CCHC-type domain-containing protein

Overview
NameCCHC-type domain-containing protein
Smed IDSMED30005298
Length (bp)1261
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCHC-type domain-containing protein (SMED30005298) t-SNE clustered cells

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30005298) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CCHC-type domain-containing protein (SMED30005298) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30005298) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005298

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30005298SMESG000007097.1 dd_Smed_v4_7965_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005298SMESG000007097.1 dd_Smed_v4_7965_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005298SMESG000007097.1 dd_Smed_v4_7965_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: TUT7 (terminal uridylyl transferase 7 [Source:HGNC Symbol;Acc:HGNC:25817])

HSP 1 Score: 148.673 bits (374), Expect = 2.990e-38
Identity = 92/292 (31.51%), Postives = 159/292 (54.45%), Query Frame = 1
Query:  247 EQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRPRP-KNNCEMWHYSDI----TNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            E ++R+    ++E+ I + F    + L+GS   G   + SDLD+ +  +  ++ E L+ +   R ++ +   L + +    I  + +A++PI++    +  L VDIS  NT+A+ NT ++  YS +DPRV  L   +K    + +IGDA  G+LSS+ YTLM+++FLQ+RN  V+P+L  +  Y   K+P    +   ++ +  I    T  +       S+ +LW+   ++YT EFDF+  V+SIR+K  L    K W  K I IEDP ++ + +GA + +     I+ AF
Sbjct:  307 EDQAREHIRQNLESFIRQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCV---RTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVL--QEIYKGEKKPEIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAF 593          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: TUT7 (terminal uridylyl transferase 7 [Source:HGNC Symbol;Acc:HGNC:25817])

HSP 1 Score: 148.673 bits (374), Expect = 4.502e-38
Identity = 92/292 (31.51%), Postives = 159/292 (54.45%), Query Frame = 1
Query:  247 EQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRPRP-KNNCEMWHYSDI----TNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            E ++R+    ++E+ I + F    + L+GS   G   + SDLD+ +  +  ++ E L+ +   R ++ +   L + +    I  + +A++PI++    +  L VDIS  NT+A+ NT ++  YS +DPRV  L   +K    + +IGDA  G+LSS+ YTLM+++FLQ+RN  V+P+L +   Y   K+P    +   ++ +  I    T  +       S+ +LW+   ++YT EFDF+  V+SIR+K  L    K W  K I IEDP ++ + +GA + +     I+ AF
Sbjct: 1018 EDQAREHIRQNLESFIRQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCV---RTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQE--IYKGEKKPEIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAF 1304          

HSP 2 Score: 90.5077 bits (223), Expect = 9.358e-19
Identity = 72/306 (23.53%), Postives = 137/306 (44.77%), Query Frame = 1
Query:  280 IENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILP----------DRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERS------------------------ITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKIL 1089
            +EN    K  +  + LYGS  + L  +NSD++I + F    +I     ++Q  +L  ++  L   + F +++  + AR+P++ C+ K++ L   +SA N  A   T+ +     ++P++  L    ++   L  I     G L  + + LM I FLQ+R   P+LP             K  +      + +  +W ++D    +   + E +                        + +LW++  ++Y +EF+    V+SIR K+ + +  K+W  K IAIEDP ++   +   +  Q  F+ IL
Sbjct:  323 MENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQF---PAI-----MSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQSGLLCKVSAGNENACLTTKHLTALGKLEPKLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAIFFLQQRKE-PLLPVYLGSWIEGFSLSKLGNFNLQDIEKDVVIWEHTDSAAGDTGITKEEAPRETPIKRGQVSLILDVKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELVSRELKDWPKKRIAIEDPYSVKRNVARTLNSQPVFEYIL 619          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: TUT4 (terminal uridylyl transferase 4 [Source:HGNC Symbol;Acc:HGNC:28981])

HSP 1 Score: 148.288 bits (373), Expect = 6.160e-38
Identity = 98/294 (33.33%), Postives = 162/294 (55.10%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKF-YNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH--YSDITN--MNNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ +R++    +E  I +++     + L+GS   G   R+SDLDI +     ++ E LN    K +++ +   L +      I  + +A++PI++ + +++ L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D K+  P+   + W+  + D T        SL +   S+ ELW+   ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  896 SEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNC---KEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKP-PVIPVLQEIFDGKQ-IPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1184          

HSP 2 Score: 95.9005 bits (237), Expect = 1.750e-20
Identity = 69/287 (24.04%), Postives = 138/287 (48.08%), Query Frame = 1
Query:  208 LLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLER-SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            ++E    + I+  + R RQ+   ++   I        + LYGS +T  A ++SD++I + F  + +  DL        L ++   L +   + ++E  + A++P++ C+ +K+ L   +SA N +A   T+++     ++P    L    ++   L  I     G + S+ + LM++ FLQ+R   P+LP                C +  +S +      ++  R S+ +LW++  K+YT++F  E  V+ +R +  L +  KNW  + IAIEDP ++   +  ++
Sbjct:  359 VIELAKEHGITDDDLRVRQEIVEEMSKVITTFLPECSLRLYGSSLTRFALKSSDVNIDIKFPPKMNHPDL--------LIKVLGILKKNVLYVDVESDFHAKVPVVVCRDRKSGLLCRVSAGNDMACLTTDLLTALGKIEPVFIPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKP-PLLP----------------CLLGSWSPLA----LETPNRVSLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSL 616          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: TUT4 (terminal uridylyl transferase 4 [Source:HGNC Symbol;Acc:HGNC:28981])

