVFHYLVE-----RINIKTIKYLIR---TISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN 1840
            ++ D  +    A ++ NL+     L NG DIN    +G    H ++  G  ++   +  +   + T  + GNT LH A       +V +L+  GA+VN  ++   TP+ +A       +N+ E++K L+   AN N+   D          +  + V  +L+      ++ +  +    R   T +  +L Q     D+  K   +PLH AA   ++ + ++LL  GA      +N    +H+A++ GN+ +V+LLL+   +    +  +E + +H AA  G   I   L++ G    AK   G + + ++A+G ++D V  +L+     +       T LH AA  GH  V K L   GA+      N
Sbjct:    8 READAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ-----ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-KTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALN 370          

HSP 9 Score: 79.7221 bits (195), Expect = 1.467e-13
Identity = 50/157 (31.85%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  281 DTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            ++V   + LH A  E   ++VA LL+ + + N+     + P+HL AQ   V + ++L K   + +DA    G T LH+A   G+  +V+ LL + A VN       S LH  A++   +++ +LL   A     SS+G TP+ IA   G+I V + L
Sbjct:  631 ESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. TrEMBL
Match: A0A267FPG6 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025935g2 PE=3 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 8.529e-130
Identity = 299/972 (30.76%), Postives = 517/972 (53.19%), Query Frame = 2
Query:  200 FYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGE-LFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLL-IRDEKLKTVFHYLVERINIKTIKYLIRTIS--GEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRY----FRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAA--SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKW--KKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCV-ISANQTSSGN---LDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIY--FVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFY 3061
            F++V+ GN + + M+ K+      +  D +   S LHYAV  ++  VVA L+    +VN+ G +  RP+H+AA  N +  ++ L   R +++DA D +GQTALH+ACRR H  +V+ LL + A+    E D  SVLH P+R+N+L++ +IL +  A +  +  +G TP+M+AA E   ++L+  +   K  + N+   LN KD +GNS + +A ++    ++Q     GADIN + ++  T  H ++  G  E + +L+E  + D N  D+ G TPLH    +    I   LL+ G+D   ++  F TP   AC       N       L  A+ +++   D +++T  H+ V   +I+ + YL+   +   E    ++N  D   K P+HYA ++G+ E+   LL  GAD  +        + LA K G + +V+ + E + + ++     RD++  + +  AAE+G  E+F +L+E G D + KD+ GR  LMLS   G+ +I   ++   ++ N  D  +NTALH+A          ++ L ++GA+ Q N    +P D A+ N+    ++ F +D +    M YR ENG +H++ LI+++ +    +L++ +TE  ++  D+N  + Y F  LD GPDDP+S+ +RY AL +MV  +++ LL+HP+   L++ KW   ++   F L+   +++  + A       +P  +    ++  TGC   + +  SSG    L +  ++   + +  +   RL I  +K+  +R ++F++   F FI   ++ F+F+    + PC   W      +  ++   ++  +HLP  GI   MF +V  +L KV + F     GF  AF I    Q PF+ I  S LK+  MT+GE D+V YFI++ +   +   +L+++  FV+ MP    NL +G+AVGDID +  EA L+   +R+   +E+ETNL +  QR  +
Sbjct:  145 FHSVREGNTDLVLMLIKNDSSLVSELDDQL--MSGLHYAVKSDRVGVVAALIQAGANVNMKGREGSRPLHVAANFNQIGALKELLSSRKVRVDATDDRGQTALHVACRRNHEEVVQILLGHKANPQLKELDGTSVLHLPSRRNNLQLCQILTNDTALISCRDKHGVTPLMVAASESGEELLSHFVSVCKLSDKNIVQMLNIKDAEGNSAMHYAARSDKPSMIQGLKNCGADINIRNLENSTPLHAASALGHKESVIKLLELGA-DPNQQDKLGRTPLHSCAISKQEEICGILLKAGSDPQAADAEFMTPFHWACRR-----NQLNEAAHLADADLDVIAATDIQMRTGLHWAVLAGSIELVNYLLDKAAELPEGCETVLNASDAQDKYPVHYAVEVGNTELLVALLSRGADFHVVDMEGRTPVQLAVKMGCIELVQNIFEHSEKLKHQALKHRDMSGMTSLLIAAEQGHSELFEYLLEQGADFMVKDEIGRTALMLSVGSGHHEIASVMIDKGVDVNASDSSRNTALHYACKHEDSDASCVELLLKNGAQLQQNYNGETPVDVAVLNNNNPAIQLFFSDAHRTWVMTYRKENGYTHLDVLIQHSPQTAELILNQAMTESGADHMDKNFMVVYNFTDLDPGPDDPASAHRRYLALRTMVKRRRVELLEHPVCQALIESKWAVARYFFWFDLLCYAVFLCCLTAFVADNGPLPLWE----IDTQTGCRNYTTDGVSSGTRQKLTNPTLILEKAIVIGILSIRLVIETVKVAFKRLQYFKNYENFFFIVLYIFTFIFVYPPDSEPCQYNWICGMFSVIMAWCLLIFQFEHLPKIGIYSLMFQQVIVSLVKVLVIFSFCIIGFALAFNIGMVAQTPFKYITYSILKTFDMTVGELDFVTYFISN-SYGGMQTGLLVVFVIFVIIMPIGLMNLLVGIAVGDIDGISKEASLKLIDIRITLFYELETNLPRYFQRRLH 1103          

HSP 2 Score: 62.003 bits (149), Expect = 8.033e-6
Identity = 76/348 (21.84%), Postives = 148/348 (42.53%), Query Frame = 2
Query:  917 KTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLL----------EAGADPKLFA---ENDHLAIHLAT--KEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQ--DNLFNLSPFDEALANSRKDVVKYFLNDD 1909
            K  FH+        +  LI+  S  ++ +D    + LHYAV +  + +V  L++ GA+VN   R    P+ VA     N +    + ++L S    +   D++ +T  H    R + + ++ L+   +         L++L   S LH  ++  ++++C++L           + G  P + A     + L  H  +  K  + N+V++L          +D   +S +H+AA   K  + + L   G D   ++      L  ++  G+ + V  +L+   +PN  D+   T LH  A     E+   L + G+  Q  D  F ++PF  A   ++ +   +  + D
Sbjct:  142 KLFFHSVREGNTDLVLMLIKNDSSLVSELDDQLMSGLHYAVKSDRVGVVAALIQAGANVNMKGREGSRPLHVAA----NFNQIGALKELLSSRKVRVDATDDRGQTALHVACRRNHEEVVQILLGHKANP------QLKELDGTSVLHLPSRRNNLQLCQILTNDTALISCRDKHGVTPLMVAASESGEELLSHFVSVCKLSDKNIVQML--------NIKDAEGNSAMHYAARSDKPSMIQGLKNCGADINIRNLENSTPLHAASALGHKESVIKLLELGADPNQQDKLGRTPLHSCAISKQEEICGILLKAGSDPQAADAEF-MTPFHWACRRNQLNEAAHLADAD 470          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. TrEMBL
Match: A0A267E899 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025935g1 PE=3 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 8.797e-130
Identity = 299/972 (30.76%), Postives = 517/972 (53.19%), Query Frame = 2
Query:  200 FYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGE-LFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLL-IRDEKLKTVFHYLVERINIKTIKYLIRTIS--GEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRY----FRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAA--SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKW--KKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCV-ISANQTSSGN---LDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIY--FVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFY 3061
            F++V+ GN + + M+ K+      +  D +   S LHYAV  ++  VVA L+    +VN+ G +  RP+H+AA  N +  ++ L   R +++DA D +GQTALH+ACRR H  +V+ LL + A+    E D  SVLH P+R+N+L++ +IL +  A +  +  +G TP+M+AA E   ++L+  +   K  + N+   LN KD +GNS + +A ++    ++Q     GADIN + ++  T  H ++  G  E + +L+E  + D N  D+ G TPLH    +    I   LL+ G+D   ++  F TP   AC       N       L  A+ +++   D +++T  H+ V   +I+ + YL+   +   E    ++N  D   K P+HYA ++G+ E+   LL  GAD  +        + LA K G + +V+ + E + + ++     RD++  + +  AAE+G  E+F +L+E G D + KD+ GR  LMLS   G+ +I   ++   ++ N  D  +NTALH+A          ++ L ++GA+ Q N    +P D A+ N+    ++ F +D +    M YR ENG +H++ LI+++ +    +L++ +TE  ++  D+N  + Y F  LD GPDDP+S+ +RY AL +MV  +++ LL+HP+   L++ KW   ++   F L+   +++  + A       +P  +    ++  TGC   + +  SSG    L +  ++   + +  +   RL I  +K+  +R ++F++   F FI   ++ F+F+    + PC   W      +  ++   ++  +HLP  GI   MF +V  +L KV + F     GF  AF I    Q PF+ I  S LK+  MT+GE D+V YFI++ +   +   +L+++  FV+ MP    NL +G+AVGDID +  EA L+   +R+   +E+ETNL +  QR  +
Sbjct:  145 FHSVREGNTDLVLMLIKNDSSLVSELDDQL--MSGLHYAVKSDRVGVVAALIQAGANVNMKGREGSRPLHVAANFNQIGALKELLSSRKVRVDATDDRGQTALHVACRRNHEEVVQILLGHKANPQLKELDGTSVLHLPSRRNNLQLCQILTNDTALISCRDKHGVTPLMVAASESGEELLSHFVSVCKLSDKNIVQMLNIKDAEGNSAMHYAARSDKPSMIQGLKNCGADINIRNLENSTPLHAASALGHKESVMKLLELGA-DPNQQDKLGRTPLHSCAISKQEEICGILLKAGSDPQAADAEFMTPFHWACRR-----NQLNEAAHLADADLDVIAATDIQMRTGLHWAVLAGSIELVNYLLDKAAELPEGCETVLNASDAQDKYPVHYAVEVGNTELLVALLSRGADFHVVDMEGRTPVQLAVKMGCIELVQKIFEHSEKLKHQALKHRDMSGMTSLLIAAEQGHSELFDYLLEQGADFMVKDEIGRTALMLSVGSGHHEIASVMIDKGVDVNASDSSRNTALHYACKHEDSDASCVELLLKNGAQLQQNYNGETPVDVAVLNNNNPAIQLFFSDAHRNWVMTYRKENGYTHLDVLIQHSPQTAELILNQAMTESGADHMDKNFMVVYNFTDLDPGPDDPASAHRRYLALRTMVKRRRVELLEHPVCQALIESKWAVARYFFWFDLLCYAVFLCCLTAFVADNGPLPLWE----IDTQTGCRNYTTDGVSSGTRQKLTNPTLILEKAIVIGILSIRLVIETVKVAFKRLQYFKNYENFFFIVLYIFTFIFVYPPDSEPCQYNWICGMFSVIMAWCLLIFQFEHLPKIGIYSLMFQQVIVSLVKVLVIFSFCIIGFALAFNIGMVAQTPFKYITYSILKTFDMTVGELDFVTYFISN-SYGGMQTGLLVVFVIFVIIMPIGLMNLLVGIAVGDIDGISKEASLKLIDIRITLFYELETNLPRYFQRRLH 1103          