HSP 1 Score: 146.747 bits (369), Expect = 1.752e-37
Identity = 98/294 (33.33%), Postives = 162/294 (55.10%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKF-YNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH--YSDITN--MNNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ +R++    +E  I +++     + L+GS   G   R+SDLDI +     ++ E LN    K +++ +   L +      I  + +A++PI++ + +++ L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D K+  P+   + W+  + D T        SL +   S+ ELW+   ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  967 SEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNC---KEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKP-PVIPVLQEIFDGKQ-IPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1255          

HSP 2 Score: 83.1889 bits (204), Expect = 2.916e-16
Identity = 77/340 (22.65%), Postives = 150/340 (44.12%), Query Frame = 1
Query:  208 LLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDR------PKYSDN---------------------------------KRPRPKNNCEMWHYSDITNMNNAQ---------SLER----SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            ++E    + I+  + R RQ+   ++   I        + LYGS +T  A ++SD++I + F  + +  DL        L ++   L +   + ++E  + A++P++ C+ +K+ L   +SA N +A   T+++     ++P    L    ++   L  I     G + S+ + LM++ FLQ+R   +LP L         PK  D+                                 K  +PK++ +    ++  N +NA          +LE     S+ +LW++  K+YT++F  E  V+ +R +  L +  KNW  + IAIEDP ++   +  ++
Sbjct:  359 VIELAKEHGITDDDLRVRQEIVEEMSKVITTFLPECSLRLYGSSLTRFALKSSDVNIDIKFPPKMNHPDL--------LIKVLGILKKNVLYVDVESDFHAKVPVVVCRDRKSGLLCRVSAGNDMACLTTDLLTALGKIEPVFIPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKPPLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWECNSSSATEKNSIAEENKAKADQPKDDTKK---TETDNQSNAMKEKHGKSPLALETPNRVSLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSL 687          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: TUT4 (terminal uridylyl transferase 4 [Source:HGNC Symbol;Acc:HGNC:28981])

HSP 1 Score: 146.747 bits (369), Expect = 1.753e-37
Identity = 98/294 (33.33%), Postives = 162/294 (55.10%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKF-YNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH--YSDITN--MNNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ +R++    +E  I +++     + L+GS   G   R+SDLDI +     ++ E LN    K +++ +   L +      I  + +A++PI++ + +++ L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D K+  P+   + W+  + D T        SL +   S+ ELW+   ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  967 SEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNC---KEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKP-PVIPVLQEIFDGKQ-IPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1255          

HSP 2 Score: 83.1889 bits (204), Expect = 2.916e-16
Identity = 77/340 (22.65%), Postives = 150/340 (44.12%), Query Frame = 1
Query:  208 LLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDR------PKYSDN---------------------------------KRPRPKNNCEMWHYSDITNMNNAQ---------SLER----SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            ++E    + I+  + R RQ+   ++   I        + LYGS +T  A ++SD++I + F  + +  DL        L ++   L +   + ++E  + A++P++ C+ +K+ L   +SA N +A   T+++     ++P    L    ++   L  I     G + S+ + LM++ FLQ+R   +LP L         PK  D+                                 K  +PK++ +    ++  N +NA          +LE     S+ +LW++  K+YT++F  E  V+ +R +  L +  KNW  + IAIEDP ++   +  ++
Sbjct:  359 VIELAKEHGITDDDLRVRQEIVEEMSKVITTFLPECSLRLYGSSLTRFALKSSDVNIDIKFPPKMNHPDL--------LIKVLGILKKNVLYVDVESDFHAKVPVVVCRDRKSGLLCRVSAGNDMACLTTDLLTALGKIEPVFIPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKPPLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWECNSSSATEKNSIAEENKAKADQPKDDTKK---TETDNQSNAMKEKHGKSPLALETPNRVSLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSL 687          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: cid-1 (Caffeine Induced Death (S. pombe Cid) homolog [Source:UniProtKB/TrEMBL;Acc:Q09409])

HSP 1 Score: 105.531 bits (262), Expect = 4.692e-24
Identity = 85/280 (30.36%), Postives = 148/280 (52.86%), Query Frame = 1
Query:  301 KFYNVDVYL--YGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN----LRVDISASNTIAIDNTEIVREYSDMDP--RVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPK--YSDNKRPRPKNNCEMWHYS----DITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            K Y  DV L  +GS +TGL+   SD+DI + F +        ++T K ++++ E+ L + +    ++ + +A++PI++ + K +    + VDIS  N +AI NT +++EYS   P  R + L   +K      EIGDA  G+LSS+ + +MLI +LQ  +  P+LP   +   SDN+  R  +N   W  S    + + +      + S  +L I +F YY+  FDF   VV  R++  L K  K W  + + +EDP ++++ + + + +  F  I+  F
Sbjct: 1043 KNYREDVTLTTFGSVMTGLSVNCSDIDICLRFGDGDVPP--KDLTAKEVIQKTESVLRKCHLVKRVQAIVTAKVPIVKFQVKLSNGAIIDVDISYYNILAIYNTALLKEYSLWTPDKRFAKLALFVKTWAKNCEIGDASRGSLSSYCHVIMLISYLQNCDP-PVLPRLQEDFRSDNRERRLVDN---WDTSFAQVETSLLQRWPKNKESCAQLLIGYFDYYS-RFDFRNFVVQCRREMILSKMEKEWP-RPLCVEDPFDLSHNLSSGVNKKMFVFIMKVF 1314          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: pup-2 (Poly(U) Polymerase [Source:UniProtKB/TrEMBL;Acc:Q09408])

HSP 1 Score: 98.9821 bits (245), Expect = 3.444e-22
Identity = 67/259 (25.87%), Postives = 124/259 (47.88%), Query Frame = 1
Query:  325 LYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKK-NLRVDISASNTIAIDNTEIVREYSDMDP-RVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPR---PKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKI 1086
            +YGS   G   R  D+D+++ F         N+    R+++ +   L+   K  + E   +A++PI+R ++   ++  DIS  N +A+ NT+++++Y   DP R+  LG  +K       +GDA  G+LSS+ + +MLIH+LQ+   +P+LP   + +  K         N   W + D       ++   S+ +L++ F  YY   FD+   V+ +  K+   K  + W    + I DP    + +   +    F+ I
Sbjct:  171 IYGSTRNGFGTRFCDVDMSLSFSPSPPSWATNS---DRVMRAVAKALVDFPKAVD-ERYVNAKVPIVRFRSSDMDMEADISYKNDLALHNTQLLQQYCKWDPERLPTLGVWVKAWAKRSGVGDASKGSLSSYAWIVMLIHYLQQVEPIPVLPCLQEMNHQKSENVYVQGYNTYYWKFVDTARTRRCRA---SVVDLFVGFLDYYATYFDYSTNVIQMVSKKLEFKPDR-WCKYPMCIADPFETDHNLAQGVDMPMFEYI 421          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: gld-2 (Poly(A) RNA polymerase gld-2 [Source:UniProtKB/Swiss-Prot;Acc:O17087])

HSP 1 Score: 89.3521 bits (220), Expect = 8.744e-19
Identity = 67/222 (30.18%), Postives = 113/222 (50.90%), Query Frame = 1
Query:  319 VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIR---CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDR-PKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQ 966
            +Y+ GS + G  + +SD+D+ ++  N+    DL+      ++  +    LQ  KF E + +  A++PI+R        ++ VD++A+N++AI NT ++  YS  D RV  L  ++K       I DA   + +S+   LM+IHFLQ     VLP L    P    NK      N  M       +++ + S + ++ EL I F  YY  EF+++ + +SIRQ
Sbjct:  513 LYVVGSSLNGFGNNSSDMDLCLMITNK----DLDQKNDAVVVLNLILSTLQYEKFVESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSYSLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDRDAISIRQ 730          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: gld-2 (Poly(A) RNA polymerase gld-2 [Source:UniProtKB/Swiss-Prot;Acc:O17087])

HSP 1 Score: 88.9669 bits (219), Expect = 8.993e-19
Identity = 69/232 (29.74%), Postives = 115/232 (49.57%), Query Frame = 1
Query:  289 CIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIR---CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDR-PKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQ 966
             I   F    +Y+ GS + G  + +SD+D+ ++  N+    DL+      ++  +    LQ  KF E + +  A++PI+R        ++ VD++A+N++AI NT ++  YS  D RV  L  ++K       I DA   + +S+   LM+IHFLQ     VLP L    P    NK      N  M       +++ + S + ++ EL I F  YY  EF+++ + +SIRQ
Sbjct:  274 AISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNK----DLDQKNDAVVVLNLILSTLQYEKFVESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSYSLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDRDAISIRQ 501          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: gld-2 (Poly(A) RNA polymerase gld-2 [Source:UniProtKB/Swiss-Prot;Acc:O17087])

HSP 1 Score: 88.9669 bits (219), Expect = 9.361e-19
Identity = 67/222 (30.18%), Postives = 113/222 (50.90%), Query Frame = 1
Query:  319 VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIR---CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDR-PKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQ 966
            +Y+ GS + G  + +SD+D+ ++  N+    DL+      ++  +    LQ  KF E + +  A++PI+R        ++ VD++A+N++AI NT ++  YS  D RV  L  ++K       I DA   + +S+   LM+IHFLQ     VLP L    P    NK      N  M       +++ + S + ++ EL I F  YY  EF+++ + +SIRQ
Sbjct:  348 LYVVGSSLNGFGNNSSDMDLCLMITNK----DLDQKNDAVVVLNLILSTLQYEKFVESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSYSLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDRDAISIRQ 565          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: wisp (gene:FBgn0260780 transcript:FBtr0073573)