HSP 2 Score: 63.1586 bits (152), Expect = 4.289e-6
Identity = 80/374 (21.39%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  839 IQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLL----------EAGADPKLFA---ENDHLAIHLAT--KEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQ--DNLFNLSPFDEALANSRKDVVKYFLNDD 1909
            +  + L  +Q+  L+ A+        K  FH+        +  LI+  S  ++ +D    + LHYAV +  + +V  L++ GA+VN   R    P+ VA     N +    + ++L S    +   D++ +T  H    R + + ++ L+   +         L++L   S LH  ++  ++++C++L           + G  P + A     + L  H  +  K  + N+V++L          +D   +S +H+AA   K  + + L   G D   ++      L  ++  G+ + V  +L+   +PN  D+   T LH  A     E+   L + G+  Q  D  F ++PF  A   ++ +   +  + D
Sbjct:  122 MMGKGLSSMQLRTLSSAE------QRKLFFHSVREGNTDLVLMLIKNDSSLVSELDDQLMSGLHYAVKSDRVGVVAALIQAGANVNMKGREGSRPLHVAA----NFNQIGALKELLSSRKVRVDATDDRGQTALHVACRRNHEEVVQILLGHKANP------QLKELDGTSVLHLPSRRNNLQLCQILTNDTALISCRDKHGVTPLMVAASESGEELLSHFVSVCKLSDKNIVQML--------NIKDAEGNSAMHYAARSDKPSMIQGLKNCGADINIRNLENSTPLHAASALGHKESVMKLLELGADPNQQDKLGRTPLHSCAISKQEEICGILLKAGSDPQAADAEF-MTPFHWACRRNQLNEAAHLADAD 470          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. TrEMBL
Match: A0A267G9R9 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000210g4 PE=3 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 1.948e-128
Identity = 308/1022 (30.14%), Postives = 517/1022 (50.59%), Query Frame = 2
Query:   56 NNKISPPPNYANHSNVTIAIKSSLQFPS--EVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNN------FSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKI-KAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVK----LLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAA--SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGN----LDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPT-KYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFY 3061
            +N++ P  +  + S V   ++   Q  +  E ++ +  +     +   + F++V+ GN + + ++        LKC  ++ +       S LHYAV  N+ D+V+ L+    +VNI G +  RPIH+AA  N  + +  + K R  ++DA D +GQTALH+ACRR H   V+ LLS+ A+    E D  SVLH P+R+N+LE+ ++L +    +  K   G TP+M+AA EG   +LN+ +    K  +G     L+ +D +GNS + FA +N     ++I   +G +++ + ++     H +A  G  E    +       N  D++G TPLH  +    L I   LL  GA    ++  F TP+  AC   L         ++L      L + D  ++T  H+ V    +  ++ L+         +  N  D + K P+HYA ++ D ++ ++LL  GAD          A  LA K G+  +V+    L   I  +    RD+   + +  AAE G   +  FL+E G D  AKD++GR  LMLS  GG+ DIV  ++   ++ N  D  +NTALH+A   +G     ++ L  +GA+ Q N    +P D A+ N+    +    +D      M YR + G SH++ LI+++ +  + +L++ +T+  ++  ++N  + + F  LD GPDDP+S   RY  L +MV  ++ +LLKHPL   LL+ KW  F   F   D   Y +++  ++ ++    P+     V+  TGC  +++   SG      +   +L+  S +      RL + FIKL+ +R ++ ++     F+   +  F+FI    + PC++ W F    +  ++   ++  +HLP  GI   MF +V  +L KV L F     GFG AF I    Q PF+  + S LK+  MT+GE ++V YFI+  + +  LA  ++ + FV+ MP    NL +G+AVGDI+ +  EA L   ++R+  V+E+ETNL +  QR  Y
Sbjct:   11 DNRVGPTADKMSPSVVESQLQELQQRSAGQETLTLEQCRSLKPDDMARRFFHSVREGNSDQVSLL--------LKCNSSLVSKLDEQLMSGLHYAVKCNRVDMVSLLMQAGANVNIKGREGSRPIHVAANFNQSDALREILKSRRTRVDATDDRGQTALHVACRRNHEPSVKILLSHKANSQLKELDGTSVLHLPSRRNNLELCQMLTTDTGLITCKDKYGVTPLMVAAAEGSEDLLNYFISVCKKTTHGAAGRILDMQDSEGNSSVHFAAKNDKFLAIEILSEHGVNLDLQNLEQSAPIHLAATLGHRESVAKLIHLGALPNLSDKNGRTPLHCCIIARQLEICDTLLLAGAQSRAADEDFMTPLHWACRRGLTQAAR----RLLRVDPGCLSLVDIHMRTGLHWAVLACAVDLVELLLAQAGDSD--ESANASDFHDKYPVHYAVEMNDSQLVRILLTHGADFHAVDTEGRTATQLAVKLGHEGLVRDICGLGQYIKRQALRHRDLRGVTSLLIAAEHGHTRVLHFLLEQGADFTAKDEFGRTALMLSCGGGHSDIVATMIDKGVDVNASDANRNTALHYACKHAGSSARSLELLLSNGAQLQQNYNGETPVDVAVLNNNGPAISLLFSDAYCDWVMSYRKDTGMSHMDILIQHSPQTALTILNRSMTKSRADNFEKNFMVTHNFFYLDPGPDDPASKPNRYLGLRTMVERQREDLLKHPLCAALLEYKW-SFTRYFFWCDFFFYAVFLCCLTAFVADQGPLP-ISLVDANTGCRNTSSSGGSGQRQKLTNGRLILE-KSVVIGFLCVRLVLEFIKLVFKRLQYLKNYENLFFVTLYILTFVFIYPPDSEPCIDNWIFGIFSVILAWCLLIFQFEHLPVTGIYSLMFQKVIISLVKVLLIFAFFIIGFGLAFNIGLVSQTPFKYPMYSILKTFDMTVGEMEFVTYFISGTSGRMQLALLVVFVIFVVVMPIGLMNLLVGIAVGDIEGISKEAGLRLVEIRINLVYEMETNLPRYFQRRLY 1015          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. TrEMBL
Match: A0A267H4S2 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000210g3 PE=3 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.588e-128
Identity = 310/1022 (30.33%), Postives = 514/1022 (50.29%), Query Frame = 2
Query:   56 NNKISPPPNYANHSNVTIAIKSSLQFPS--EVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNN------FSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKI-KAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVK----LLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAA--SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGN----LDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPT-KYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFY 3061
            +N++ P  +  + S V   ++   Q  +  E ++ +  +     +   + F++V+ GN         D     LKC  ++ +       S LHYAV  N+ D+V+ L+    +VNI G +  RPIH+AA  N  + +  L   R  ++DA D +GQTALH+ACRR H   V+ LLS+ A+    E D  SVLH P+R+N+LE+ ++L +    +  K   G TP+M+AA EG   +LN+ +    K  +G     L+ +D +GNS + FA +N     ++I   +GA+++ + ++     H +A  G  E    +       N  D++G TPLH  +    L I   LL  GA    ++  F TP+  AC   L         ++L      L + D  ++T  H+ V    +  ++ L+         +  N  D + K P+HYA ++ D ++ ++LL  GAD          A  LA K G+  +V+    L   I  +    RD+   + +  AAE G   +  FL+E G D  AKD++GR  LMLS  GG+ DIV  ++   ++ N  D  +NTALH+A   +G     ++ L  +GA+ Q N    +P D A+ N+    +    +D      M YR + G SH++ LI+++ +  + +L++ +T+  ++  ++N  + + F  LD GPDDP+S   RY  L +MV  ++ +LLKHPL   LL+ KW  F   F   D   Y +++  ++ ++    P+     V+  TGC  +++   SG      +   +L+  S +      RL + FIKL+ +R ++ ++     F+   +  F+FI    + PC++ W F    +  ++   ++  +HLP  GI   MF +V  +L KV L F     GFG AF I    Q PF+  + S LK+  MT+GE ++V YFI+  + +  LA  ++ + FV+ MP    NL +G+AVGDI+ +  EA L   ++R+  V+E+ETNL +  QR  Y
Sbjct:   11 DNRVGPTADKMSPSVVESQLQELQQRSAGQEALTLEQCRSLKPDDMARRFFHSVREGN--------SDQVSRLLKCNSSLVSKLDEQLMSGLHYAVKCNRVDMVSLLMQAGANVNIKGREGSRPIHVAANFNQSDALRELLNSRRTRVDATDDRGQTALHVACRRNHEPSVKILLSHKANSQLKELDGTSVLHLPSRRNNLELCQMLTTDTGLITCKDKYGVTPLMVAAAEGSEDLLNYFISVCKKTTHGAAGRILDMQDSEGNSSVHFAAKNDKFLAIEILSEHGANLDLQNLEQSAPIHLAATLGHRESVAKLIHLGALPNLSDKNGRTPLHCCIIARQLEICDTLLLAGAQSRAADEDFMTPLHWACRRGLTQAAR----RLLRVDPGCLSLVDIHMRTGLHWAVLACAVDLVELLLAQAGDSD--ESANASDFHDKYPVHYAVEMNDSQLVRILLTHGADFHAVDTEGRTATQLAVKLGHEGLVRDICGLGQYIKRQALRHRDLRGVTSLLIAAEHGHTRVLHFLLEQGADFTAKDEFGRTALMLSCGGGHSDIVATMIDKGVDVNASDVNRNTALHYACKHAGSSARSLELLLSNGAQLQQNYNGETPVDVAVLNNNGPAISLLFSDAYCDWVMSYRKDTGMSHMDILIQHSPQTALTILNRSMTKSGADNLEKNFMVTHNFFYLDPGPDDPASKPNRYLGLRTMVERQREDLLKHPLCAALLEYKW-SFTRYFFWCDFFFYAVFLCCLTAFVADQGPLP-ISLVDANTGCRNTSSSGGSGQRQKLTNGRLILE-KSVVIGFLCVRLVLEFIKLVFKRLQYLKNYENLFFVTLYILTFVFIYPPDSEPCIDNWIFGIFSVILAWCLLIFQFEHLPVTGIYSLMFQKVIISLVKVLLIFAFFIIGFGLAFNIGLVSQTPFKYPMYSILKTFDMTVGEMEFVTYFISGTSGRMQLALLVVFVIFVVVMPIGLMNLLVGIAVGDIEGISKEAGLRLVEIRINLVYEMETNLPRYFQRRLY 1015          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. TrEMBL
Match: A0A267EGL5 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000210g1 PE=3 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.897e-128
Identity = 308/1022 (30.14%), Postives = 516/1022 (50.49%), Query Frame = 2
Query:   56 NNKISPPPNYANHSNVTIAIKSSLQFPS--EVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNN------FSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKI-KAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVK----LLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAA--SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGN----LDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPT-KYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFY 3061
            +N++ P  +  + S V   ++   Q  +  E ++ +  +     +   + F++V+ GN + + ++        LKC  ++ +       S LHYAV  N+ D+V+ L+    +VNI G +  RPIH+AA  N  + +  L   R  ++DA D +GQTALH+ACRR H   V+ LLS+ A+    E D  SVLH P+R+N+LE+ ++L +    +  K   G TP+M+AA EG   +LN+ +    K  +G     L+ +D +GNS + FA +N     ++I   +G +++ + ++     H +A  G  E    +       N  D++G TPLH  +    L I   LL  GA    ++  F TP+  AC   L         ++L      L + D  ++T  H+ V    +  ++ L+         +  N  D + K P+HYA ++ D ++ ++LL  GAD          A  LA K G+  +V+    L   I  +    RD+   + +  AAE G   +  FL+E G D  AKD++GR  LMLS  GG+ DIV  ++   ++ N  D  +NTALH+A   +G     ++ L  +GA+ Q N    +P D A+ N+    +    +D      M YR + G SH++ LI+++ +  + +L++ +T+  ++  ++N  + + F  LD GPDDP+S   RY  L +MV  ++ +LLKHPL   LL+ KW  F   F   D   Y +++  ++ ++    P+     V+  TGC  +++   SG      +   +L+  S +      RL + FIKL+ +R ++ ++     F+   +  F+FI    + PC++ W F    +  ++   ++  +HLP  GI   MF +V  +L KV L F     GFG AF I    Q PF+  + S LK+  MT+GE ++V YFI+  + +  LA  ++ + FV+ MP    NL +G+AVGDI+ +  EA L   ++R+  V+E+ETNL +  QR  Y
Sbjct:   11 DNRVGPTADKMSPSVVESQLQELQQRSAGQEALTLEQCRSLKPDDMARRFFHSVREGNSDQVSLL--------LKCNSSLVSKLDEQLMSGLHYAVKCNRVDMVSLLMQAGANVNIKGREGSRPIHVAANFNQSDALRELLNSRRTRVDATDDRGQTALHVACRRNHEPSVKILLSHKANSQLKELDGTSVLHLPSRRNNLELCQMLTTDTGLITCKDKYGVTPLMVAAAEGSEDLLNYFISVCKKTTHGAAGRILDMQDSEGNSSVHFAAKNDKFLAIEILSEHGVNLDLQNLEQSAPIHLAATLGHRESVAKLIHLGALPNLSDKNGRTPLHCCIIARQLEICDTLLLAGAQSRAADEDFMTPLHWACRRGLTQAAR----RLLRVDPGCLSLVDIHMRTGLHWAVLACAVDLVELLLAQAGDSD--ESANASDFHDKYPVHYAVEMNDSQLVRILLTHGADFHAVDTEGRTATQLAVKLGHEGLVRDICGLGQYIKRQALRHRDLRGVTSLLIAAEHGHTRVLHFLLEQGADFTAKDEFGRTALMLSCGGGHSDIVATMIDKGVDVNASDANRNTALHYACKHAGSSARSLELLLSNGAQLQQNYNGETPVDVAVLNNNGPAISLLFSDAYCDWVMSYRKDTGMSHMDILIQHSPQTALTILNRSMTKSGADNFEKNFMVTHNFFYLDPGPDDPASKPNRYLGLRTMVERQREDLLKHPLCAALLEYKW-SFTRYFFWCDFFFYAVFLCCLTAFVADQGPLP-ISLVDANTGCRNTSSSGGSGQRQKLTNGRLILE-KSVVIGFLCVRLVLEFIKLVFKRLQYLKNYENLFFVTLYILTFVFIYPPDSEPCIDNWIFGIFSVILAWCLLIFQFEHLPVTGIYSLMFQKVIISLVKVLLIFAFFIIGFGLAFNIGLVSQTPFKYPMYSILKTFDMTVGEMEFVTYFISGTSGRMQLALLVVFVIFVVVMPIGLMNLLVGIAVGDIEGISKEAGLRLVEIRINLVYEMETNLPRYFQRRLY 1015          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 228.794 bits (582), Expect = 2.700e-61
Identity = 246/975 (25.23%), Postives = 435/975 (44.62%), Query Frame = 2
Query:  197 IFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESD-KISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EPRSWD-INTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYL-IRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVL--LEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH--IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLL--------DAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQ---YCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPIL----IIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            + YA   G++  +K++ +   +  L  +D   N + LH+AV ++Q+   + LL+   D NI+    + P+HLA                                ++ R  H+ +VE L+S+  +   LE D   + +   A  ++ E + IL    A L  ++  G  P+  AA  G  K +  +L+K +    ++   +N  D   +S +  A++  NL+V+Q+C+ +GA IN +  D  T  H +   G  E  +L+     R  D IN  D    TPLH A       +   L+  GAD++  +    +P+++A S        +  + +L+S  + L +RD+      H  +  +  + +K L    +  E + +L+N +D    +PLHYA +LG  +  K +  LE   D K  ++    A+H A + G +N    LLE   +TR   + +E  +  +H A+  G  ++   L+  G   L   DY G + L  +A  G    +E +L + I   +  D   NTALH AA  GH+  ++ L   GA+F  N  + S   EA+ N RK+V    ++ D  ++ +     N      +  +I++  E    LLD CI E   + +     I+Y F  L        +    +     +   AL +MV F ++ LL HP+  + L+ KWK +G+   L++    I+Y + +    + I  ++   TVN+          T+S +    F+      + ++  + +G   +++  +R ++ +D      +S   C+L     I  L N+     W    +    S+   L ++Q     GI V MF  + +TL  + + F  L   F  AFY +  +Q  F  +  S +++ VM +GE  Y + F+       L  P++     ++FVL +P    NL IGLAVGDI  + + A L+   +++E    +E  L
Sbjct:   49 LHYAACKGHLRAIKLIVQIAGQQELNVVDEEGN-TPLHWAVQKDQRGSCSALLSLGADPNILNKSLLSPLHLA--------------------------------VSLR--HNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPLHLAVRGGNLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLMLLAYDRVCDIINITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLLLATSC-----GAWRTVNLLLSHGAELKVRDKAGCNFLHLAI--LQPRGLKNLPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQK--SKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLRKG--ALFHSDYKGWSCLHHAAAEGFTQTMETLLISNIKLLDKIDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLNKGDASFLHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKRCIVLDMIEFLPESYKHLLDTCIKESDDDVNSCTYNIEYNFQWLQHTNHRIQNTDNIEEDDDYKPLAALNAMVEFNRVELLTHPVCKKFLEMKWKAYGMKAHLLN---MIVYTLGVLPLTYLIVNLRPKLTVNKNV--TTVTMVTTSIDKQCYFITSCMFLVLAMNTYAVGKEIVQMFQQRLKYLRDMSNLMDWSSTICSL--LFVIPLLLNVESSWHWQAGALAGLISWINLLLYLQRFERFGIYVVMFREICRTLLSIIVLFIYLILAFALAFYALMVEQRHFGRMFLSLMQTFVMMVGEISYQDNFLKPYMSSQLPFPLMTYGIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKQIGMQIELHSNLEERL 970          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 227.254 bits (578), Expect = 6.908e-61
Identity = 263/997 (26.38%), Postives = 452/997 (45.34%), Query Frame = 2
Query:  119 SSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLA---AQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI----EPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTI-SGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKINPNLFD---QKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISAN-QTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCL----NEWTF---APMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRV 3004
            SSL+F S+  + +  K  DE      I +A    N+  ++++   V    L   D  +  + LH+AV +NQ+   + LL    D NI+      P+HLA      NLV+++ +LC +  + ++  D+ G T   +AC    SN                             N+ + ++IL  Y A L  ++  G   +   A  G  + +  +L+K +      S  +N  D   +S +  A++  N EV+++C+  GA ++ +  D  T  H +   G  E  +++    E     IN  D    TPLH A     + +   L+  GAD++  +    +P+++A      T + ++ +  L+   ++  ++D+  +   H ++     K +K L   +   + + +L++ +D    +PLHYA KLG  +  K +L         ++     +H A + G LN    LLE   ++R   +  E+ L  +H A+  G  ++   L+  G   L + DY G + L  +A  G    +  +L    N  L D   ++ NTALH AA  GH+  +K L   GA F  N    S   EA+ N +K+V    + ++   + +  ++   G +  +  LI++  E T  LLD C+ E   + ++ N  I Y F  L A          D S + Q   AL +MV + +L LL HP+  + L+ KWK +G    L++L +Y+L ++ +++ I  + P +NT +VN TT  + S + +T S  +    V+ L   +Y++         ++L  +R  +F D    S    A+   +F+     IP      N+W +   A  +LF   ++ LYF Q     GI V MF  + KTL    + F  L   FG +FY +   +  F  I  S  ++ VMT+GE +Y N  + +  +  LA P     + + FVL MP    NL IGLAVGDI  +   A L+   +++
Sbjct:   33 SSLEFLSQK-NPELLKSRDECG-AGPIHHAAASANLAVIRLIVTVVGPEELNTQDD-HGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLL-LLCDRTDVDLEG-DL-GNTPAMVAC----SN-----------------------------NNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLA-----TTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLVI--FQPKGLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRG--ALFQSDYKGWSCLHHAAAEGYTQTMVILLA--ANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNT-SVNGTTVTMASVSFRTQSYMISVCIVMVLVMNVYAICKE-----LVQLAQQRLIYFMDSTNVSDWASAISSLVFV-----IPLFFSVDNKWHWEAGALAILFAWINFLLYF-QRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQNTLLEAYEQGQLAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQI 967          

HSP 2 Score: 67.0106 bits (162), Expect = 8.804e-11
Identity = 60/234 (25.64%), Postives = 103/234 (44.02%), Query Frame = 2
Query: 1160 NNYEIIKILVSANSNLL-IRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL-----EINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILK--------NKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
             N   ++ L   N  LL  RDE      H+     N+  I+ ++  +  E L    N QD + ++PLH+A +      C +LLE GADP + + +    +HLA    + N+V+LLL     ++++E     D+  +  +  A      +  + L +       ++  G   +   A  G  + +E IL+           + N  D+ K++ LH A  GG+ EVIK     GA+
Sbjct:   30 GNISSLEFLSQKNPELLKSRDECGAGPIHHAAASANLAVIRLIVTVVGPEEL----NTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEG----DLGNTPAM-VACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAK 254          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 227.254 bits (578), Expect = 8.574e-61
Identity = 263/997 (26.38%), Postives = 452/997 (45.34%), Query Frame = 2
Query:  119 SSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLA---AQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI----EPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTI-SGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKINPNLFD---QKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISAN-QTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCL----NEWTF---APMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRV 3004
            SSL+F S+  + +  K  DE      I +A    N+  ++++   V    L   D  +  + LH+AV +NQ+   + LL    D NI+      P+HLA      NLV+++ +LC +  + ++  D+ G T   +AC    SN                             N+ + ++IL  Y A L  ++  G   +   A  G  + +  +L+K +      S  +N  D   +S +  A++  N EV+++C+  GA ++ +  D  T  H +   G  E  +++    E     IN  D    TPLH A     + +   L+  GAD++  +    +P+++A      T + ++ +  L+   ++  ++D+  +   H ++     K +K L   +   + + +L++ +D    +PLHYA KLG  +  K +L         ++     +H A + G LN    LLE   ++R   +  E+ L  +H A+  G  ++   L+  G   L + DY G + L  +A  G    +  +L    N  L D   ++ NTALH AA  GH+  +K L   GA F  N    S   EA+ N +K+V    + ++   + +  ++   G +  +  LI++  E T  LLD C+ E   + ++ N  I Y F  L A          D S + Q   AL +MV + +L LL HP+  + L+ KWK +G    L++L +Y+L ++ +++ I  + P +NT +VN TT  + S + +T S  +    V+ L   +Y++         ++L  +R  +F D    S    A+   +F+     IP      N+W +   A  +LF   ++ LYF Q     GI V MF  + KTL    + F  L   FG +FY +   +  F  I  S  ++ VMT+GE +Y N  + +  +  LA P     + + FVL MP    NL IGLAVGDI  +   A L+   +++
Sbjct:   33 SSLEFLSQK-NPELLKSRDECG-AGPIHHAAASANLAVIRLIVTVVGPEELNTQDD-HGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLL-LLCDRTDVDLEG-DL-GNTPAMVAC----SN-----------------------------NNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLA-----TTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLVI--FQPKGLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRG--ALFQSDYKGWSCLHHAAAEGYTQTMVILLA--ANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNT-SVNGTTVTMASVSFRTQSYMISVCIVMVLVMNVYAICKE-----LVQLAQQRLIYFMDSTNVSDWASAISSLVFV-----IPLFFSVDNKWHWEAGALAILFAWINFLLYF-QRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQNTLLEAYEQGQLAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQI 967          