HSP 1 Score: 82.8037 bits (203), Expect = 1.561e-16
Identity = 81/293 (27.65%), Postives = 137/293 (46.76%), Query Frame = 1
Query:  304 FYNVDVYLYGSHVTGLAHRNSDLDITVL-----------------FHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLE-RSITELWIDFFKYYTMEFDFEVEVVSIRQKQPL-------LKSTKNWIF--KVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            F    + L GS +TG    +SD+D+ +L                 FHN K  E L  +T       + N +L+  +  +   +  AR+PI+R K   N + VD++ +N + I NT +++ Y+ MD R   L  ++K     ++I DA+  T+SS+   LM++H+LQ   V  +LP        K    + +C       I  +   Q+L  +++ E  + FFKYY+  FDF    +SIR    L        KS KN ++  K + IE+P +++N   +      F+++   F
Sbjct: 1008 FERYRICLVGSTITGFGTDSSDIDMCLLPEQGVHPHQHQYHQHHHFHNEKRTEALIILT-------LFNAVLKDTEVFQDFNLIEARVPILRFKDISNGIEVDLNFNNCVGIKNTYLLQLYAQMDWRTRPLVVIVKLWAQYHDINDAKRMTISSYSLVLMVLHYLQHACVPHVLPCLHSLYPEKFQLGQQDC--LDLDLIEPIEPYQALNTQTLGEHLLGFFKYYST-FDFRNFAISIRTGGVLPVSTCRMAKSPKNDVYQWKELNIEEPFDLSNTARSVYDGPTFERVKAVF 1290          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: wisp (gene:FBgn0260780 transcript:FBtr0342743)

HSP 1 Score: 82.8037 bits (203), Expect = 1.561e-16
Identity = 81/293 (27.65%), Postives = 137/293 (46.76%), Query Frame = 1
Query:  304 FYNVDVYLYGSHVTGLAHRNSDLDITVL-----------------FHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLE-RSITELWIDFFKYYTMEFDFEVEVVSIRQKQPL-------LKSTKNWIF--KVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            F    + L GS +TG    +SD+D+ +L                 FHN K  E L  +T       + N +L+  +  +   +  AR+PI+R K   N + VD++ +N + I NT +++ Y+ MD R   L  ++K     ++I DA+  T+SS+   LM++H+LQ   V  +LP        K    + +C       I  +   Q+L  +++ E  + FFKYY+  FDF    +SIR    L        KS KN ++  K + IE+P +++N   +      F+++   F
Sbjct: 1008 FERYRICLVGSTITGFGTDSSDIDMCLLPEQGVHPHQHQYHQHHHFHNEKRTEALIILT-------LFNAVLKDTEVFQDFNLIEARVPILRFKDISNGIEVDLNFNNCVGIKNTYLLQLYAQMDWRTRPLVVIVKLWAQYHDINDAKRMTISSYSLVLMVLHYLQHACVPHVLPCLHSLYPEKFQLGQQDC--LDLDLIEPIEPYQALNTQTLGEHLLGFFKYYST-FDFRNFAISIRTGGVLPVSTCRMAKSPKNDVYQWKELNIEEPFDLSNTARSVYDGPTFERVKAVF 1290          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: wisp (gene:FBgn0260780 transcript:FBtr0342742)

HSP 1 Score: 82.8037 bits (203), Expect = 1.575e-16
Identity = 81/293 (27.65%), Postives = 137/293 (46.76%), Query Frame = 1
Query:  304 FYNVDVYLYGSHVTGLAHRNSDLDITVL-----------------FHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLE-RSITELWIDFFKYYTMEFDFEVEVVSIRQKQPL-------LKSTKNWIF--KVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            F    + L GS +TG    +SD+D+ +L                 FHN K  E L  +T       + N +L+  +  +   +  AR+PI+R K   N + VD++ +N + I NT +++ Y+ MD R   L  ++K     ++I DA+  T+SS+   LM++H+LQ   V  +LP        K    + +C       I  +   Q+L  +++ E  + FFKYY+  FDF    +SIR    L        KS KN ++  K + IE+P +++N   +      F+++   F
Sbjct: 1007 FERYRICLVGSTITGFGTDSSDIDMCLLPEQGVHPHQHQYHQHHHFHNEKRTEALIILT-------LFNAVLKDTEVFQDFNLIEARVPILRFKDISNGIEVDLNFNNCVGIKNTYLLQLYAQMDWRTRPLVVIVKLWAQYHDINDAKRMTISSYSLVLMVLHYLQHACVPHVLPCLHSLYPEKFQLGQQDC--LDLDLIEPIEPYQALNTQTLGEHLLGFFKYYST-FDFRNFAISIRTGGVLPVSTCRMAKSPKNDVYQWKELNIEEPFDLSNTARSVYDGPTFERVKAVF 1289          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: Gld2 (gene:FBgn0038934 transcript:FBtr0305038)