HSP 2 Score: 67.3958 bits (163), Expect = 8.049e-11
Identity = 60/234 (25.64%), Postives = 103/234 (44.02%), Query Frame = 2
Query: 1160 NNYEIIKILVSANSNLL-IRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL-----EINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILK--------NKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
             N   ++ L   N  LL  RDE      H+     N+  I+ ++  +  E L    N QD + ++PLH+A +      C +LLE GADP + + +    +HLA    + N+V+LLL     ++++E     D+  +  +  A      +  + L +       ++  G   +   A  G  + +E IL+           + N  D+ K++ LH A  GG+ EVIK     GA+
Sbjct:   30 GNISSLEFLSQKNPELLKSRDECGAGPIHHAAASANLAVIRLIVTVVGPEEL----NTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEG----DLGNTPAM-VACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAK 254          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 227.254 bits (578), Expect = 8.574e-61
Identity = 263/997 (26.38%), Postives = 452/997 (45.34%), Query Frame = 2
Query:  119 SSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLA---AQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI----EPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTI-SGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKINPNLFD---QKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISAN-QTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCL----NEWTF---APMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAP----ILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRV 3004
            SSL+F S+  + +  K  DE      I +A    N+  ++++   V    L   D  +  + LH+AV +NQ+   + LL    D NI+      P+HLA      NLV+++ +LC +  + ++  D+ G T   +AC    SN                             N+ + ++IL  Y A L  ++  G   +   A  G  + +  +L+K +      S  +N  D   +S +  A++  N EV+++C+  GA ++ +  D  T  H +   G  E  +++    E     IN  D    TPLH A     + +   L+  GAD++  +    +P+++A      T + ++ +  L+   ++  ++D+  +   H ++     K +K L   +   + + +L++ +D    +PLHYA KLG  +  K +L         ++     +H A + G LN    LLE   ++R   +  E+ L  +H A+  G  ++   L+  G   L + DY G + L  +A  G    +  +L    N  L D   ++ NTALH AA  GH+  +K L   GA F  N    S   EA+ N +K+V    + ++   + +  ++   G +  +  LI++  E T  LLD C+ E   + ++ N  I Y F  L A          D S + Q   AL +MV + +L LL HP+  + L+ KWK +G    L++L +Y+L ++ +++ I  + P +NT +VN TT  + S + +T S  +    V+ L   +Y++         ++L  +R  +F D    S    A+   +F+     IP      N+W +   A  +LF   ++ LYF Q     GI V MF  + KTL    + F  L   FG +FY +   +  F  I  S  ++ VMT+GE +Y N  + +  +  LA P     + + FVL MP    NL IGLAVGDI  +   A L+   +++
Sbjct:   33 SSLEFLSQK-NPELLKSRDECG-AGPIHHAAASANLAVIRLIVTVVGPEELNTQDD-HGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLL-LLCDRTDVDLEG-DL-GNTPAMVAC----SN-----------------------------NNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLA-----TTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLVI--FQPKGLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRG--ALFQSDYKGWSCLHHAAAEGYTQTMVILLA--ANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNT-SVNGTTVTMASVSFRTQSYMISVCIVMVLVMNVYAICKE-----LVQLAQQRLIYFMDSTNVSDWASAISSLVFV-----IPLFFSVDNKWHWEAGALAILFAWINFLLYF-QRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQNTLLEAYEQGQLAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQI 967          

HSP 2 Score: 67.3958 bits (163), Expect = 8.049e-11
Identity = 60/234 (25.64%), Postives = 103/234 (44.02%), Query Frame = 2
Query: 1160 NNYEIIKILVSANSNLL-IRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL-----EINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILK--------NKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
             N   ++ L   N  LL  RDE      H+     N+  I+ ++  +  E L    N QD + ++PLH+A +      C +LLE GADP + + +    +HLA    + N+V+LLL     ++++E     D+  +  +  A      +  + L +       ++  G   +   A  G  + +E IL+           + N  D+ K++ LH A  GG+ EVIK     GA+
Sbjct:   30 GNISSLEFLSQKNPELLKSRDECGAGPIHHAAASANLAVIRLIVTVVGPEEL----NTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEG----DLGNTPAM-VACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAK 254          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 191.815 bits (486), Expect = 1.797e-49
Identity = 180/697 (25.82%), Postives = 313/697 (44.91%), Query Frame = 2
Query:  197 IFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESD-KISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELI---EPRSWD-INTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYL-IRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVL--LEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH--IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLL--------DAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGL 2221
            + YA   G++  +K++ +   +  L  +D   N + LH+AV ++Q+   + LL+   D NI+    + P+HLA                                ++ R  H+ +VE L+S+  +   LE D   + +   A  ++ E + IL    A L  ++  G  P+  AA  G  K +  +L+K +    ++   +N  D   +S +  A++  NL+V+Q+C+ +GA IN +  D  T  H +   G  E  +L+     R  D IN  D    TPLH A       +   L+  GAD++  +    +P+++A S        +  + +L+S  + L +RD+      H  +  +  + +K L    +  E + +L+N +D    +PLHYA +LG  +  K +  LE   D K  ++    A+H A + G +N    LLE   +TR   + +E  +  +H A+  G  ++   L+  G   L   DY G + L  +A  G    +E +L + I   +  D   NTALH AA  GH+  ++ L   GA+F  N  + S   EA+ N RK+V    ++ D  ++ +     N      +  +I++  E    LLD CI E   + +     I+Y F  L        +    +     +   AL +MV F ++ LL HP+  + L+ KWK +G+
Sbjct:   49 LHYAACKGHLRAIKLIVQIAGQQELNVVDEEGN-TPLHWAVQKDQRGSCSALLSLGADPNILNKSLLSPLHLA--------------------------------VSLR--HNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPLHLAVRGGNLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLMLLAYDRVCDIINITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLLLATSC-----GAWRTVNLLLSHGAELKVRDKAGCNFLHLAI--LQPRGLKNLPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQK--SKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLRKG--ALFHSDYKGWSCLHHAAAEGFTQTMETLLISNIKLLDKIDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLNKGDASFLHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKRCIVLDMIEFLPESYKHLLDTCIKESDDDVNSCTYNIEYNFQWLQHTNHRIQNTDNIEEDDDYKPLAALNAMVEFNRVELLTHPVCKKFLEMKWKAYGM 699          

HSP 2 Score: 56.225 bits (134), Expect = 1.977e-7
Identity = 53/184 (28.80%), Postives = 85/184 (46.20%), Query Frame = 2
Query: 2495 FSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILI----IYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            +S   C+L     I  L N+     W    +    S+   L ++Q     GI V MF  + +TL  + + F  L   F  AFY +  +Q  F  +  S +++ VM +GE  Y + F+       L  P++     ++FVL +P    NL IGLAVGDI  + + A L+   +++E    +E  L
Sbjct:  759 WSSTICSL--LFVIPLLLNVESSWHWQAGALAGLISWINLLLYLQRFERFGIYVVMFREICRTLLSIIVLFIYLILAFALAFYALMVEQRHFGRMFLSLMQTFVMMVGEISYQDNFLKPYMSSQLPFPLMTYGIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKQIGMQIELHSNLEERL 940          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 3.576e-43
Identity = 142/553 (25.68%), Postives = 251/553 (45.39%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL----EINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GN   +K++     K   K  D     + LH A     + V+  LL     +       + P+H+A Q   +  V++L   R   +D V +   T LH+A   GH  + + LL  G   N    +  + LH   +KN ++++++LL + A +   + +G TP+ +A+  GH+ V+  LL+     NG  S   N  ++ G + +  A +   LEV++  L +GA +  K  + +T  H ++  G  E+ +L+  R  D N     G+TPL++A      ++   LLE GAD++   +   TP+ +A           E+  +L+   ++   + +   T  H      + K    L+   +          ++ Y  +PLH AAK   +E+ KVLLE GA+  +  +     +HLA +EG+ ++V LLL     I++ T+        + +H AA+E K  +   L +   D           L +++  GNI +V ++L+N+   N   +   T LH AA  GH  V+  L +H A
Sbjct:  240 FTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD---GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLG-RQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-----NGASS---NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKY-----GRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPH----STAKNGY--TPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK-----GGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEA 764          

HSP 2 Score: 161.77 bits (408), Expect = 7.407e-41
Identity = 145/582 (24.91%), Postives = 249/582 (42.78%), Query Frame = 2
Query:  251 DVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEIL------FQLINLQDLYFK----------------------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLNDD 1909
            DV    +    T + F+ LH A +    +V   LL     V+      + P+H+AA+R    +V++L   R  +ID     G T LH A R GH  ++E LL   A +     + +S LH   +   L  +++LL  +AP+   + +  TP+ +AA  GH +V   LL++            N + ++G + +  A +   ++V+++ L +GA I+     G T  H ++  G   + +L+       N  +  G TPLH A     L +V  LL+ GA V    R  QTP+ +A S L       EI+++L+   S+         T   Y   R     +  L+     +I       F  +++   Y +                      +PLH A      ++  +LL+ GA P   A+N +  +H+A K+  L V K+LLE+  ET        + L H AA+EG  ++   L+            G   + L+A+   +++ E + K+K + N   +   T LH A+  G+++++  L R+ A       N  +P  +A       VV   L  +
Sbjct:  198 DVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLD-RGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR--------GGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIA-SRL----GKAEIVQLLLQRGSDPNAPTASGSTPL-YFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPL-HLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE 763          

HSP 3 Score: 161.384 bits (407), Expect = 7.604e-41
Identity = 153/612 (25.00%), Postives = 282/612 (46.08%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLV------DGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAEND----HLA-----------------------------IHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQD-NLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYN-EEITIELLDK 2011
            S L  A N N + ++ +L    +D+N      +  +HLA++   V++V  L K R  +ID     G TALHIA   G +++V  L+ +GA++N    +  + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH +V+  LLE         SDT  +  +     I+    + N   L +   + AD+ +K++       G T  H +A  G   +  L+      ++   R+G TPLH A    + N+V  LL+ GA ++T  R   TP+  A  S      + ++I++L+  ++ +L + +   +  H   +  ++  ++ L+   +       ++   L + +PLH AA  G   + K+LL+ G +P   A N     H+A                             IH+A+  G+LNVV+LLL+ N  +    ++   + +H A+  G+ E+ + L++ G     K    +  L ++++ G  +IV+ +L+   +PN      +T L+FA+  GH +V   L  +GA          +P   A    R +V    L       + + + +NG + +     Y+ +++ + LLDK
Sbjct:   13 SFLRAARNGNLERLMDHL-KGGMDINTCNQNGLNALHLASKEGHVDVVTELLK-REAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE---------SDTKGKVRLPA-LHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARS-----GHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAP------VDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEK---YASADPKGKNGLTPLHVATHYDHQKVALLLLDK 597          

HSP 4 Score: 65.4698 bits (158), Expect = 6.048e-11
Identity = 47/156 (30.13%), Postives = 75/156 (48.08%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            T    + LH A  E   D+VA LL     +++     +  +HLAAQ + V + EIL K +   ++       T LH+A   G+  MV  LL   A VN    +  + LH  A++    ++  LL ++A     ++NG T + IA   G+I V++ L
Sbjct:  638 TQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKA-DVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.318 bits (425), Expect = 3.953e-43
Identity = 144/559 (25.76%), Postives = 255/559 (45.62%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV----SANSNLLIRD--EKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL----EINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GN   +K++     K   K  D     + LH A     + V+  LL     +       + P+H+A Q   +  V++L   R   +D V +   T LH+A   GH  + + LL  G   N    +  + LH   +KN ++++++LL + A +   + +G TP+ +A+  GH+ V+  LL+     NG  S   N  ++ G + +  A +   LEV++  L +GA +  K  + +T  H ++  G  E+ +L+  R  D N     G+TPL++A      ++   LLE GAD++   +   TP+ +A           E+  +L+    SA+  +  ++    L    HY  +++ +  +       S          ++ Y  +PLH AAK   +E+ KVLLE GA+  +  +     +HLA +EG+ ++V LLL     I++ T+        + +H AA+E K  +   L +   D           L +++  GNI +V ++L+N+   N   +   T LH AA  GH  V+  L +H A
Sbjct:  233 FTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD---GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLG-RQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-----NGASS---NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKY-----GRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHS--------TAKNGY--TPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK-----GGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEA 759          

HSP 2 Score: 162.155 bits (409), Expect = 3.764e-41
Identity = 142/598 (23.75%), Postives = 256/598 (42.81%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKS---------------------------PLHYAAKLGDIEICKVLLE--AGADPKLFAEND----HLA-----------------------------IHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLNDD 1909
            LH A  ++  +  A LL  + + ++       P+H+AA    + +  +L       +D     G T LH+A +RG++NMV+ LL  GA ++    D ++ LH  AR    ++I++LL   AP++ K+ NG +P+ +A    H+  +  LL +           +++  +D  + +  A    +  V ++ L  G + N + ++G T  H +      ++ EL+      I+T    G TP+H A +   LN+V  LL+ GA  N +N   +TP+ +A  +        E++K L+ + + + ++  + +T  H        + ++ L++  S            LYF S                           PLH A+K G +E+  +LLE  A ADPK+  +N     H+A                             +H+A K+  L V K+LLE+  ET        + L H AA+EG  ++   L+            G   + L+A+   +++ E + K+K + N   +   T LH A+  G+++++  L R+ A       N  +P  +A       VV   L  +
Sbjct:  176 LHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGA-AVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGR--------QAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRA-----GQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPL-HLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE 758          

HSP 3 Score: 160.614 bits (405), Expect = 1.114e-40
Identity = 141/539 (26.16%), Postives = 255/539 (47.31%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAEND----HLA-----------------------------IHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            S L  A N N + ++ +L    +D+N      +  +HLA++   V++V  L K R  +ID     G TALHIA   G +++V  L+ +GA++N    +  + L+  A++N LE++K LL   A   + + +G TP+ +A  +GH +V+  LLE         SDT  +  +     I+    + N   L +   + AD+ +K   G T  H +A  G   +  L+      ++   R+G TPLH A    + N+V  LL+ GA ++T  R   TP+  A  S      + ++I++L+  ++ +L + +   +  H   +  ++  ++ L+   +       ++   L + +PLH AA  G   + K+LL+ G +P   A N     H+A                             IH+A+  G+LNVV+LLL+ N  +    ++   + +H A+  G+ E+ + L++ G     K    +  L ++++ G  +IV+ +L+   +PN      +T L+FA+  GH +V   L  +GA
Sbjct:   14 SFLRAARNGNLERLMDHL-KGGMDINTCNQNGLNALHLASKEGHVDVVTELLK-REAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE---------SDTKGKVRLPALH-IAARKDDTNAAALLLQHEHNADVTSK--SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARS-----GHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAP------VDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGA 526          

HSP 4 Score: 131.339 bits (329), Expect = 2.149e-31
Identity = 119/456 (26.10%), Postives = 213/456 (46.71%), Query Frame = 2
Query:  458 KRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLA-IHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF 1822
            K  + I+  +  G  ALH+A + GH ++V  LL   A ++       + LH  A     +++++L+ + A +  +S NG TP+ +AA E H++++ FLL+     NG       E   DG + ++ A+Q  + +V  + LL  +D   K+       H +A         L+     + +   + G TPLH A +  ++N+   LL +GA V+ + R   TP+ VA         N  ++K+L+   + +  +     T  H      + K I+ L+      IL +  N       SPLH A + G+   C  LL     P      D+L  +H+A   G+  V KLLL+   E    R +N  + +H A ++ + ++   L++ G       + G   + +++  G++++V+ +L+N  + N  + +  T LH A+  G LEV+K L + GAR 
Sbjct:   32 KGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLD-----NGANQSVATE---DGFTPLAVALQQGHEQV--VGLLLESDTKGKVR--LPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKR-----GNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKN-----GLSPLHMATQ-GEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNA-RALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARV 462          

HSP 5 Score: 65.0846 bits (157), Expect = 7.329e-11
Identity = 47/156 (30.13%), Postives = 75/156 (48.08%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFL 751
            T    + LH A  E   D+VA LL     +++     +  +HLAAQ + V + EIL K +   ++       T LH+A   G+  MV  LL   A VN    +  + LH  A++    ++  LL ++A     ++NG T + IA   G+I V++ L
Sbjct:  633 TQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKA-DVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 6 Score: 59.3066 bits (142), Expect = 3.657e-9
Identity = 38/140 (27.14%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  188 VMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVL 607
            V  +  A Q G+ + + ++   + ++    L T    + +H A  E++ +V   L   K DVN        P+H+A+    +++V  L + R L ++A    G T LH A ++GH+++V  LL + AS N+L ++  + L
Sbjct:  637 VAPLHLAAQEGHADMVALL---LGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRAL-VNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTAL 772          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 3.253e-37
Identity = 139/542 (25.65%), Postives = 232/542 (42.80%), Query Frame = 2
Query:  290 NNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINES-----SLIHFAAEE---------------------------------GKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            +  + LH A     + VV  LL     +       + P+H+A Q + VE V++L + R   +D + +   TALH+A   GH    + LL  GA+ N    +  + LH   +KN + ++++LL Y A +   + +G TP+ ++A  G++ ++  LL+      G  S   N  ++ G + +  A +    EV++  L NGA ++ K  + +T  H +A  G  E+ +L+       +    +G TPLH A      ++   LLE GA +  + +   TP+ VA     +     E+  +L+   ++     +   T  H      N K    L+   +          ++ Y  +PLH AAK   +EI   LLE GA+           +HL  +EG+ +V  LLL      RY  D+N +     S +H AA+E                                 G  ++  FL++ G D  +K   G   L  +A+ G+  IV  +LK    PN      NTAL  A   G++ V+  L
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRA-PVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQ------GGASP--NATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVA-----SKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASP----HATAKNGY--TPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLL-----ARY-ADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 2 Score: 150.599 bits (379), Expect = 4.469e-37
Identity = 140/523 (26.77%), Postives = 231/523 (44.17%), Query Frame = 2
Query:  401 PIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE----------------KIKAENGNVSDTL---------NEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINES-----SLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRK 1879
            P+H AA+    ++VEIL ++    I A    G + LH+A +  H   V+ L+ Y A V+ +  D ++ LH  A        K+LL   A   +++ NG TP+ IA  +  I+V+  LL+                 + A  GN++  L         N  ++ G + +  A +    EV++  L NGA ++ K  + +T  H +A  G  E+ +L+       +    +G TPLH A      ++   LLE GA +  + +   TP+ VA     +     E+  +L+   ++     +   T  H      N K    L+   +          ++ Y  +PLH AAK   +EI   LLE GA+           +HL  +EG+ +V  LLL      RY  D+N +     S +H AA+E K  +   L++ G    A    G   L+++   GNI +V ++L++  + N   +   T LH AA  GH  ++  L + GAR  D   N    + ALA +R+
Sbjct:    9 PLHCAARSGHEQVVEILLEQGA-PILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVA-----SKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASP----HATAKNGY--TPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLL-----ARY-ADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVN---GNTALAIARR 510          

HSP 3 Score: 131.339 bits (329), Expect = 4.249e-31
Identity = 104/407 (25.55%), Postives = 191/407 (46.93%), Query Frame = 2
Query:  287 VNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE 1507
            +N F+ LH A  +N+  V+  LL +   +  +    + P+H++A    + IV IL +      +A +V+G+TALH+A R G + +V +LL  GA V+    ++ + LH  AR   LE++++LL + A     +SNG TP+ +AA EGH  V   LLE           +L      G + +  A +   +EV  + L   A  +    +G T  H ++     ++  L+  +    +   ++G TPLH A     L I   LLE GA+ N   R    P+ +        + + ++  +L++  +++    +   +  H   +   +   + L++  +       +N       +PL  A   G+I++   LL+ GAD     +N +  +H A ++G+ ++V LLL+
Sbjct:  103 LNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGA-SPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEH--------GASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQ-----EGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAH------VNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK 489          