HSP 1 Score: 81.6481 bits (200), Expect = 3.578e-16
Identity = 74/275 (26.91%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  319 VYLYGSHVTGLAHRNSDLDITVLFHNRKSIED-LNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNK----RPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPL-------LKSTKNWI--FKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            +YL GS ++    + SD+DI +L     +I+  +  +    ++K +         F  IE    AR+PI+R   +   + VDI+ +N++ I NT ++  YS +D RV  +   +K     + I +A++ T+SS+   LM+IHFLQ     P+LP        K    +P      +M         +N+Q+L     +L + F  YY++ FD+    +SIR    L         + KN I  +  + IE+P + TN   +    + F++I   F
Sbjct:  977 LYLVGSSISYFGSKCSDMDICMLACTNPNIDSRMEAVYHLHVMKELLGRTNMFQDFNLIE----ARVPILRFTDRCHKVEVDINFNNSVGIRNTHLLYCYSQLDWRVRPMALTVKQWAQYHNINNAKNMTISSYSLMLMVIHFLQVGASPPVLPCLHNLYPEKFGLLQPNDFGYVDMNEVMAPYQSDNSQTL----GDLLLSFLHYYSV-FDYGKYAISIRVGGVLPIEVCRAATAPKNDIHQWNELCIEEPFDQTNTARSVYDTDTFERIKTIF 1242          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: Gld2 (gene:FBgn0038934 transcript:FBtr0310204)

HSP 1 Score: 81.6481 bits (200), Expect = 3.578e-16
Identity = 74/275 (26.91%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  319 VYLYGSHVTGLAHRNSDLDITVLFHNRKSIED-LNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNK----RPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPL-------LKSTKNWI--FKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            +YL GS ++    + SD+DI +L     +I+  +  +    ++K +         F  IE    AR+PI+R   +   + VDI+ +N++ I NT ++  YS +D RV  +   +K     + I +A++ T+SS+   LM+IHFLQ     P+LP        K    +P      +M         +N+Q+L     +L + F  YY++ FD+    +SIR    L         + KN I  +  + IE+P + TN   +    + F++I   F
Sbjct:  977 LYLVGSSISYFGSKCSDMDICMLACTNPNIDSRMEAVYHLHVMKELLGRTNMFQDFNLIE----ARVPILRFTDRCHKVEVDINFNNSVGIRNTHLLYCYSQLDWRVRPMALTVKQWAQYHNINNAKNMTISSYSLMLMVIHFLQVGASPPVLPCLHNLYPEKFGLLQPNDFGYVDMNEVMAPYQSDNSQTL----GDLLLSFLHYYSV-FDYGKYAISIRVGGVLPIEVCRAATAPKNDIHQWNELCIEEPFDQTNTARSVYDTDTFERIKTIF 1242          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01065131.1 (pep chromosome:GRCz11:23:42272588:42289293:1 gene:ENSDARG00000101404.2 transcript:ENSDART00000164907.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01065131.1)

HSP 1 Score: 134.035 bits (336), Expect = 1.117e-33
Identity = 92/306 (30.07%), Postives = 153/306 (50.00%), Query Frame = 1
Query:  313 VDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKK-NLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRP-RPKNNCEMWHYSDITNMN----NAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEISRKIHNQESKSFYRQCSTFANEF 1206
              + L+GS   G   R+SDLDI +      + E LN    K +++ +   L +      I  + +A++PI++ + ++  L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   V+P+L +   +  N  P R  +    + + D+  +            ++ ELW+   ++YT EFDF+  V+SIRQ++ L    K W +    + DP ++ + +GA + +     I+ AF         IN   RK+       FY Q  T A+ F
Sbjct:    3 AQLCLFGSSKNGFGFRDSDLDICMTLEGHDTAEKLNC---KEIIEGLAKVLKKHTGLRNILPITTAKVPIVKFEHRQSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRQPPVIPVLQE--IFDGNTTPQRMVDGWNAFFFDDLDELRRRLPELHQNRETVGELWLGLLRFYTEEFDFKEHVISIRQRKRLTTFEKQWTYFCFLLSDPFDLNHNLGAGVSRKMTNFIMKAF---------IN--GRKLFG---TPFYPQPGTEADYF 289          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: tent2 (terminal nucleotidyltransferase 2 [Source:NCBI gene;Acc:553626])

HSP 1 Score: 101.293 bits (251), Expect = 6.983e-23
Identity = 87/295 (29.49%), Postives = 149/295 (50.51%), Query Frame = 1
Query:  292 IDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILP-DRPKYSDNKRPRPKNNCEMWHY--SDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKS-TKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCE---VLLVRGNINEISRK 1146
            I + F    V+L GS + G   R+SD D+ ++          + +    +L  +   L +L+ + E   +  A++PI++ + +   +  D++ +NT+ I NT ++R Y+ ++ RV  L  ++K   N + I DA  GTLSS+   LM++H+LQ     V+P L  D P   D     PK +  +     SDI    +    + S+ +L++ F +YY   F ++ +V+S+R  + L KS  K W  K I +E+P N TN   A   +  F+ I  AF E   +L +R ++N I  K
Sbjct:  194 IQKIFPCAKVFLGGSSLNGFGSRSSDADLCLVIEEGPVNHRKDAVY---VLSLVRKLLYKLS-YIEKPQLIRAKVPIVKFRDRISGVEFDLNFNNTVGIRNTFLLRTYAFVEKRVRPLVLVIKKWANHHCINDASRGTLSSYTLVLMVLHYLQTLPEPVIPCLQRDYPTCFD-----PKMDIHLVPSGPSDIPAFVSRN--QSSLGDLFLGFLRYYATVFKWDKQVISVRMARTLPKSNCKEWKDKFICVEEPFNRTNTARAVHERMKFEAIKAAFIESYRLLQLRKDLNFILPK 477          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01032476.1 (terminal uridylyl transferase 7 [Source:NCBI gene;Acc:562358])

HSP 1 Score: 96.6709 bits (239), Expect = 4.616e-21
Identity = 78/313 (24.92%), Postives = 136/313 (43.45%), Query Frame = 1
Query:  196 LRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKN----NCEMWHYSDITNMNNAQSLERS-------------------ITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            L  I+ EF  N+     + + RQ     IE  +          LYGS  T    ++SD++I V F +        +     +L   + +L + + F  +EG +  R+P++ CK K + L   +SA N  A   T  + E +D++P++  L    ++   +  +     G L S+ + LM+I FLQ+R   PILP   +       + K+      E  H   + +  N  SL++                    + +LWI+  +YY +EF    +++S+R    L +  K+W  K IAIEDP  +   +   +
Sbjct:  195 LESIVTEFGLND----EDLKQRQNILALIEKVLHPVLPECQFRLYGSSSTKFGFKDSDVNIDVKFPS--------HFQHPDILLAAQEHLSKSSLFDSVEGDFHRRMPVVVCKEKASGLICKVSAGNESACLTTAYLSEMADLEPQLVPLVICFRYWAKICCVDQMEEGGLPSYCFALMVISFLQRRKE-PILPTYLESMGFPLSKLKSFSLTGVEKGHVLWVYDQTNDSSLDKDKAVKKGKAPLAFKSRSPVLLGKLWIELLRYYALEFQIPEKIISVRTNGELWRDLKDWPKKRIAIEDPFTVQRNVARTL 494          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: tut4 (terminal uridylyl transferase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-2403])

HSP 1 Score: 59.6918 bits (143), Expect = 1.331e-10
Identity = 36/118 (30.51%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  424 ITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILP 774
            +TQ  +L ++   L    +FAE+E  + A++P++ C+ + + L   +SA N +A   T  +   S ++PR+  L    ++  NL  I     G + S+  +LM+I FLQ+R   P+LP
Sbjct:    1 MTQPDVLIQVLEILKNCVEFAEVESDFHAKVPVVFCRDEASGLMCKVSAGNDVACLTTNHLAALSRLEPRLVPLVLAFRYWANLCHIDCQAEGGIPSYSLSLMVIFFLQQR-YKPVLP 117          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: tent4a (terminal nucleotidyltransferase 4A [Source:ZFIN;Acc:ZDB-GENE-041021-1])

HSP 1 Score: 56.9954 bits (136), Expect = 2.004e-8
Identity = 76/323 (23.53%), Postives = 143/323 (44.27%), Query Frame = 1
Query:  241 RSEQRSRQKEFYD-IENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAE---IEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIR------QKQPLLKSTKN-WIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF-CEVLLVRGNINEISRKIHNQESKS 1170
            R E+ + ++E  D IE+ I E +   DV ++GS  TGL    SD+D+ V               +K  L+++E  L + +  AE   I+ +  A +PII+   ++  ++VDIS +    I     ++EY      +  L  +LK  +   ++ +  +G +SS+   LM+I FLQ    +          D + P               NMN        +  L I+FF+ Y   F++    + I+       K+ ++K+  N +   ++ IEDP    N +G +       ++ +AF    +++   ++ ++R   N++S S
Sbjct:    4 RPEEATMRQEVVDRIESVIKELWPTADVQIFGSFSTGLFLPTSDIDLVVF-----------GKWEKPPLQQLEQALRK-HSVAEPYSIKVLDKATVPIIKLTDQETEVKVDISFNVETGIKAASFIKEYVKKYTVLPYLIFVLKQFLLQRDLNEVFTGGISSYSLILMVISFLQLHPRI----------DTRNP---------------NMN--------LGILLIEFFELYGRHFNYLKTGIRIKNGGAYMAKEDIMKAMSNGYRPSMLCIEDPLLPGNDVGRS--SYGAMQVKEAFDYAYIILSHAVSPLARSYPNKDSDS 279          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: tyms (thymidylate synthetase [Source:Xenbase;Acc:XB-GENE-1001385])