HSP 4 Score: 105.531 bits (262), Expect = 3.615e-23
Identity = 77/271 (28.41%), Postives = 121/271 (44.65%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVN 1096
            T N ++ LH A  E  +DV A LL     + +   K   P+H+A++   +E+  +L + R    DA    G T LH+A    +  +   LL  GAS +    +  + LH  A+K+ LE+   LL Y A     +  G  P+ + A EGH  V + LL +           +N     G S +  A Q   + V +I + +GA +N     G T    +   G  ++   +     D+N+  ++G TPLH A      +IV  LL+ GA  N
Sbjct:  234 TSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQ-RFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYA--------DVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPN 495          

HSP 5 Score: 92.8189 bits (229), Expect = 2.364e-19
Identity = 74/270 (27.41%), Postives = 127/270 (47.04%), Query Frame = 2
Query: 1007 RDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +DG TPLH A  +    +V  LLE GA +    +   +P+ +A        ++ E +++L+   + +        T  H      + +T K L+   +        N++ L   +PLH A K   I + ++LL+ GA  +   E+    +H++   GNLN+V +LL+            E++L H AA  G+ E+ R L+  G    AK    +  L ++A+ G ++IV+ +L++  +P+       T LH AA  GH +V   L  HGA
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQG-----DHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANP------NVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETAL-HMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGA 261          

HSP 6 Score: 78.1814 bits (191), Expect = 7.916e-15
Identity = 56/172 (32.56%), Postives = 82/172 (47.67%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLN 799
            T    + LH    E   DV + LL    DVN      + P+HLAAQ + V + EIL K     ++A    G T L +AC  G+  MV  LL +GA VN    +  + LH  A++    ++ +LL   A     + NG T + IA   G+I V++ L  K+  E    S T++
Sbjct:  366 TRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGA-HVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL--KVVTEETITSTTVS 534          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 9.358e-36
Identity = 152/608 (25.00%), Postives = 251/608 (41.28%), Query Frame = 2
Query:  296 FSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE----------------KIKAENG---------NVSDTLNEKDIDGNSCISFAIQNRNLEV-LQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAV-YNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA--------CSSLLNTDNNYEIIK--------------------------------------ILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKL-GD--------------------------IEIC-KVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINES----SLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQK-KNTALHFAASGGHLEVIKCL 1801
             + LH A     +  V  LL    DVN        P+H+AA    V+  E +    +   +  D  G+TALH A   GHS MV  L++ GA++N  +      +H  A     E++K+L+++ A +  K   G +P+  A+  G I V+  LL+                 +   NG         +    +N+ +  G + + FA  + +  + L++ + NGAD+N +  DGK+  H +A+ G     + +     +I+  DRDGNTPLH A  Y  +L ++  L+  GAD          P+ +A        C  LL+    Y I+                                       +L+S  +++  +D   +T  HY     N++ +  L+   SG  L    N QD    +PLHYAA   GD                           +IC + LL   ADP +  +  +  +H A   G+   ++LLLE   +   F+   +S    S +H AA  G +     LI   +D   ++  G   L L+A  G+ D V  ++++  +  L +   + TALH AA+ GH+E ++ L
Sbjct:   73 LTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLS-SSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHEL-LINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLV--ASGARL----NEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLE---QPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLL 669          

HSP 2 Score: 142.124 bits (357), Expect = 1.282e-34
Identity = 129/510 (25.29%), Postives = 231/510 (45.29%), Query Frame = 2
Query:  314 AVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIF-----RFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQD 1828
            A+     D V  L+  K +VN +  +   P+H AA     EI+E+L      ++++ D K  T LH AC       V+TLL + A VN  + +  + LH  A    ++  + ++   +   +    G+T +  AA  GH +++NFL+ K     G   +  ++KD      I +A    + EV+++ + +GAD+  K   G +  H ++ +G   + +L+     DI+  +  GNT LH A YN    +V +L++ GA+VN +N    TP+  A +S     +    +++LV+  +++ ++ +  K+  H           + LI+   GE     I+ +D    +PLH AA+ G   +   L+  GAD      +    +HLA   G  +  + LL                         KY I        ++  G +    D++GR  L  +A GGN++ +  +L    + N  D+ + TALH+AA+  +++ +  L   GAR  +
Sbjct:   13 AIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGA-RVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAK-----GANINAFDKKD---RRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAAST----HGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQN-GGE-----IDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQ---------------------KYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNE 482          

HSP 3 Score: 96.2857 bits (238), Expect = 1.785e-20
Identity = 121/541 (22.37%), Postives = 211/541 (39.00%), Query Frame = 2
Query:  140 EVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNF--SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQR------------NLVEI---VEI--------LCKKRTLQIDA----VDVKGQTALHIACRRGHSNMVETLLSYGAS--VNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE-----------------------------KIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEI----GADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLK-TVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFA 1567
             V+SA F+    +      +  A   GNVE L ++           ++  + F  + LHYA        V  L+     +N    +   P+H AA              N + +   +++        +C +  L+ DA     D +G T +H A   GH   +E LL    +   +      IS LH  A       +++L+     L ++  NG TP+ +AA+ GH   +  L++                             ++  EN + ++ ++  D +  + +  A+ N + +   + L  GA IN K   G T  H  A TG  E  +L+  RS D++  +R G  PLH A     + I+  L++     GA +  ++R   TP+  AC +    D   E++  L     ++  + E    +  H  V   N    + LI T   +I    IN  D   + PLH AA    +E  ++LL   A   +        + +A + G    V++L+         +D N ++ +H A
Sbjct:  406 HVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGAD-----MNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYN--GHDGCVELLLEL-----DVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKI----INCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLA 930          

HSP 4 Score: 95.1301 bits (235), Expect = 4.257e-20
Identity = 102/413 (24.70%), Postives = 178/413 (43.10%), Query Frame = 2
Query:  203 YAVQHGNVEYL--KMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVR-PIHLAAQRNLVEIVEILCKK--RTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFE-LIEPRSWD-INTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV-SANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGA 1417
            Y   HG +E L   +V  DV +         N ++ L  A      D V  L+     V +    + R  +H AA    VE + +L +       +DA D   QT + +A   GH++    LLS GAS+N  ++   + LH  A     E + +LL     + ++   G+ P+ +AA  GH+ +L+ L++   A    +  T    D +G + + +A  N +   +++ LL       +  +  +  H + +       E LI+      IN  D  G  PLH A +   +  +  LL   A VN ++   ++P+M+AC      +     +++LV S  ++L ++D    T  H    R +      ++  +       LIN  +   ++PLH AA+ G   + +VLL  GA
Sbjct:  592 YHGHHGALEVLIRSLVDLDVREG--------NGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLT----DRNGYTPLHWACYNGHDGCVEL-LLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACE-----NGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLD---DLNLINATNAALQTPLHLAARSGMATVVQVLLNKGA 983          

HSP 5 Score: 85.1149 bits (209), Expect = 5.177e-17
Identity = 135/577 (23.40%), Postives = 236/577 (40.90%), Query Frame = 2
Query:  266 CLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKN--------------------DLE--------MIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFE-LIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGAD----VNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLI-RTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEA----GADPKLFAENDHLAIHLATKEGNLNVVKLLLEINM----ETRYFRDI-------NESS-----------LIHFAAEEGKYEIFRFLIEVGIDCL-----------AKDDYGRNTLMLSAKGGNIDIVEYILKN-KINPNLFDQKKNTALHFAASGGH 1780
            C K L     +S++    NE       ++L+   +++         +H AA    VE + +L       ++  D   +TALH A    +   V TL++ GA +N+ +  + + LH+ A  +                    D+          ++ LL   A   I+   G TPV  AA  GH   L  LLE+  A     SD  +   I      ++   +  LEVL   L+   D++ +  +G T    +A+ G  +    LI+  +  +     D  T LH A  N  +  +  L+E  AD    V+ S+   QTP+M+A       + + +   +L+S  +++  +D K  T  H      + + +  L+ R++        ++L++   ++PLH AA  G + I   L++A    GA   L   N +  +H A   G+   V+LLLE+++    E   F  +       NES            +I+    +G+  +        ++CL             D  G++ LM++ + G    VE ++ + K +  L D  +NTALH A S  H
Sbjct:  386 CRKLLSAGQKYSIVSSFSNE-------HVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGA-DMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQ---SDGKSGHPISPLHLAAYHGHHGALEVLIRSLV---DLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVE-NADSNEAVDASDANEQTPVMLAVG-----NGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVD-------VSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSH 935          

HSP 6 Score: 82.4185 bits (202), Expect = 3.728e-16
Identity = 70/287 (24.39%), Postives = 127/287 (44.25%), Query Frame = 2
Query: 1019 TPLHYAVYNTDLNIV--------------------------------IQLLEI-GADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGH 1780
             PL  A++N D + V                                I+LL + GA VN+ +  + TP+  AC+S      +   ++ L+  ++++  RD+  +T  H       +K  + +I  +S        N+ D   ++ LH+AA  G  E+   L+  GA+   F + D  AIH A   G+  VVK+L+    + R  +D    S +H A+  G+  + + L+++G+D    + +G   L ++   G   +V  ++    N N  +++  T LHFAA+  H
Sbjct:    8 APLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACAS-----RSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSS------NVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVR-CKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTH 282          

HSP 7 Score: 82.0333 bits (201), Expect = 5.239e-16
Identity = 132/610 (21.64%), Postives = 236/610 (38.69%), Query Frame = 2
Query:  269 LKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVE-------------IVEILCKKRTL----QIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVM-IAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKD-IDGNSCISFAIQNRNLEVLQICLLN----GADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGN--TPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRD-EKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAK----DDYGRNTLMLSAKGGNIDIVEYILK---------NKINP-------------------------NLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQ-DNLFNLSPFDEALANSRKDVVKYFLN 1903
            + C D   N + LH A     + ++  L+T   D    G   + P+HLAA     +             IV     +  L    +ID  D  G+T LH A   G+   +  LLS GA +NK +  + + LH+ A   +++ +  L++  A L  +     TP+   AA +G    ++F          +V +T++ +  ID +S  S A         QICL +     AD   +   G T  H +A  G     EL+  +     +  + G+  +PLH A Y+     +  L+    D++       TP+ +A         + + +++L+   +++L+++    +T  H      +++ ++ L+         + ++  D   ++P+  A   G  +   +LL  GA           A+H     G+   V LLL+ +++    R+    + +H AA  G   I   L++  +   A     D  G   L  +   G+   VE +L+         N  +P                         N  D K    LH AA   H+E ++ L  H A     ++   SP   A  N +   V+  +N
Sbjct:  330 IDCEDRDGN-TPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSF----------SVYNTISVQSYIDVHSTCSEA---------QICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAA-----LRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSN---EAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVS-LRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVN 910          

HSP 8 Score: 74.7146 bits (182), Expect = 9.458e-14
Identity = 60/198 (30.30%), Postives = 101/198 (51.01%), Query Frame = 2
Query: 1322 INLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDH--LAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA--RFQDNLFNLSPFDEALANSRKDVVKYFLN 1903
            +N  D   ++PLH AA LG+ EI ++L+ +GA  ++ ++++     +H A    +   V+ LL+ + +    RD N  + +H AA     +    +I +       D  GR  L  +A  G+ ++V +++    N N FD+K   A+H+AA  GH EV+K L  HGA  R +D     SP   A ++ +  VVK  L+
Sbjct:   32 VNAVDDEKRTPLHAAAYLGEAEIIELLVLSGA--RVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNA-RDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDK-KGYSPLHAASSSGQIGVVKLLLD 225          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 5.763e-34
Identity = 164/638 (25.71%), Postives = 265/638 (41.54%), Query Frame = 2
Query:  302 LLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKA-PLMI----KSSNGQTPV------MIAAIEGHIKVLNFLLE----KIKAENGNVSDTLNEKDIDGNS----CISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVN-----------TSNRLFQTPIMVACSSLLNTDNNYEII------------KILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTIS------------------------GEILFQ---LINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPK-----------LFAEND---------HLAIHLATKEGNL-NVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA-RFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHE 1942
            LL  A + N++ ++A L    ++ +    +   P+HLAA  N V IV++L +     + A D  G   LH AC  GH  + E L+ +GASVN ++  + + LH  A KN +E+  +LLSY A P ++    KS+    P       ++    GH  +L    E    ++K   G   D +N K    +     C   +   +  +V ++ L  GA++N K  D  T  H ++     ++ +++      IN  D  G T LH A +   L     LL  G D N             N   Q  +  +   + N+D  ++++            ++  +   N    + +  T  H+      +  ++YL++  +                         E+L +   ++N+ DL+  +PLH AA  G  EICK+LL+ GADP            L  E D           A+  A K+G L  V KL    N+  R  +  N S+ +H AA     E+  +L+E G D  A+D  G   L  +A  G++DI   ++K     N  D+   T LH AA  G  ++   L  HGA     N    +P D A A    D V+  L D    + +   H+
Sbjct:  304 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQ-HGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGH-SLLQAAREADVTRVKKHLG--LDIINFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNESVQQILHESSLPVRNSDVEHQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSGENVNCRDSQGRN-STPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLATA----DDVRALLIDAMPPEALPVTHK 932          

HSP 2 Score: 122.094 bits (305), Expect = 2.809e-28
Identity = 142/576 (24.65%), Postives = 232/576 (40.28%), Query Frame = 2
Query:  374 NIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQT------PVMIAAIEGHIKVLNFLLEKIKAENGN------VSDTLNEKDIDG--NSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYE----------------------------------------------------IIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHL---------------------------ATKEGNLNVVKLLLEINMETRYFRDI--NESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +  G K+  P+H AA     ++VE L +     + A D  G   LH AC  GH+ +V  LL  GA  N  ++   + LH  A K  +++  +LL + A   I++++G+T      P   A + G  K  + LLE  ++ N            +N    DG  ++ +  A     + ++Q+ L +GAD++ K   G    H +   G  E+ EL+      +N +D    TPLH A     + +   LL  GAD    N   ++ I +A +S L     YE                                                    + ++L+   +N+  + + L T  H   ++ +   I  L++  +       IN+ D   ++ LH AA  G +  C++LL  G DP L +     A  L                           A K G+L+ VK L     +T   RD+    S+ +HFAA   +  +  +L++ G D  AKD  G   L  +   G+ ++ E ++K     N+ D  K T LH AA+ G  E+ K L +HGA
Sbjct:  176 DTTGRKST-PLHFAAGFGRKDVVEHLLQNGA-NVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLAEPTAKAVLTGEYKK-DELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQAAREADVTRVKKHLGLDIINFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGA------KINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGNESVQQILHESSLPVRNSDVEHQLLEAAKAGDLDTVKQL--CTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGA 740          

HSP 3 Score: 101.679 bits (252), Expect = 5.037e-22
Identity = 123/492 (25.00%), Postives = 204/492 (41.46%), Query Frame = 2
Query:  467 LQIDAVDVKGQ--TALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGE-LFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHL---------------------ATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEG---KYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEA 1861
            L ++A D  G+  T LH A   G  ++VE LL  GA+V+  +   +  LH+       E++ +LL   A    + +   TP+  AAI+G I V   LL+   A+ G        ++ DG + +  A      E     +L G    ++L++       +A +G  E L  L+ P + + +  D   +TPLH A     + IV  LL+ GADV+  ++    P+  ACS       +YE+ ++LV   ++                                       +N  DL+  +PLH AA    +E+C +LL  GADP L   +   AI L                     A +E ++  VK  L +++        +E++L H A       + ++   L+  G +   K       L +++   + D+++ +LK+    N+ D    T+LH AA  GHL   + L  HG     NL +L  F  A
Sbjct:  170 LNVNARDTTGRKSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQH-GADPG-------IRNTDGKTALDLA------EPTAKAVLTGEYKKDELLE-------AARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSY-----GHYEVTELLVKHGAS---------------------------------------VNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLVYEFRGHSLLQAAREADVTRVKKHLGLDIINFKHPQTHETAL-HCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGC--DPNLPSLQGFTAA 593          

HSP 4 Score: 99.3673 bits (246), Expect = 2.557e-21
Identity = 93/331 (28.10%), Postives = 148/331 (44.71%), Query Frame = 2
Query:  191 MQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKI----KAENGNVS--------DTLNEKDIDG--NSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACS 1141
            +Q F A Q GN    + V + + ++ L   ++     LL  A   +   V     T  ++   M  ++  P+H AA  N V +VE L +     + A D  G   LH AC  GH  + E L+  GA VN  +  K + LH  A K   E+ K+LL + A    K+ +G TP+ +   EG   + + L         A+ G ++        + +N +D  G  ++ +  A    NLEV +  L +GAD+N +   G    H +A  G  ++  L+   S  +N  D+   TPLH A       +   LL  GAD +  N+  QTP+ +A +
Sbjct:  587 LQGFTAAQLGN----ESVQQILHESSLPVRNSDVEHQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQ-HGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVK-EGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLATA 911          

HSP 5 Score: 83.5741 bits (205), Expect = 1.823e-16
Identity = 82/333 (24.62%), Postives = 139/333 (41.74%), Query Frame = 2
Query:  914 GKTIFHTSAMTGFGELFELIEPRSWDINTVDRDG--NTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQD-NLFNLSPFDEALANSRKDVVKYFLN 1903
            GK +F        G +  L+ P   ++N  D  G  +TPLH+A      ++V  LL+ GA+V+  +     P+  ACS       + E++ +L+   ++                                        N +D +  +PLH AA  G I++C VLL+ GADP +   +   A+ LA  E     V       +   Y +D     L+  A    + ++   L  + ++C A D      L L+A    + IV+ +L++  + +  D+     LH A S GH EV + L +HGA     +L+  +P  EA + +R +V    L+
Sbjct:  148 GKELFEACRNGDVGRVKRLVSP--LNVNARDTTGRKSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSF-----GHAEVVNLLLRQGAD---------------------------------------PNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDLA--EPTAKAV-------LTGEYKKD----ELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLS 421          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 60.4622 bits (145), Expect = 1.047e-9
Identity = 56/204 (27.45%), Postives = 89/204 (43.63%), Query Frame = 2
Query: 1358 HYAAKLGDIEICKVLLEAGADPKLFAEN------DHL-AIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLF-----DQKKNTALHFAASGGHLEVIKCLCRHGARFQ-DNLFNLSPFDEALANSRKDVVKYFLND--DNWKKT 1924
            H A + GD+   K ++      KL   N      +H+  +H A+    L+VV  L+    +         ++ +H+AA  G   I  FL++ G D    DD G N L LS    NI +V Y+L N ++  L      D K  T+L +AA  G    +  L + GA  +  +    +P        +  V+KY + D  D ++KT
Sbjct:   78 HTACQRGDLATVKEMIHG----KLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKT 277          

HSP 2 Score: 58.9214 bits (141), Expect = 3.282e-9
Identity = 49/183 (26.78%), Postives = 76/183 (41.53%), Query Frame = 2
Query:  281 DTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNI-MGSKNVRPIHLAAQRNLVEIVEILCK-------------------------------------KRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIA 715
            D+  + + LH+A   N+  VV +L++   DVN   G+ +  P+H AA+   V IV+ L K                                     K  L ID  D KG+T+L  A  +G S  V  LL +GAS+   +++  + LH    K    ++K L+   A    K+  G+    IA
Sbjct:  105 DSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA 287          

HSP 3 Score: 51.9878 bits (123), Expect = 4.559e-7
Identity = 53/201 (26.37%), Postives = 92/201 (45.77%), Query Frame = 2
Query:  920 TIFHTSAMTG-FGELFELIEPRSWDINTVDRDGN---TPLHYAVYNTDLNIVIQLLEIGADVNT-SNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE 1507
            T +HT+   G    + E+I  +  ++N  D D     T LH+A  N  L++V  L+  GADVN  +  L  TP+  A            I+  L+   ++  + D++   + H  V   NI  + Y++  +  + L   I+ +D   ++ L +AA  GD      LL+ GA  K+        +H  T +G  +V+K L++
Sbjct:   75 TRYHTACQRGDLATVKEMIHGKLLEVNN-DGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARY-----GYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLD-IDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQ 268          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 59.6918 bits (143), Expect = 2.483e-9
Identity = 65/242 (26.86%), Postives = 105/242 (43.39%), Query Frame = 2
Query: 1295 ISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAG----ADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETR---------YFRDINESSLIHF-----AAEEGKYEIFRFLIEVGI-----------------DCLAKDDYGRNTLMLSAK-GGNIDIVEYILKNKINPNLFDQ-KKNTALHFAASGGHLEVIKCLCRHGARF---QDNLFNLSPFDEALANSRKDVVKYFL 1900
            +S E + +L+N QD++ + PLHYAA+LG +E    LL        DP     +    + LA    +++VV+ LL I              Y +++  S+ + F     A +   ++  + L+E+                       K+  G  TL + AK GG+  +++ +++   +PN  D   K T + +A   GH EVI  L +H AR     DN    SP   AL  S  DV+   L
Sbjct:  408 LSKETVQKLLNAQDIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDP--IDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDN--GHSPLFYALWESHVDVLNALL 645          

HSP 2 Score: 56.225 bits (134), Expect = 2.621e-8
Identity = 57/226 (25.22%), Postives = 108/226 (47.79%), Query Frame = 2
Query:  191 MQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFS--LLHYAVNENQKDVVAYLLT-------------FKIDVNIMGSKNVR--PIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTA-----------------LHIACR-RGHSNMVETLLSYGASVNKLES-DKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK 760
            + + YA + G +E++  +   +  N L+ +D +++ S   L  A+  N  DVV  LLT                  N++ S  V+  P+++A + N  +  ++L + R+ Q +A + K +++                 LHI  +  G   +++ L+ YGA  N+++  +K + + +  R    E+I  LL + A L I+  NG +P+  A  E H+ VLN LL++
Sbjct:  426 VPLHYAAELGKLEFVHSL---LITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQ-NADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQR 647          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 51.9878 bits (123), Expect = 1.066e-7
Identity = 45/162 (27.78%), Postives = 77/162 (47.53%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNI---MGSKNVRPIHLAAQRNLVEIVEILCKKRTLQID--AVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSY-KAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAE 772
            LH++V+    ++ ++LL+   +VN+          P H+A     +E+V+ L   R L+ D   +  +G T LH+A  +    + + L+  GASV   +      LH  A    L++I++L    K+ +  +   G TP+  A  EGH      L+EK  AE
Sbjct:   40 LHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSL-YDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAE 200          

HSP 2 Score: 49.2914 bits (116), Expect = 9.638e-7
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 2
Query: 1352 PLHYAAKLGDIEICKVLLEAGADPKLFAEND---HLAIHLATKEGNLNVVKLLLEINMETRYFRDINES-SLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILK-NKINPNLFDQKKNTALHFAASGGHLEVIKCLC-RHGARFQDNLFNLSPFDEALANSRKDVVKYFLND 1906
            PLH++      EI   LL    +  L    D       H+A   GNL VVK L +  ++    +  N+  + +H A  +  +E+ +FLIE G     KD + +  L  +A  G++ ++E +    K   N  D++  T L  A + GH +    L  ++GA + D + N     E +A + + V K+FLN+
Sbjct:   39 PLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEY-DLVDNKGAKAEDVALNEQ-VKKFFLNN 227          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Yeast
Match: MGA2 (ER membrane protein involved in regulation of OLE1 transcription; inactive ER form dimerizes and one subunit is then activated by ubiquitin/proteasome-dependent processing followed by nuclear targeting; MGA2 has a paralog, SPT23, that arose from the whole genome duplication [Source:SGD;Acc:S000001472])

HSP 1 Score: 53.1434 bits (126), Expect = 1.996e-7
Identity = 33/92 (35.87%), Postives = 56/92 (60.87%), Query Frame = 2
Query:  443 EILCKK--RTLQIDA----VDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQT 700
            E+L +K  ++L I++     D  G+T LH+AC + +S++V TL+  GA VN ++S  ++ LH      D ++IK+LL+ K    ++S NG T
Sbjct:  697 EVLIQKVIKSLNINSNISICDSLGRTLLHLACLKNYSSLVYTLIKKGARVNDIDSFGLTPLHFACISGDPKIIKMLLNCKVNYSLRSHNGLT 788          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 53.1434 bits (126), Expect = 2.271e-7
Identity = 32/99 (32.32%), Postives = 59/99 (59.60%), Query Frame = 2
Query: 1529 FRDINESSLIHFAAEEGKYEIFRFLIEV-GIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNL--FDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +RD    + +  A ++GKY++ + +IE  G D   +D+ G   L  +A  G+I+IVE +++N  + N+   +   +T L  A++ GHL+V+K L ++GA
Sbjct:  325 YRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGA 423          

HSP 2 Score: 50.8322 bits (120), Expect = 1.207e-6
Identity = 33/94 (35.11%), Postives = 50/94 (53.19%), Query Frame = 2
Query: 1631 KDDYGRNTLMLSAKGGNIDIVEYILKNK-INPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF---QDNLFNLSPFDEALANSRKDVVKYFL 1900
            +D  GR  L ++   G  D+V+ +++    + N  D   NTALH AA  GH+E+++ L  +GA        +F  +P  +A AN   DVVKY L
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLL 419          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 90.1225 bits (222), Expect = 1.494e-20
Identity = 65/166 (39.16%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  269 LKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVR---PIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGA-SVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLL 754
            L  LD  + FS LHYA   N  D+V  LL    DV++ GS +++   PI  AA+ N +E   +L +     ++  +  GQTALH A RRGHS MVE LL  G   VN ++ D  + LH  A      +IK LL   A +  K ++G T   +AA EG  +VL  LL
Sbjct:   22 LNTLDA-DGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGA-DVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          

HSP 2 Score: 73.559 bits (179), Expect = 6.724e-15
Identity = 54/174 (31.03%), Postives = 91/174 (52.30%), Query Frame = 2
Query:  989 DINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNT--SNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL 1504
            ++NT+D DG +PLHYA     ++IV  LL+ GADV+   S  + + P ++  +      N  E  ++L+ A +++ I +   +T  H+   R + K ++ L+R   G++    +N+ D    + LH AA +G   I K LL  GA+      +   A HLA +EG   V++ LL
Sbjct:   21 NLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKF----NAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLR--DGQM---DVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          

HSP 3 Score: 51.2174 bits (121), Expect = 3.580e-7
Identity = 47/195 (24.10%), Postives = 86/195 (44.10%), Query Frame = 2
Query:  515 ACRRGHSNMVETLLSYG-ASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQT---PVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGA-DINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIG 1084
            ACR G  + V  LL     ++N L++D  S LH+    N ++++++LL   A + ++ S       P++ AA    I+    LL             +N  +  G + +  A +  + +++++ L +G  D+N    D  T  H +AM G   + + +     +I   D DG T  H A    +  ++  LL  G
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLR--------AGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 4 Score: 48.521 bits (114), Expect = 2.993e-6
Identity = 38/131 (29.01%), Postives = 68/131 (51.91%), Query Frame = 2
Query: 1454 IHLATKEGNLNVVKLLLEI--NMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKN-KINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF--QDN 1831
            +H AT   ++++V++LL+   +++ R    I     I  AA+    E  R L+  G D    + YG+  L  + + G+  +VE +L++ +++ N+ D+   T+LH AA  G   +IK L   GA    +DN
Sbjct:   33 LHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDN 163          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Nematostella
Match: EDO39112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB40])

HSP 1 Score: 96.6709 bits (239), Expect = 1.497e-20
Identity = 81/291 (27.84%), Postives = 136/291 (46.74%), Query Frame = 2
Query: 1229 KTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAA-KLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPD 2095
            +T  H      + +T++ ++R     I    IN +D Y K+PLHYA  +    +I ++L+E+GA+      ++ L +H A ++G L+ + +LL+ N ET    D    + +H AA   + E  R L+E G +   +DD     L   A  G    V+ +L+   +    D+ + T L  AA  G LEV + L   GA    +     +  D AL N+  D+    +  ++WK  +     +G S ++ LI+    +   +LDKCI       +D+   + Y F LL   PD
Sbjct:    4 RTCLHVAAACSDFRTVEIILRNGGKSI----INSKDSYGKTPLHYAVIRCQGGKIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDITNEIIRHESWKTLLLNTKADGVSPLKKLIERVPCLAKVVLDKCIEHSTWVDTDKEYSVTYDFQLLSPPPD 290          

HSP 2 Score: 66.6254 bits (161), Expect = 3.766e-11
Identity = 63/231 (27.27%), Postives = 105/231 (45.45%), Query Frame = 2
Query:  305 LHYAVNENQK-DVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEK---IKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLV---DGKTIFHTSAMTGFGELFELIE 976
            LHYAV   Q   ++  L+    +V  +      P+H AA++ +++ + IL +     I+ VD +  TALHIA     +     LL  GA V+  + ++++ L + A       +K+LL Y A L  +  N +TP++ AA  G ++V   LL+    I AE  +           G + +  A+ N NL           DI N+++     KT+   +   G   L +LIE
Sbjct:   42 LHYAVIRCQGGKIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSS-----------GWNALDVALDNNNL-----------DITNEIIRHESWKTLLLNTKADGVSPLKKLIE 250          

HSP 3 Score: 60.4622 bits (145), Expect = 3.207e-9
Identity = 62/241 (25.73%), Postives = 98/241 (40.66%), Query Frame = 2
Query:  992 INTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNK 1714
            IN+ D  G TPLHYAV       +IQL                                     L+ + +N+L  D   +   H+  E+  +  I  L++        + IN  D    + LH AA     E C++LLE GA+     +     +      G    VK+LLE + +    RD N  + +  AA  G+ E+FR L++ G D  A+   G N L ++    N+DI   I++++
Sbjct:   31 INSKDSYGKTPLHYAVIRCQGGKIIQL-------------------------------------LIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANP-----ETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEA-RDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDITNEIIRHE 228          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Nematostella
Match: EDO33180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST04])

HSP 1 Score: 82.4185 bits (202), Expect = 4.420e-16
Identity = 56/201 (27.86%), Postives = 96/201 (47.76%), Query Frame = 2
Query: 1634 DDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKN----TALHFAASGGHLEVIK-CLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYY-ALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 2218
            D  GR  L  +A  G++  V+ I     NPN  + + N    T+LH AA  GH EV+   L     +   N +N +  D A+   R++VV    N   W++ M +R E G + ++ L+        + LD+C+ E  + K D++  + + F  L   PD      +++   L +MV +K++N L H +   ++  KW+  G
Sbjct:   15 DTEGRTALHFAAAKGSLRSVQLICM--ANPNCINDEDNADQDTSLHLAAKNGHSEVVDFLLSDPNQKITYNGYNQNGLDVAIEAGRENVVMVIANHTRWRE-MCHRVEEGLTQLQHLVIKMPSAAEKFLDRCVEECGAGK-DEDYSVTFDFMFLQGMPDIRKDDPKKFLDCLHTMVKYKRVNCLSHQVCGAIMNIKWRSVG 211          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Nematostella
Match: EDO29974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T238])

HSP 1 Score: 78.5666 bits (192), Expect = 7.706e-15
Identity = 72/290 (24.83%), Postives = 130/290 (44.83%), Query Frame = 2
Query:  722 EGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGE-----LFELIEPRSWDINTVDRDGNTPLHYAVY-NTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIK----ILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTIS------------GEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETR 1525
            EG    L  LL ++ A      D +N +D  G + +  A++  NL  ++  +  G ++N K  +    F  +A+    +     +  LIE ++ D+N  D+   T L YAV  NT   +V  LLE GA VNT++   +TP+  A ++   T   +E +     +++    ++  +D K +   HY   ++   T   L   +S            G+ + +L+N  D + ++PLH AA  G    C  LL+ GA       + +    LA + G+ +   + +++N   R
Sbjct:   14 EGTPTCLQVLLGRLAA----CHDVINSRDRHGRTPLQLAVKWNNLHAVEALVKAGVNLNLKSHNADEDFFGTALIMACDNKLQVVKALIEGKA-DVNLTDKQNRTALSYAVSSNTATPMVQSLLEAGAHVNTADSHARTPLHYAVNA---TTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHYAFVKLKKHTDASLSDPVSICSLLLEAMAEHGKDMSKLLNTHDKFGQTPLHRAAIRGATICCLNLLQRGARIDAIDNDGNTPFSLAARHGHHSCAMMFIQMNAPAR 295          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Nematostella
Match: EDO39289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ4])

HSP 1 Score: 76.6406 bits (187), Expect = 2.430e-14
Identity = 61/235 (25.96%), Postives = 108/235 (45.96%), Query Frame = 2
Query: 1529 FRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQ-KKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA---LMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 2218
            F D +  +++H  A     ++ +F++E G      D YGR  L ++A     ++VE++ +N       DQ ++ T  H+AA     + +K L + G    D  +N  +P   A    R +  K+ ++          +  +G   +  +I     +  E LD+  T      +D+ N  +Y++ L    PD P + G   YA   L  +V FK+++L+ HP+  RL+  KW KFG
Sbjct:   37 FSDRHGQTILHEVARIWHPDVAKFILENGGKVNVSDSYGRTPLHVAAAVDYPEMVEFLFQNGGKHRKLDQIQQQTPTHYAAKNDATKSLKVLIKLGGNMDDRDYNGRTPLQVAAELDRSETAKFLIDQGT---AAGVQDTSGNCSLSIMISKMPPVAKEALDQFHT------TDRANRKQYYY-LNYLEPDLPEN-GHGCYARTPLQCVVLFKQMDLIMHPVFQRLIAIKWSKFG 260          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Medaka
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:101174541])