HSP 1 Score: 155.221 bits (391), Expect = 2.185e-40
Identity = 100/294 (34.01%), Postives = 163/294 (55.44%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKFYNVD-VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNM----NNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ++R++    +E  I ++F N   + L+GS   G   R+SDLDI +     ++ + LN    K ++  +   L +      I  + +A++PI++ + K++ +  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+RN  P++P   +  D +   P+   + W+     N     N   SL +   S+ ELW+ F ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  687 SEQQNREQILAYLERFIRKEFNNHSRLCLFGSSKNGFGFRDSDLDICMTLEGHENAKKLNC---KEIIDGLAKVLKKHPGLKNILAITTAKVPIVKFEHKESGVEGDISLYNTLAQHNTRMLATYAAIDPRVKYLGYTVKFFAKRCDIGDASRGSLSSYAYILMVLYFLQQRNP-PVIPVLQEIYDGQE-TPQRMVDGWNAFFFDNTEELRNRFPSLGKNRESVGELWLGFLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 975          

HSP 2 Score: 107.842 bits (268), Expect = 1.955e-24
Identity = 78/292 (26.71%), Postives = 136/292 (46.58%), Query Frame = 1
Query:  229 NTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKILDAF 1098
            N +S+ +   RQ+    +E  I  K     + +YGS +T  A  +SD++I V F             +K ++K    Y+L +  + E+E  + A++P++ CK KK+ L   +SA N  A   TE +     ++P +  L    ++   L  I     G + S+ + LM++ FLQKR   PILP                    +    + +      + S+  LW++  K+YT+EF  E  V+S+R +  L +  KNW  + +AIEDP  +   +  ++  Q  ++ IL+ F
Sbjct:  183 NGVSQEDFLLRQEIVKSMEKIIQMKLPECSLRMYGSSLTRFAFTSSDINIDVKF------------PRKVLIKLF--YVLSIACYTEVESDFHAKVPVVFCKDKKSGLTCKVSAGNDTACLTTEFLEAIGKLEPVLIPLVMAFRYWARLCHIDCQAEGGIPSYCFALMVVFFLQKRQP-PILPA-------------------YLGPWSALVFDHPPKESLGHLWLELLKFYTLEFAMEEHVISVRVQGLLSRDNKNWPRRRLAIEDPFALKRNVARSLNSQMVYEYILERF 440          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: tyms (thymidylate synthetase [Source:Xenbase;Acc:XB-GENE-1001385])

HSP 1 Score: 154.451 bits (389), Expect = 3.789e-40
Identity = 100/294 (34.01%), Postives = 163/294 (55.44%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKFYNVD-VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNM----NNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ++R++    +E  I ++F N   + L+GS   G   R+SDLDI +     ++ + LN    K ++  +   L +      I  + +A++PI++ + K++ +  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+RN  P++P   +  D +   P+   + W+     N     N   SL +   S+ ELW+ F ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  699 SEQQNREQILAYLERFIRKEFNNHSRLCLFGSSKNGFGFRDSDLDICMTLEGHENAKKLNC---KEIIDGLAKVLKKHPGLKNILAITTAKVPIVKFEHKESGVEGDISLYNTLAQHNTRMLATYAAIDPRVKYLGYTVKFFAKRCDIGDASRGSLSSYAYILMVLYFLQQRNP-PVIPVLQEIYDGQE-TPQRMVDGWNAFFFDNTEELRNRFPSLGKNRESVGELWLGFLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 987          

HSP 2 Score: 101.293 bits (251), Expect = 3.107e-22
Identity = 86/343 (25.07%), Postives = 146/343 (42.57%), Query Frame = 1
Query:  229 NTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILP----------DRPKYSDNKRPRPKNNCEM-WHYSDITNMNNAQS----------------------------------------LERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKILDAF 1098
            N +S+ +   RQ+    +E  I  K     + +YGS +T  A  +SD++I V F             +K ++K    Y+L +  + E+E  + A++P++ CK KK+ L   +SA N  A   TE +     ++P +  L    ++   L  I     G + S+ + LM++ FLQKR   PILP          +  K  D       ++C + W Y   +N  N  S                                         + S+  LW++  K+YT+EF  E  V+S+R +  L +  KNW  + +AIEDP  +   +  ++  Q  ++ IL+ F
Sbjct:  125 NGVSQEDFLLRQEIVKSMEKIIQMKLPECSLRMYGSSLTRFAFTSSDINIDVKF------------PRKVLIKLF--YVLSIACYTEVESDFHAKVPVVFCKDKKSGLTCKVSAGNDTACLTTEFLEAIGKLEPVLIPLVMAFRYWARLCHIDCQAEGGIPSYCFALMVVFFLQKRQP-PILPAYLGPWIDGFESKKLDDYHLKGVSDDCYLDWEYRPSSNNENKGSSTTDGRGRTEQNHRKTAVSELESRKNKERQGRSALVFDHPPKESLGHLWLELLKFYTLEFAMEEHVISVRVQGLLSRDNKNWPRRRLAIEDPFALKRNVARSLNSQMVYEYILERF 452          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: tyms (thymidylate synthetase [Source:Xenbase;Acc:XB-GENE-1001385])