HSP 1 Score: 222.631 bits (566), Expect = 3.092e-59
Identity = 249/945 (26.35%), Postives = 431/945 (45.61%), Query Frame = 2
Query:  401 PIHLAAQRNLVEIVE-ILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPA--RKNDLEMIKILLSYKAP-LMIKSSNGQTPVMIAAIEGHIKVLNFLLE--------------------------------KIKAENGNVSDT-LNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFEL----IEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQ-----LINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLF--AENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDY-GRNTLMLSAKGGNIDIVEYILKNKIN-PNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEY--RHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA--GPD---DPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKN-TDTVNETTGCVISA--NQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLR-NIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILI----IYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNL 3034
            P+H AA    V +++ I+      +++  D +G   LH A  R        LL  GA  N L +  +S LH     R+NDL  +K+LLSY A    ++   G TP+M+A    + + L  LL+                                K   E+G+ +   +N  D   +S +  A++  N+E +++C+  GA I+ +  D  T  H +   G  E+ +L    ++     IN  D    TPLH A       +   L+ +GAD+N+ +    TP+++A S        ++ + +L+S  +N+ ++D+      H  + +         ++ I  E+L +     L++ +D    +PLHYA +LG  +  K +L       L   +++   A+H A + G +N  + LLE   ++R   + +E  L  +H A++EG  ++ + L+  G   L   DY G + L  +A  G    +  +L   +   +  D+  NTALH AA  GH+  ++ +   GA    N  + S   EA+ N RKDVV   ++ D  ++ ++      + +  I  +I++  E    LLD C+ E   + +  +  I+Y F  L A   P    D S   Q   A+ +MV + ++ LL HP+  + L  KW  +G     +++ LY+L ++ ++  I ++ P  N TDT +     V  +   QT   +     VL +N  IYS     +G   ++L  +R  +F+D    +    A+Y  LFI  L  N      W    + +   +  FL ++Q   + GI V MF  + +TL ++ + FF L   F  AF+ +  +Q+ F  +  S +++ VM +GE +Y N  + +  K  L   IL     + FV+ MP    NL IGLAVGDI  +   A L+   ++++    +E  L
Sbjct:   63 PLHHAAAGGHVTLIQFIITVLDPKELNCSDDQGNVPLHWAVERNKPESCRALLDLGADPNVLNTALLSPLHLAVSLRQNDL--MKLLLSYNATDCNLQGDLGNTPLMMACSINNCEALTILLKHGAKLCQQNKLGHFPMHAAAFAGAKKAMEVILKAGEEHGHPAAVHINYLDKSNSSPLHLAVRGGNIEAIRLCIATGAKIDQQQNDRSTPLHLACTQGATEVVKLMLSTVDQVEDFINLTDGACQTPLHRATIFDHSELAEYLISLGADLNSCDCKGNTPLLLATSC-----GAWKCVALLLSKGANVNLKDKCGCNFLHLAIHQ------PKGLKNIPEEVLQRNSVKALLSCEDNEGCTPLHYACRLGIHDSVKNMLGLSGQLGLACKSKDKKSALHFAAQYGRINTCQRLLETITDSRLLNEGDERGLTPLHLASKEGHTKVVQLLLRKG--ALFHSDYKGWSCLHHAASEGYTQTMAILLSANLKLLDKTDEDGNTALHIAARAGHVAAVRLMLVKGAELVLNKNHTSFLHEAVQNGRKDVVNAVVDSDRCEEALQLFTPGTSQRCPILDMIEFLPETYKHLLDCCVRESDDDHNSPDYHIEYNFQWLQAPISPQKLSDESLKIQPLVAVNAMVKYNRIELLNHPVCKKYLAMKWVAYGSKAHALNMFLYLLGLLPLTHLIVSLRPSMNTTDTGDHVINMVPVSFTEQTVFKSFSMVMVLIMN--IYS-----IGKEIVQLSQQRWNYFRDHSNHNDWASAVYSLLFIIPLMINAEGSLHWQAGALAVLHYWIGFLLYLQRFENVGIFVVMFGEIMRTLVRIVMLFFFLMLAFSLAFHALMLNQSQFETVPLSVIQTFVMMVGELNYQNNILDAFLKNELPFGILTYFIFVQFVMLMPILLVNLMIGLAVGDIAEVQRNASLKRIAMQIDLHTSLEDKL 985          

HSP 2 Score: 56.6102 bits (135), Expect = 1.369e-7
Identity = 95/425 (22.35%), Postives = 169/425 (39.76%), Query Frame = 2
Query:  290 NNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQ---IDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAI-QNRNL-----EVLQ----ICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTV--DRDGNTPLHYAVYNTDLNIVIQLLEIGAD---VNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLA-IHLATKEGNLNVVKLLLE 1507
            +N S LH AV     + +   +     ++   +    P+HLA  +   E+V+++          I+  D   QT LH A    HS + E L+S GA +N  +                                   G TP+++A   G  K +  LL K      NV    N KD  G + +  AI Q + L     EVLQ      LL+  D      +G T  H +   G  +  + +   S  +      +D  + LH+A     +N   +LLE   D   +N  +    TP+ +A     + + + +++++L+   + L   D K  +  H+       +T+  L+         +L++  D    + LH AA+ G +   +++L  GA+  L    +H + +H A + G  +VV  +++
Sbjct:  235 SNSSPLHLAVRGGNIEAIRLCIATGAKIDQQQNDRSTPLHLACTQGATEVVKLMLSTVDQVEDFINLTDGACQTPLHRATIFDHSELAEYLISLGADLNSCD---------------------------------CKGNTPLLLATSCGAWKCVALLLSK----GANV----NLKDKCGCNFLHLAIHQPKGLKNIPEEVLQRNSVKALLSCED-----NEGCTPLHYACRLGIHDSVKNMLGLSGQLGLACKSKDKKSALHFAAQYGRINTCQRLLETITDSRLLNEGDERGLTPLHLA-----SKEGHTKVVQLLLRKGA-LFHSDYKGWSCLHHAASEGYTQTMAILLSAN-----LKLLDKTDEDGNTALHIAARAGHVAAVRLMLVKGAE--LVLNKNHTSFLHEAVQNGRKDVVNAVVD 600          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 186.037 bits (471), Expect = 2.301e-47
Identity = 150/578 (25.95%), Postives = 257/578 (44.46%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVA-------------------------------CSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR-FQDNLFNLSPFDEALANSRKDVVKYFLNDD---NWKKTMEY 1933
            LH A   +     A LL    + +++      P+H+AA    + + ++L   R   ++     G T LHIA RRG+  MV  LL  GA ++    D+++ LH  AR   + +I+ILL + AP+  K+ NG +P+ +AA   H+  +  LL+     N  + D      +D  + +  A    +  + ++ L  GA  N + ++G T  H +         +L+   S  +  V   G TPLH A +   LNIV  LL+ GA  N SN   +TP+ +A                               C++ +    + E++K+L+   +N         T  H      +I TI+ L+     +   Q + +    F +PLH A+K G +++ ++LLE GA+P    +N    +H+A    NL+VVKLL+     + +    N  + +H AA++ + E+   L++ G     +   G   L L+++ G  D+V  ++  + N NL ++   T LH  A  GH+ +   L + GA  +  +    +P   A       +VK+ L      N K  M Y
Sbjct:  175 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLN-RGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQY----NAEIDDI----TLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARM---GHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILL-----DAGAQQVKMTKKGF-TPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS-KGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGY 733          

HSP 2 Score: 180.644 bits (457), Expect = 1.094e-45
Identity = 141/550 (25.64%), Postives = 251/550 (45.64%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGAD-VNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +   N +  +  A + GNV  ++++   + +       T +  + LH A       ++  LL     +       + PIH+AAQ + ++ V  L +    +ID + +   T LH+A   GH  M + LL  GA  N    +  + LH   +KN +  + +LL + A L   + +G TP+ +AA  GH+ ++  LL++  + N +        ++   + +  A +  + EV Q  L N A ++ +  D +T  H +A  G  EL +L+     + ++    G+TPLH A     ++ +  LL+ GA  V  + + F TP+ VA           ++ ++L+   +N     +   T  H  V   N+  +K L+ +  G       N       +PLH AAK   IE+  VLL+ GA P   +      +HLA++EG  ++V +L+          + N  + +H  A+EG   I   L++ G    A    G   L ++   GNI +V+++L+ + + N   +   T LH AA  GH +++  L +HGA
Sbjct:  232 FTPKNGITPLHIASRRGNVMMVRLL---LDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNA-EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNAS--------NVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGF-TPLHVASKY-----GKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-SKGGSAHSTARN-----GYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVN-LGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGA 756          

HSP 3 Score: 161.384 bits (407), Expect = 1.126e-39
Identity = 140/564 (24.82%), Postives = 247/564 (43.79%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIR--------TISGEILFQLI-------------------NLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLND 1906
            + LH A    Q+ VVA L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q    +  G T L +A ++GH N+V  L++YG    K+   ++  LH  AR +D     +LL       + S  G TP+ IAA   ++ V   LL        N    +N    +G + +  A +  N+ ++++ L  GA I+ +  D  T  H +A  G   + E++      I    ++G +P+H A     ++ V QLL+  A+++       TP+ VA         ++ + K+L+   +    R     T  H   ++ +++++  L++        T SG     +                    N  ++  ++PLH A++ G  E+ + LL+  A     A++D   +H A + G+  +VKLLL+             + L H AA EG     R L++ G   +     G   L +++K G +D+ E +L+   NPN   +   T LH A    +L+V+K L   G        N  +P   A   ++ +V    L +
Sbjct:   78 TALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTE-DGFTPLAVALQQGHENVVALLINYGTK-GKV---RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLL--------NRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHC-----GHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPL-HIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQN 622          

HSP 4 Score: 156.377 bits (394), Expect = 4.276e-38
Identity = 141/511 (27.59%), Postives = 240/511 (46.97%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVEIV-EILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE------------KIKAENGNVSDTL----NEKDID-----GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLK--TVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIE--VGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
            I++NI     +  +HLA++   V++V E+L     ++++A   KG TALHIA   G   +V  L++YGA+VN       S L+  A++N LE++K LL   A   + + +G TP+ +A  +GH  V+  L+              I A N +         N+ + D     G + +  A    N+ V Q+ L  GA++N    +G T  H ++  G   +  L+  R   I+   +D  TPLH A  N  + I+  LLE GA +    +   +PI +A        ++ + ++ L+  N+   I D  L   T  H      + +  K L+   +        N + L   +PLH A K   +    +LL+  A  +   E+    +H+A   G+LN+VK LL+         ++   + +H A+  G  E+ +FL++    +D  AKDD  +  L  +A+ G+ ++V+ +L +K NP+      +T LH AA  GH+  I+ L   GA+
Sbjct:   34 ININIANQNGLNGLHLASKEGHVKMVLELL--HSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQG-----DHMDCVRQLLQYNAE--IDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAK------ANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNA-SNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDD--QTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQ 526          

HSP 5 Score: 125.561 bits (314), Expect = 1.194e-28
Identity = 111/451 (24.61%), Postives = 195/451 (43.24%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVV---KLLLEINMETRYFR---------DINES----SLIHFAAEEGKYEIFRFLIE 1609
            LH A      +V  +LL     V+     +  P+H AA+    E+V++L   +    D+    G T LHIA R GH + +  LL  GA   K+     + LH  ++   +++ ++LL   A       NG TP+ +A    ++ V+  L+ K     G+   T      +G + +  A +   +EV  + L NGA  N + + G T  H ++  G  ++  ++  +  ++N  +++G TPLH       + I   L++ GA V  ++R+  TP+ VAC                                  HY     NIK +K+L++  +       +N +     +PLH AA+ G  +I  +LL+ GA P     N    + +A + G ++V+   KL+ E ++ T             D++E     SL+ F  EE   E+  F+++
Sbjct:  439 LHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKA-NPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSK----GGSAHSTAR----NGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVAC----------------------------------HY----GNIKMVKFLLQQQAH------VNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVSTHRMSFPETVDEILDVSEDEVILSLLFFLQEEA--ELLDFVLQ 834          

HSP 6 Score: 53.5286 bits (127), Expect = 1.301e-6
Identity = 41/160 (25.62%), Postives = 82/160 (51.25%), Query Frame = 2
Query: 1364 AAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNL 1843
            AA+ G+++     ++ G +  +  +N    +HLA+KEG++ +V  LL   +E         ++L H AA  G+ ++   L+  G +  A+   G + L ++A+  ++++V+++L+N  N +L  +   T L  A   GH  V+  L  +G + +  L  L
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTAL-HIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPAL 175          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 177.563 bits (449), Expect = 1.173e-44
Identity = 157/623 (25.20%), Postives = 270/623 (43.34%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGAS--------------------------------------VNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSS---------LLNTD-------------------NNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR-FQDNLFNLSPFDEALANSRKDVVKYFLNDD---NWKKTMEYRHENGKSH 1957
            + LH A    Q+ VV  L+ +  +VN    K   P+++AAQ N +E+V+ L +    Q    +  G T L +A ++GH N+V  L+SYG                                        +N+  +D+++ LH  AR     +I+ILL   AP+  K+ NG +P+ +AA   H+  +  LL+     N  + D      +D  + +  A    +  + ++ L  GA  N++ ++G T  H +       + +L+   S  I  V   G TPLH A +   LNIV  LL+ GA  + SN   +TP+ +A  S         L N                      + E++K+L+   +N         +  H      +++T++ L+     ++  Q   +    F +PLH A+K G +++ ++LLE GA+P    +N    +H+A    NL+VV LL+     + +    N  + +H AA++ + E+   L++ G    A+   G   L L+++ G  DIV  ++  + N NL ++   T LH  A  GH+ +   L + GA  +       +P   A       +VK+ L      N K  +EY   + K H
Sbjct:   75 TALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTE-DGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQY----NAEIDDI----TLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLL-----DMEAQQTKMTKKGF-TPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKG-GSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDH 681          

HSP 2 Score: 164.466 bits (415), Expect = 1.490e-40
Identity = 146/574 (25.44%), Postives = 261/574 (45.47%), Query Frame = 2
Query:  365 IDVNIMGSKNVRPIHLAAQRNLVEIV-EILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLE-------KIKA----------------------ENGNVSD-TLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSS--------LLNTDNNYE--------------------IIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINES-SLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF-QDNLFNLSPFDEALANSRKDVVKYFLN 1903
            ID+N      +  +HLA++   V++V E+L     + ++    KG TALHIA   G   +V  L++YG +VN       + L+  A++N LE++K LL   A   I + +G TP+ +A  +GH  V+  L+        ++ A                      EN NV+   LN    D  + +  A +N +  +++I L NGA I  K  +G +  H +A     +  + +   + +I+ +  D  TPLH A +     +   LL+ GA  N+      TP+ +AC          LL    + E                    I+KIL+   ++    + K++T  H      + +  ++L++  +       ++ +    ++PLH AA++G  E+ K+LLE  A+P       H  +H+A +EG++  V+LLL  +ME +  +   +  + +H A++ GK ++   L+E G +  A    G   L ++    N+D+V  ++    +P+   +   TALH AA    +EV   L +HGA    ++L  ++P   A    R D+V   ++
Sbjct:   31 IDINTANQNGLNALHLASKEGHVKMVLELL--HNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAP------VDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLL--DMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLIS 594          

HSP 3 Score: 127.102 bits (318), Expect = 4.072e-29
Identity = 105/418 (25.12%), Postives = 187/418 (44.74%), Query Frame = 2
Query:  284 TVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLE----INMETR 1525
             +N F+ LH A  +N   V+  LL     +  +    + P+H+A+    + IV+IL +K      A +VK +T LH+A R GH  + E LL   A V+    D  + LH  AR    E++K+LL +KA     ++ G +P+ IAA EGH++ +  LL+ ++A+   ++         G + +  A +   ++V ++ L  GA+ N    +G T  H +      ++  L+  +    ++  R+G T LH A     + +   LL+ GA  N  +    TP+ +A     + +   +I+ +L+S  +N                                       +NL +    +PLH  A+ G + I  +L++ GA         +  +H+A   GN+ +VK LL+    +N +TR
Sbjct:  306 ALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGA-SPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLD-MEAQQTKMTK-------KGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLA-----SQEGRPDIVSLLISKQAN---------------------------------------VNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTR 670          

HSP 4 Score: 87.0409 bits (214), Expect = 8.430e-17
Identity = 95/400 (23.75%), Postives = 177/400 (44.25%), Query Frame = 2
Query:  815 GNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGEL-FELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIR-------------------TISG------EILFQLINLQDLYFK-------SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQ-DNLFNLSPFDEALANSRKDVVKYFLND 1906
            GNS +  A ++ NL+     + NG DIN    +G    H ++  G  ++  EL+      + T  + GNT LH A       +V +L+  G +VN  ++   TP+ +A       +N+ E++K L+   +N  I  E   T     +++ +   +  LI                    +++G         ++ +N+  L          +PLH AA+ G   I ++LL+ GA  +   +N    IH+A +  +++ VK LL+ N E     DI    L  +H AA  G + + + L++ G    ++   G   L ++ K  ++ +++ +LK+  +     +   T LH A+  GHL ++K L + GA     N+   +P   A  +   +V ++ L +
Sbjct:    8 GNSFLR-AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLH-NGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQ-----ENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAE---IDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQN 397          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 167.162 bits (422), Expect = 2.165e-41
Identity = 134/509 (26.33%), Postives = 232/509 (45.58%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF 1822
            LH A  ++     A LL    + ++       P+H+AA    V +  +L   R   +D     G T LH+A +RG++NMV  LL  G+ ++    D ++ LH  AR      +++LL   APL+ ++ NG +P+ +AA   H++ +  LL+  KA   +V+       +D  + +  A    +  V ++ L   A+ N + ++G T  H +      ++ EL+      I  V   G TP+H A +   LNIV+ LL+ GA  + SN   +T + +A  +        E+++ L+   + +  R  + +T  H +  R+    I         ++L Q +   D       +PLH +A+ G +E   VLLEAGA   L  +     +H+ +K G+L+V KLLL+           N  + +H AA     ++   L++ G         G   L ++AK   +DI   +L+     N   ++  T LH A+  GH ++   L   GA+ 
Sbjct:  197 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLN-RGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQH-KAPVDDVT-------LDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARA-----GQAEVVRCLLRNGAMVDARAREDQTPLH-IASRLGKTEIV--------QLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGK-NGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQI 681          

HSP 2 Score: 155.606 bits (392), Expect = 8.111e-38
Identity = 133/513 (25.93%), Postives = 246/513 (47.95%), Query Frame = 2
Query:  290 NNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLN--GADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSL--IHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            +N S L  A   N   V+ YL    +D++      +  +HLAA+   +++V+ L   R   +D+   KG TALHI+   G + +V+TL+  GA +N    +  + L+  A++N L++++ LL         + +G TP+ IA  +GH +V++ LLE         +DT  +  +     +  A +  + +   + L N   AD+ +K   G T  H +A  G   +  L+  R   ++   R+G TPLH A    + N+V  LL+ G+ ++   R   TP+  A  S      +   +++L+   + LL R +   +  H   +  +++ +K+L++  +       ++   L + + LH AA  G   + K+LL+  A+P   A N    +H+A K+  + V++LL++        + + ES L  IH AA  G   I   L++ G      +  G  +L ++A+ G  ++V  +L+N    +   ++  T LH A+  G  E+++ L +H A
Sbjct:   32 SNTSFLRAARAGNIDKVLEYL-KGGVDISTCNQNGLNALHLAAKEGHMDLVQELL-DRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE---------NDTKGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSK--SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARS-----GHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAP------VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGAS---IQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMA 514          

HSP 3 Score: 153.68 bits (387), Expect = 2.599e-37
Identity = 148/570 (25.96%), Postives = 247/570 (43.33%), Query Frame = 2
Query:  290 NNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV-------SANSN------LLIRDEKLKTVF--------HYLVERINIKTIKYLIRTIS---GEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAK-------------GGNID--------------------IVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
            + F+ LH A +    +V   LL     V+      + P+H+A++R    +V +L   R  QIDA    G T LH A R GH   VE LL  GA +     + +S LH  A+ + +E +K LL +KAP+   + +  T + +AA  GH +V   LL+K    N         + ++G + +  A +   ++V+++ +  GA I      G T  H +A  G   +  L+       +  +  G T LH A       +V  LL  GA V+   R  QTP+ +A S L  T    EI+++L+       +A +N      +  R+ +L+T          H L  +     +  + +  S    ++L Q     D   K   +PLH AA   + ++  +LL+ GA P   A+N +  +H+A K+  +++  +LL+   ET        + L H A++EG  ++   L+  G         G   L L+A+             G N+D                    +V ++L+N  + N   +   T LH AA  G+  +I  L +HGA+
Sbjct:  225 SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLD-RGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNA--------RALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIA-SRLGKT----EIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPL-HLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAK 779          

HSP 4 Score: 153.68 bits (387), Expect = 3.032e-37
Identity = 136/500 (27.20%), Postives = 235/500 (47.00%), Query Frame = 2
Query:  347 YLLTFKIDVNIMGSKNVRP---------IHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHL-AIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            Y L     +N +G +  RP         +  A   N+ +++E L  K  + I   +  G  ALH+A + GH ++V+ LL  GA V+       + LH  +     E++K L+   A +  +S NG TP+ +AA E H+ V+ +LL     ENG    T  E   DG + ++ A+Q  + +V+ I L N      +L       H +A     +   L+     + +   + G TPLH A +  ++N+   LL  GA V+ + R   TP+ VA         N  ++++L+   S +  +     T  H      +  +++ L+      +L +  N       SPLH AA+   +E  K LL+  A P      D+L A+H+A   G+  V KLLL+        R +N  + +H A ++ + ++   L++ G    A  + G   + ++A  G+++IV  +L+N  +P++ + +  T+LH AA  G  EV++CL R+GA
Sbjct:    9 YRLDPSDRLNGLGQRRKRPKKSDSNTSFLRAARAGNIDKVLEYL--KGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLL-----ENGGNQSTATE---DGFTPLAIALQQGHNQVVSILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKR-----GNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEK-GAPLLARTKN-----GLSPLHMAAQGDHVECVKHLLQHKA-PVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNA-RALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGA 481          

HSP 5 Score: 146.362 bits (368), Expect = 4.833e-35
Identity = 138/581 (23.75%), Postives = 252/581 (43.37%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL----EINMETRYFRDINESSLIHFAAEE---------------------------------GKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            +   N +  +  A + GN   ++++   + +       T +  + LH A     +  V  LL     +       + P+H+AAQ + VE V+ L + +   +D V +   TALH+A   GH  + + LL   A+ N    +  + LH   +KN ++++++L+ Y A +   + +G TP+ +AA  GH+ ++  LL+     NG   D  N   I G + +  A +    EV++  L NGA ++ +  + +T  H ++  G  E+ +L+       +    +G TPLH +     L     LLE GA  + + +   TP+ V     ++   + ++ K+L+   +      +   T  H      N K    L+   +          ++ Y  +PLH AAK   ++I  VLL+ GA+     +     +HLA++EG+ ++  LL+    +IN+ T+     +  + +H AA+E                                 G  ++  FL++ G    AK   G   L  +A+ GN  I+  +L++   PN      NTAL  A   G++ V+  L
Sbjct:  254 FTARNGITPLHVASKRGNTNMVRLL---LDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKA-PVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQ-----NGASPDVSN---IRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHV-----VSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASP----HTTAKNGY--TPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTK-----SGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 6 Score: 144.436 bits (363), Expect = 2.230e-34
Identity = 132/511 (25.83%), Postives = 232/511 (45.40%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESD-----KISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            + LH +    Q +VV  L+    D+N        P+++AAQ N +++V  L +    Q  A +  G T L IA ++GH+ +V  L         LE+D     ++  LH  ARK+D +   +LL       ++S +G TP+ IAA  G++ V   LL +  A +            +G + +  A +  N  ++++ L  G+ I+ K  DG T  H +A +G     E++  +   +    ++G +PLH A     +  V  LL+  A V+     + T + VA         +Y + K+L+   +N   R     T  H   ++  +K ++ L++  +     Q +    L   +P+H AA +G + I  +LL+ GA P +       ++H+A + G   VV+ LL  N      R   + + +H A+  GK EI + L++      A    G   L +SA+ G ++    +L+   + +L  +K  T LH  +  G L+V K L +  A
Sbjct:  100 TALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATE-DGFTPLAIALQQGHNQVVSIL---------LENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR--------NGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHC-----GHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGAS---IQAVTESGL---TPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLR-NGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQA 580          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 166.777 bits (421), Expect = 2.371e-41
Identity = 134/509 (26.33%), Postives = 232/509 (45.58%), Query Frame = 2
Query:  305 LHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARF 1822
            LH A  ++     A LL    + ++       P+H+AA    V +  +L   R   +D     G T LH+A +RG++NMV  LL  G+ ++    D ++ LH  AR      +++LL   APL+ ++ NG +P+ +AA   H++ +  LL+  KA   +V+       +D  + +  A    +  V ++ L   A+ N + ++G T  H +      ++ EL+      I  V   G TP+H A +   LNIV+ LL+ GA  + SN   +T + +A  +        E+++ L+   + +  R  + +T  H +  R+    I         ++L Q +   D       +PLH +A+ G +E   VLLEAGA   L  +     +H+ +K G+L+V KLLL+           N  + +H AA     ++   L++ G         G   L ++AK   +DI   +L+     N   ++  T LH A+  GH ++   L   GA+ 
Sbjct:  212 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLN-RGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQH-KAPVDDVT-------LDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARA-----GQAEVVRCLLRNGAMVDARAREDQTPLH-IASRLGKTEIV--------QLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGK-NGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQI 696          

HSP 2 Score: 155.992 bits (393), Expect = 6.576e-38
Identity = 134/500 (26.80%), Postives = 235/500 (47.00%), Query Frame = 2
Query:  320 NENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHL-AIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            N++Q     Y     +   ++   N   +  A   N+ +++E L  K  + I   +  G  ALH+A + GH ++V+ LL  GA V+       + LH  +     E++K L+   A +  +S NG TP+ +AA E H+ V+ +LL     ENG    T  E   DG + ++ A+Q  + +V+ I L N      +L       H +A     +   L+     + +   + G TPLH A +  ++N+   LL  GA V+ + R   TP+ VA         N  ++++L+   S +  +     T  H      +  +++ L+      +L +  N       SPLH AA+   +E  K LL+  A P      D+L A+H+A   G+  V KLLL+        R +N  + +H A ++ + ++   L++ G    A  + G   + ++A  G+++IV  +L+N  +P++ + +  T+LH AA  G  EV++CL R+GA
Sbjct:   24 NQDQNAPPQYFCEEHVPAEMLSDSNTSFLRAARAGNIDKVLEYL--KGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLL-----ENGGNQSTATE---DGFTPLAIALQQGHNQVVSILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKR-----GNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEK-GAPLLARTKN-----GLSPLHMAAQGDHVECVKHLLQHKA-PVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNA-RALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGA 496          

HSP 3 Score: 153.68 bits (387), Expect = 2.748e-37
Identity = 148/570 (25.96%), Postives = 247/570 (43.33%), Query Frame = 2
Query:  290 NNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILV-------SANSN------LLIRDEKLKTVF--------HYLVERINIKTIKYLIRTIS---GEILFQLINLQDLYFK---SPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAK-------------GGNID--------------------IVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGAR 1819
            + F+ LH A +    +V   LL     V+      + P+H+A++R    +V +L   R  QIDA    G T LH A R GH   VE LL  GA +     + +S LH  A+ + +E +K LL +KAP+   + +  T + +AA  GH +V   LL+K    N         + ++G + +  A +   ++V+++ +  GA I      G T  H +A  G   +  L+       +  +  G T LH A       +V  LL  GA V+   R  QTP+ +A S L  T    EI+++L+       +A +N      +  R+ +L+T          H L  +     +  + +  S    ++L Q     D   K   +PLH AA   + ++  +LL+ GA P   A+N +  +H+A K+  +++  +LL+   ET        + L H A++EG  ++   L+  G         G   L L+A+             G N+D                    +V ++L+N  + N   +   T LH AA  G+  +I  L +HGA+
Sbjct:  240 SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLD-RGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNA--------RALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIA-SRLGKT----EIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPL-HLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAK 794          

HSP 4 Score: 146.362 bits (368), Expect = 5.151e-35
Identity = 138/581 (23.75%), Postives = 252/581 (43.37%), Query Frame = 2
Query:  170 YDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLL----EINMETRYFRDINESSLIHFAAEE---------------------------------GKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCL 1801
            +   N +  +  A + GN   ++++   + +       T +  + LH A     +  V  LL     +       + P+H+AAQ + VE V+ L + +   +D V +   TALH+A   GH  + + LL   A+ N    +  + LH   +KN ++++++L+ Y A +   + +G TP+ +AA  GH+ ++  LL+     NG   D  N   I G + +  A +    EV++  L NGA ++ +  + +T  H ++  G  E+ +L+       +    +G TPLH +     L     LLE GA  + + +   TP+ V     ++   + ++ K+L+   +      +   T  H      N K    L+   +          ++ Y  +PLH AAK   ++I  VLL+ GA+     +     +HLA++EG+ ++  LL+    +IN+ T+     +  + +H AA+E                                 G  ++  FL++ G    AK   G   L  +A+ GN  I+  +L++   PN      NTAL  A   G++ V+  L
Sbjct:  269 FTARNGITPLHVASKRGNTNMVRLL---LDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKA-PVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQ-----NGASPDVSN---IRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHV-----VSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASP----HTTAKNGY--TPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTK-----SGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 5 Score: 144.05 bits (362), Expect = 2.438e-34
Identity = 132/511 (25.83%), Postives = 232/511 (45.40%), Query Frame = 2
Query:  299 SLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESD-----KISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGA 1816
            + LH +    Q +VV  L+    D+N        P+++AAQ N +++V  L +    Q  A +  G T L IA ++GH+ +V  L         LE+D     ++  LH  ARK+D +   +LL       ++S +G TP+ IAA  G++ V   LL +  A +            +G + +  A +  N  ++++ L  G+ I+ K  DG T  H +A +G     E++  +   +    ++G +PLH A     +  V  LL+  A V+     + T + VA         +Y + K+L+   +N   R     T  H   ++  +K ++ L++  +     Q +    L   +P+H AA +G + I  +LL+ GA P +       ++H+A + G   VV+ LL  N      R   + + +H A+  GK EI + L++      A    G   L +SA+ G ++    +L+   + +L  +K  T LH  +  G L+V K L +  A
Sbjct:  115 TALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATE-DGFTPLAIALQQGHNQVVSIL---------LENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR--------NGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHC-----GHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGAS---IQAVTESGL---TPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLR-NGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQA 595          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Planmine SMEST
Match: SMESG000014208.1 (SMESG000014208.1)

HSP 1 Score: 1462.2 bits (3784), Expect = 0.000e+0
Identity = 713/722 (98.75%), Postives = 715/722 (99.03%), Query Frame = 2
Query:   47 MSLNNKISPPPNYANHSNVTIAIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKK 2212
            MSLNNKISPPPNY N SNVTI IKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCL+CLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA YNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAEND+LAIHLATKEGNL VVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVE ILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK KK
Sbjct:    1 MSLNNKISPPPNYTNRSNVTIPIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLQCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAAYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDYLAIHLATKEGNLKVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVECILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKDKK 722          

HSP 2 Score: 238.81 bits (608), Expect = 1.389e-64
Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 2
Query: 2759 QAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK 3103
            QAPF DILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK
Sbjct: 1068 QAPFSDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK 1182          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Planmine SMEST
Match: SMESG000014208.1 (SMESG000014208.1)

HSP 1 Score: 1457.2 bits (3771), Expect = 0.000e+0
Identity = 711/719 (98.89%), Postives = 713/719 (99.17%), Query Frame = 2
Query:   47 MSLNNKISPPPNYANHSNVTIAIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK 2203
            MSLNNKISPPPNY N SNVTI IKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCL+CLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA YNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAEND+LAIHLATKEGNL VVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVE ILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK
Sbjct:    1 MSLNNKISPPPNYTNRSNVTIPIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLQCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAAYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDYLAIHLATKEGNLKVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVECILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK 719          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Planmine SMEST
Match: SMESG000014208.1 (SMESG000014208.1)

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 707/722 (97.92%), Postives = 709/722 (98.20%), Query Frame = 2
Query:   47 MSLNNKISPPPNYANHSNVTIAIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKK 2212
            MSLNNKISPPPNY N SNVTI IKSSLQFPSEVISAKFQKFYDESNQVMQ      HGNVEYLKMVPKDVWKNCL+CLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYA YNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAEND+LAIHLATKEGNL VVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVE ILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK KK
Sbjct:    1 MSLNNKISPPPNYTNRSNVTIPIKSSLQFPSEVISAKFQKFYDESNQVMQ------HGNVEYLKMVPKDVWKNCLQCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAAYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDYLAIHLATKEGNLKVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVECILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKDKK 716          

HSP 2 Score: 238.81 bits (608), Expect = 1.261e-64
Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 2
Query: 2759 QAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK 3103
            QAPF DILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK
Sbjct: 1062 QAPFSDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIERPKEKRQK 1176          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Planmine SMEST
Match: SMESG000078033.1 (SMESG000078033.1)

HSP 1 Score: 959.133 bits (2478), Expect = 0.000e+0
Identity = 503/1011 (49.75%), Postives = 707/1011 (69.93%), Query Frame = 2
Query:   53 LNNKISPPPNYANHSNVTIAIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEF-VLKLNSAIYSLTLFRLGIIFIKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIYFVLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVIQRYFYDSEFIER 3082
            +NNK+    + A        IK   +F       K QK  D S Q  Q+F+AVQHG +++L+ VP  VW   L  +D  NNFSLLHYA  EN KD+V++LL FK DVN++G+  +RPIHLAAQ+  +EIVE+LCK ++  IDA DVKGQT LH ACRRGH N+V+ LL Y ASV KLE D ISV+HHP R+ND +M+K+L++Y +PL ++++NGQTP+M+AAIEGH ++ + LL ++K +  N+   LNEKD DG SC+S A+QN N E+++IC+ N  D++ K  DGKTIFH++A+ G+ ELF+LIE  S+ +N  D + NTP+H+A+ N +L +V  LL+ GA++N  NR FQTPIM+AC  +  + N  EIIK L  AN+NL I+D ++KT+FHYL+E+ NI+ ++Y  +T++ EIL +LIN QD    SPLH AAK+G+ EIC++LL+AGADP LF++ND LA+H+AT +G+L+ V +LLE + ET Y+RD NE+S I+ AAE G+YEIF+ L+++G D ++KDD+GRNTLM +AK G + IVE +L +++N NL+DQ K+TALH AA  GHL+++K L + GA+  +++F  +  D A+ N +  VV++FLN++NWKK M +RH+NG  HI+ LIKYNEEIT+ELLDKCI E  SN  D N EIK+WFG+LD+GPDD +S  +RY AL SM    +L+LLKHPLS +LLQ KW KFGL F L+D I+Y+L++I I+ Y+    P+ +TD+    +GC  + +  SS  LD+   V+ +NS IY++   +L ++ +KL ++R RFF + + + FI   + VF FIKN   +PCL EW FAP L+F  +   LY+++  P  GI+V MF +V  ++ K F  FF LF GFGF FYIIN  Q PF+      +KS+ M +GE + V+YF+T    Y+  +  +I+ F++ MP TFFNL IGLAVGDI ++ +EAELE  KLRV +VWE+E+ L    QR  Y SE  E 
Sbjct:    1 MNNKVKDSNHSAEFYATLNPIKQKKKFLPTNKVLKIQKLDDISYQTKQLFHAVQHGYLQFLQSVPLKVWAKRLNVIDEKNNFSLLHYACLENHKDIVSFLLIFKPDVNVIGANKIRPIHLAAQQGHMEIVELLCKYKSTHIDAADVKGQTPLHTACRRGHLNVVKILLKYQASVQKLELDSISVMHHPVRRNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQNDGKTIFHSAAIIGYSELFDLIETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANINVCNRHFQTPIMLACIEITQSRNTAEIIKTLNQANANLKIKDFEMKTIFHYLIEKENIEMLEYFTQTLNSEILLELINSQDDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIKGHLDCVIILLEASKETSYYRDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRNTLMFAAKSGCLPIVEDLLNDEVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGAKLSEDMFGSTQLDVAILNQQWHVVRFFLNNENWKKVMNFRHQNGHGHIKVLIKYNEEITLELLDKCIIENMSNVMDPNYEIKFWFGILDSGPDDKASISKRYLALKSMADCGQLDLLKHPLSEKLLQCKWNKFGLAFYLIDFIVYLLFLICINVYMSIYTPMTDTDSYTSYSGCKQTNSSVSSDKLDAPVGVVLMNSLIYAIITGQLLLLLLKLFSQRIRFFMEVWNYIFITNDILVFFFIKNPLQLPCLYEWQFAPGLIFVVWFLLLYYMRFFPYIGIQVMMFQKVLVSIIKAFAIFFGLFVGFGFGFYIINSSQDPFKTQGLGIIKSIAMMIGELEIVSYFVTGKKNYANVSYAMIVCFMIIMPITFFNLMIGLAVGDISNVNAEAELEMIKLRVNFVWEMESQLPVRWQRILYVSEITEH 1011          
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Planmine SMEST
Match: SMESG000078033.1 (SMESG000078033.1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 404/790 (51.14%), Postives = 569/790 (72.03%), Query Frame = 2
Query:   53 LNNKISPPPNYANHSNVTIAIKSSLQFPSEVISAKFQKFYDESNQVMQIFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVAYLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKGQTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIKILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTLNEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMTGFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVNTSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHYLVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICKVLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINESSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVEYILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQTSSGNLDSEF-VLKLNSAIYSL 2419
            +NNK+    + A        IK   +F       K QK  D S Q  Q+F+AVQHG +++L+ VP  VW   L  +D  NNFSLLHYA  EN KD+V++LL FK DVN++G+  +RPIHLAAQ+  +EIVE+LCK ++  IDA DVKGQT LH ACRRGH N+V+ LL Y ASV KLE D ISV+HHP R+ND +M+K+L++Y +PL ++++NGQTP+M+AAIEGH ++ + LL ++K +  N+   LNEKD DG SC+S A+QN N E+++IC+ N  D++ K  DGKTIFH++A+ G+ ELF+LIE  S+ +N  D + NTP+H+A+ N +L +V  LL+ GA++N  NR FQTPIM+AC  +  + N  EIIK L  AN+NL I+D ++KT+FHYL+E+ NI+ ++Y  +T++ EIL +LIN QD    SPLH AAK+G+ EIC++LL+AGADP LF++ND LA+H+AT +G+L+ V +LLE + ET Y+RD NE+S I+ AAE G+YEIF+ L+++G D ++KDD+GRNTLM +AK G + IVE +L +++N NL+DQ K+TALH AA  GHL+++K L + GA+  +++F  +  D A+ N +  VV++FLN++NWKK M +RH+NG  HI+ LIKYNEEIT+ELLDKCI E  SN  D N EIK+WFG+LD+GPDD +S  +RY AL SM    +L+LLKHPLS +LLQ KW KFGL F L+D I+Y+L++I I+ Y+    P+ +TD+    +GC  + +  SS  LD+   V+ +NS IY++
Sbjct:    1 MNNKVKDSNHSAEFYATLNPIKQKKKFLPTNKVLKIQKLDDISYQTKQLFHAVQHGYLQFLQSVPLKVWAKRLNVIDEKNNFSLLHYACLENHKDIVSFLLIFKPDVNVIGANKIRPIHLAAQQGHMEIVELLCKYKSTHIDAADVKGQTPLHTACRRGHLNVVKILLKYQASVQKLELDSISVMHHPVRRNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQNDGKTIFHSAAIIGYSELFDLIETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANINVCNRHFQTPIMLACIEITQSRNTAEIIKTLNQANANLKIKDFEMKTIFHYLIEKENIEMLEYFTQTLNSEILLELINSQDDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIKGHLDCVIILLEASKETSYYRDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRNTLMFAAKSGCLPIVEDLLNDEVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGAKLSEDMFGSTQLDVAILNQQWHVVRFFLNNENWKKVMNFRHQNGHGHIKVLIKYNEEITLELLDKCIIENMSNVMDPNYEIKFWFGILDSGPDDKASISKRYLALKSMADCGQLDLLKHPLSEKLLQCKWNKFGLAFYLIDFIVYLLFLICINVYMSIYTPMTDTDSYTSYSGCKQTNSSVSSDKLDAPVGVVLMNSLIYAI 790          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPA12.249e-6025.23transient receptor potential cation channel subfam... [more]
TRPA12.468e-5024.86transient receptor potential cation channel subfam... [more]
ANK17.489e-4726.59ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK17.642e-4726.59ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK19.820e-4726.59ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa-16.559e-5023.50Transient receptor potential cation channel subfam... [more]
trpa-18.465e-5023.50Transient receptor potential cation channel subfam... [more]
unc-443.448e-4226.32AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.448e-4226.32AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.518e-4225.22AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TrpA12.067e-4624.52gene:FBgn0035934 transcript:FBtr0331823[more]
TrpA12.447e-4624.52gene:FBgn0035934 transcript:FBtr0331825[more]
TrpA14.774e-4624.26gene:FBgn0035934 transcript:FBtr0331826[more]
TrpA15.186e-4624.26gene:FBgn0035934 transcript:FBtr0331824[more]
Ank1.245e-4227.85gene:FBgn0011747 transcript:FBtr0089172[more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1a2.444e-6426.05transient receptor potential cation channel, subfa... [more]
trpa1b1.587e-6325.38transient receptor potential cation channel, subfa... [more]
trpa1b1.587e-6325.38transient receptor potential cation channel, subfa... [more]
trpa1b1.189e-6025.33transient receptor potential cation channel, subfa... [more]
ank1b1.051e-4625.34ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa16.690e-6024.60transient receptor potential cation channel, subfa... [more]
trpa16.477e-5725.03transient receptor potential cation channel, subfa... [more]
trpa17.621e-5624.50transient receptor potential cation channel, subfa... [more]
trpa16.846e-5423.98transient receptor potential cation channel, subfa... [more]
trpa17.769e-5424.55transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpa11.202e-5624.93transient receptor potential cation channel, subfa... [more]
Trpa12.829e-5524.43transient receptor potential cation channel, subfa... [more]
Ank12.461e-4526.42ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank12.493e-4526.42ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank12.566e-4526.42ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75762|TRPA1_HUMAN1.080e-5925.23Transient receptor potential cation channel subfam... [more]
sp|Q6RI86|TRPA1_RAT4.789e-5724.73Transient receptor potential cation channel subfam... [more]
sp|Q8BLA8|TRPA1_MOUSE8.411e-5624.93Transient receptor potential cation channel subfam... [more]
sp|Q18297|TRPA1_CAEEL1.077e-4823.50Transient receptor potential cation channel subfam... [more]
sp|P16157|ANK1_HUMAN3.670e-4626.59Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FPG68.529e-13030.76ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267E8998.797e-13030.76ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267G9R91.948e-12830.14ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267H4S23.588e-12830.33ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267EGL53.897e-12830.14ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1a2.700e-6125.23transient receptor potential cation channel subfam... [more]
trpa1b6.908e-6126.38transient receptor potential cation channel subfam... [more]
trpa1b8.574e-6126.38transient receptor potential cation channel subfam... [more]
trpa1b8.574e-6126.38transient receptor potential cation channel subfam... [more]
trpa1a1.797e-4925.82transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.13.576e-4325.68pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.13.953e-4325.76pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007446.13.253e-3725.65pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000003991.19.358e-3625.00pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000009608.15.763e-3425.71pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR11.047e-927.45Palmitoyl transferase involved in protein palmitoy... [more]
PHO812.483e-926.86Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
NAS61.066e-727.78Evolutionarily conserved 19S regulatory particle a... [more]
MGA21.996e-735.87ER membrane protein involved in regulation of OLE1... [more]
HOS42.271e-732.32Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391131.494e-2039.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391121.497e-2027.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331804.420e-1627.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299747.706e-1524.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392892.430e-1425.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1b3.092e-5926.35transient receptor potential cation channel subfam... [more]
ank1b2.301e-4725.95ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a1.173e-4425.20ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000039458.12.165e-4126.33ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.12.371e-4126.33ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014208.11.389e-6498.75SMESG000014208.1[more]
SMESG000014208.10.000e+098.89SMESG000014208.1[more]
SMESG000014208.11.261e-6497.92SMESG000014208.1[more]
SMESG000078033.10.000e+049.75SMESG000078033.1[more]
SMESG000078033.10.000e+051.14SMESG000078033.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005315 ID=SMED30005315|Name=Transient receptor potential cation channel, subfamily A, member 1a|organism=Schmidtea mediterranea sexual|type=transcript|length=3121bp
AGAAACATAAATTGAGAACTTATATTAAAAGTTCATTCGCCAATAAATGA
GTTTGAACAATAAAATAAGTCCACCCCCCAATTATGCCAATCATTCCAAT
GTTACGATTGCAATTAAATCATCCCTTCAATTTCCGTCTGAAGTAATATC
TGCAAAGTTTCAAAAATTCTATGATGAATCCAATCAAGTTATGCAAATAT
TTTATGCTGTCCAGCATGGCAATGTTGAATATTTGAAAATGGTGCCAAAA
GATGTTTGGAAAAATTGTTTAAAATGTTTAGATACGGTCAACAATTTTTC
TTTGCTTCATTACGCCGTGAACGAGAATCAGAAAGATGTTGTGGCTTACT
TACTAACATTTAAAATAGACGTAAACATTATGGGTTCTAAAAATGTTCGA
CCGATTCACTTAGCTGCTCAAAGAAATCTAGTTGAAATAGTAGAAATTCT
CTGTAAAAAACGTACTCTACAAATAGATGCTGTTGATGTAAAGGGTCAAA
CTGCTTTACATATAGCTTGCAGAAGAGGACATTCGAATATGGTTGAAACA
CTGTTGAGTTATGGCGCTTCTGTCAATAAATTGGAATCTGACAAAATTTC
AGTATTGCATCATCCAGCCAGAAAAAACGATCTTGAAATGATCAAAATAC
TTTTGTCCTACAAAGCCCCGTTGATGATTAAAAGTAGCAATGGACAAACT
CCAGTAATGATTGCCGCTATCGAAGGTCACATCAAAGTGCTGAATTTTCT
ATTAGAAAAAATAAAAGCCGAAAATGGAAACGTTTCTGACACACTAAATG
AAAAAGATATAGATGGTAATTCTTGCATTTCATTTGCAATTCAAAATAGA
AATTTGGAAGTTTTACAGATCTGTTTACTGAACGGAGCCGATATAAACAA
TAAATTGGTTGATGGCAAGACAATATTCCACACCTCAGCTATGACTGGAT
TTGGGGAATTATTTGAACTTATTGAACCTAGAAGTTGGGATATAAATACT
GTTGACAGAGATGGGAATACTCCACTTCATTATGCAGTTTATAATACTGA
TCTAAATATTGTCATTCAGTTGCTAGAAATCGGAGCTGATGTCAATACCT
CCAACCGCTTGTTCCAGACCCCAATTATGGTTGCTTGTTCATCTTTACTG
AATACCGACAATAATTACGAAATTATTAAAATTCTTGTTTCAGCAAATTC
AAATTTGCTAATTCGTGACGAGAAGTTGAAAACTGTTTTTCATTACCTGG
TGGAAAGAATAAATATTAAAACTATTAAATATTTGATTAGAACAATTTCT
GGAGAAATATTATTTCAATTAATCAATTTACAAGATTTATATTTTAAAAG
TCCGCTTCATTATGCGGCAAAACTTGGAGATATCGAAATTTGTAAAGTTT
TACTAGAAGCTGGTGCTGATCCTAAACTTTTTGCGGAAAACGATCATTTG
GCGATACATCTAGCTACTAAAGAAGGAAATTTGAACGTTGTAAAATTATT
GTTGGAAATAAATATGGAAACAAGATATTTTAGAGATATCAACGAAAGCT
CATTAATTCATTTTGCAGCCGAAGAAGGAAAATATGAAATTTTTAGATTT
TTAATCGAAGTCGGAATCGACTGCTTAGCAAAGGATGATTACGGCAGAAA
TACTTTAATGTTATCGGCCAAAGGGGGCAATATAGATATTGTAGAATACA
TTTTAAAAAATAAAATAAATCCAAATTTATTTGATCAAAAGAAAAATACT
GCGTTGCATTTCGCAGCTTCTGGAGGTCATTTAGAAGTCATTAAGTGCTT
ATGCCGTCACGGTGCAAGGTTTCAAGATAATTTATTTAATCTCTCTCCAT
TTGATGAAGCTCTTGCGAATAGCCGAAAGGACGTGGTCAAATATTTCTTA
AACGATGACAATTGGAAAAAAACTATGGAATACCGACATGAAAACGGGAA
AAGCCATATCGAGTCTTTGATTAAGTACAATGAAGAAATAACAATTGAAC
TTCTCGATAAATGCATAACAGAAATTCCATCAAACAAATCTGATCAAAAT
AATGAAATCAAATATTGGTTTGGACTACTAGATGCTGGCCCAGATGATCC
ATCAAGTTCCGGGCAACGTTATTATGCATTAATGAGCATGGTTACTTTTA
AAAAACTAAATCTTCTGAAACATCCTTTATCTACAAGATTACTGCAAAGG
AAATGGAAAAAATTTGGACTTGGATTTCTTTTAGTCGATTTGATTCTATA
TATTTTATATATTATAGCTATTTCTTTTTATATTTTTGCAATTCCTCCAA
TTAAGAATACTGATACGGTGAATGAAACAACGGGATGTGTAATTTCTGCC
AATCAAACGTCATCGGGAAATTTAGATTCAGAATTTGTATTAAAACTAAA
TTCTGCAATTTATTCCTTAACTTTATTTCGACTAGGAATAATATTTATCA
AATTGTTGACTGAAAGATCTAGATTTTTCCAGGATCAATACTGTTTTTCG
TTTATTTTTTGCGCTTTATACGTATTTTTGTTCATTAAAAATCTCCGAAA
CATTCCTTGTTTAAATGAATGGACATTTGCTCCGATGCTCTTATTTCAGT
CTTATTCCTACTTTCTTTATTTTATACAACATCTTCCATCAGAAGGAATA
AAGGTGTTCATGTTTTGGAGAGTTTTTAAGACGTTGACAAAAGTATTTTT
AACATTTTTTTGTCTCTTTTTTGGATTTGGATTTGCCTTCTATATTATTA
ACAGAGATCAGGCTCCATTCAGGGATATCTTAGATTCGAGTCTGAAAAGT
ATGGTAATGACAATGGGTGAATTTGATTATGTTAATTATTTTATAACGAG
CCCTACAAAATACAGTTTAGCAGCTCCGATTCTGATTATATATTTTGTCT
TATTTATGCCCACAACATTTTTTAATTTAACAATCGGGTTAGCTGTTGGT
GATATAGATTCCATGATTTCTGAGGCTGAACTGGAATTTTACAAGTTGAG
AGTCGAATATGTCTGGGAGGTCGAAACCAACCTTTTAAAAGTTATTCAGA
GATATTTTTATGATTCTGAATTTATTGAGAGGCCTAAAGAAAAGAGACAA
AAGTAAATAAGCGGAAGTCTA
back to top

protein sequence of SMED30005315-orf-1

>SMED30005315-orf-1 ID=SMED30005315-orf-1|Name=SMED30005315-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1020bp
MSLNNKISPPPNYANHSNVTIAIKSSLQFPSEVISAKFQKFYDESNQVMQ
IFYAVQHGNVEYLKMVPKDVWKNCLKCLDTVNNFSLLHYAVNENQKDVVA
YLLTFKIDVNIMGSKNVRPIHLAAQRNLVEIVEILCKKRTLQIDAVDVKG
QTALHIACRRGHSNMVETLLSYGASVNKLESDKISVLHHPARKNDLEMIK
ILLSYKAPLMIKSSNGQTPVMIAAIEGHIKVLNFLLEKIKAENGNVSDTL
NEKDIDGNSCISFAIQNRNLEVLQICLLNGADINNKLVDGKTIFHTSAMT
GFGELFELIEPRSWDINTVDRDGNTPLHYAVYNTDLNIVIQLLEIGADVN
TSNRLFQTPIMVACSSLLNTDNNYEIIKILVSANSNLLIRDEKLKTVFHY
LVERINIKTIKYLIRTISGEILFQLINLQDLYFKSPLHYAAKLGDIEICK
VLLEAGADPKLFAENDHLAIHLATKEGNLNVVKLLLEINMETRYFRDINE
SSLIHFAAEEGKYEIFRFLIEVGIDCLAKDDYGRNTLMLSAKGGNIDIVE
YILKNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLS
PFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITI
ELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVT
FKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDLILYILYIIAISFYIFAIP
PIKNTDTVNETTGCVISANQTSSGNLDSEFVLKLNSAIYSLTLFRLGIIF
IKLLTERSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLF
QSYSYFLYFIQHLPSEGIKVFMFWRVFKTLTKVFLTFFCLFFGFGFAFYI
INRDQAPFRDILDSSLKSMVMTMGEFDYVNYFITSPTKYSLAAPILIIYF
VLFMPTTFFNLTIGLAVGDIDSMISEAELEFYKLRVEYVWEVETNLLKVI
QRYFYDSEFIERPKEKRQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 338..352
score: 41.57
coord: 150..165
score: 39.84
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 432..461
e-value: 7.0E-5
score: 32.2
coord: 499..528
e-value: 1.1
score: 18.3
coord: 393..423
e-value: 60.0
score: 12.5
coord: 597..627
e-value: 600.0
score: 6.7
coord: 322..351
e-value: 2.2E-6
score: 37.2
coord: 355..389
e-value: 1.5
score: 17.8
coord: 532..561
e-value: 0.0032
score: 26.7
coord: 82..111
e-value: 0.002
score: 27.4
coord: 256..285
e-value: 0.048
score: 22.8
coord: 289..318
e-value: 790.0
score: 5.8
coord: 182..211
e-value: 19.0
score: 14.2
coord: 149..178
e-value: 3.4E-7
score: 39.9
coord: 115..145
e-value: 170.0
score: 10.7
coord: 565..594
e-value: 4.5E-4
score: 29.5
coord: 215..248
e-value: 0.048
score: 22.8
coord: 465..494
e-value: 0.67
score: 19.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 499..531
score: 9.992
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 465..497
score: 8.576
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 149..181
score: 14.158
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 532..564
score: 8.656
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 432..464
score: 11.621
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 215..238
score: 9.351
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 322..354
score: 14.8
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 82..114
score: 9.19
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 565..590
score: 9.671
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 369..492
e-value: 1.6E-22
score: 81.9
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 64..243
e-value: 2.1E-44
score: 153.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 493..683
e-value: 2.8E-30
score: 107.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 244..368
e-value: 3.4E-25
score: 90.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 425..619
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 80..415
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 263..352
e-value: 1.1E-11
score: 45.1
coord: 537..620
e-value: 7.6E-10
score: 39.3
coord: 183..240
e-value: 3.5E-8
score: 33.9
coord: 87..178
e-value: 1.2E-16
score: 61.0
coord: 437..530
e-value: 7.5E-15
score: 55.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 82..590
score: 104.047
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 249..620
coord: 78..274
coord: 182..488
NoneNo IPR availableTMHMMTMhelixcoord: 945..967
NoneNo IPR availableTMHMMTMhelixcoord: 842..859
NoneNo IPR availableTMHMMTMhelixcoord: 815..837
NoneNo IPR availableTMHMMTMhelixcoord: 727..749
NoneNo IPR availableTMHMMTMhelixcoord: 880..902