HSP 1 Score: 154.451 bits (389), Expect = 3.795e-40
Identity = 100/294 (34.01%), Postives = 163/294 (55.44%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKFYNVD-VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNM----NNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ++R++    +E  I ++F N   + L+GS   G   R+SDLDI +     ++ + LN    K ++  +   L +      I  + +A++PI++ + K++ +  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+RN  P++P   +  D +   P+   + W+     N     N   SL +   S+ ELW+ F ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  699 SEQQNREQILAYLERFIRKEFNNHSRLCLFGSSKNGFGFRDSDLDICMTLEGHENAKKLNC---KEIIDGLAKVLKKHPGLKNILAITTAKVPIVKFEHKESGVEGDISLYNTLAQHNTRMLATYAAIDPRVKYLGYTVKFFAKRCDIGDASRGSLSSYAYILMVLYFLQQRNP-PVIPVLQEIYDGQE-TPQRMVDGWNAFFFDNTEELRNRFPSLGKNRESVGELWLGFLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 987          

HSP 2 Score: 100.908 bits (250), Expect = 3.536e-22
Identity = 86/343 (25.07%), Postives = 146/343 (42.57%), Query Frame = 1
Query:  229 NTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILP----------DRPKYSDNKRPRPKNNCEM-WHYSDITNMNNAQS----------------------------------------LERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKILDAF 1098
            N +S+ +   RQ+    +E  I  K     + +YGS +T  A  +SD++I V F             +K ++K    Y+L +  + E+E  + A++P++ CK KK+ L   +SA N  A   TE +     ++P +  L    ++   L  I     G + S+ + LM++ FLQKR   PILP          +  K  D       ++C + W Y   +N  N  S                                         + S+  LW++  K+YT+EF  E  V+S+R +  L +  KNW  + +AIEDP  +   +  ++  Q  ++ IL+ F
Sbjct:  125 NGVSQEDFLLRQEIVKSMEKIIQMKLPECSLRMYGSSLTRFAFTSSDINIDVKF------------PRKVLIKLF--YVLSIACYTEVESDFHAKVPVVFCKDKKSGLTCKVSAGNDTACLTTEFLEAIGKLEPVLIPLVMAFRYWARLCHIDCQAEGGIPSYCFALMVVFFLQKRQP-PILPAYLGPWIDGFESKKLDDYHLKGVSDDCYLDWEYRPSSNNENKGSSTTDGRGRTEQNHRKTAVSELESRKNKERQGRSALVFDHPPKESLGHLWLELLKFYTLEFAMEEHVISVRVQGLLSRDNKNWPRRRLAIEDPFALKRNVARSLNSQMVYEYILERF 452          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: tyms (thymidylate synthetase [Source:Xenbase;Acc:XB-GENE-1001385])

HSP 1 Score: 154.451 bits (389), Expect = 4.784e-40
Identity = 100/294 (34.01%), Postives = 163/294 (55.44%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKFYNVD-VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNM----NNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ++R++    +E  I ++F N   + L+GS   G   R+SDLDI +     ++ + LN    K ++  +   L +      I  + +A++PI++ + K++ +  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+RN  P++P   +  D +   P+   + W+     N     N   SL +   S+ ELW+ F ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  678 SEQQNREQILAYLERFIRKEFNNHSRLCLFGSSKNGFGFRDSDLDICMTLEGHENAKKLNC---KEIIDGLAKVLKKHPGLKNILAITTAKVPIVKFEHKESGVEGDISLYNTLAQHNTRMLATYAAIDPRVKYLGYTVKFFAKRCDIGDASRGSLSSYAYILMVLYFLQQRNP-PVIPVLQEIYDGQE-TPQRMVDGWNAFFFDNTEELRNRFPSLGKNRESVGELWLGFLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 966          

HSP 2 Score: 100.908 bits (250), Expect = 3.621e-22
Identity = 86/343 (25.07%), Postives = 146/343 (42.57%), Query Frame = 1
Query:  229 NTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILP----------DRPKYSDNKRPRPKNNCEM-WHYSDITNMNNAQS----------------------------------------LERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKILDAF 1098
            N +S+ +   RQ+    +E  I  K     + +YGS +T  A  +SD++I V F             +K ++K    Y+L +  + E+E  + A++P++ CK KK+ L   +SA N  A   TE +     ++P +  L    ++   L  I     G + S+ + LM++ FLQKR   PILP          +  K  D       ++C + W Y   +N  N  S                                         + S+  LW++  K+YT+EF  E  V+S+R +  L +  KNW  + +AIEDP  +   +  ++  Q  ++ IL+ F
Sbjct:  124 NGVSQEDFLLRQEIVKSMEKIIQMKLPECSLRMYGSSLTRFAFTSSDINIDVKF------------PRKVLIKLF--YVLSIACYTEVESDFHAKVPVVFCKDKKSGLTCKVSAGNDTACLTTEFLEAIGKLEPVLIPLVMAFRYWARLCHIDCQAEGGIPSYCFALMVVFFLQKRQP-PILPAYLGPWIDGFESKKLDDYHLKGVSDDCYLDWEYRPSSNNENKGSSTTDGRGRTEQNHRKTAVSELESRKNKERQGRSALVFDHPPKESLGHLWLELLKFYTLEFAMEEHVISVRVQGLLSRDNKNWPRRRLAIEDPFALKRNVARSLNSQMVYEYILERF 451          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: tyms (thymidylate synthetase [Source:Xenbase;Acc:XB-GENE-1001385])

HSP 1 Score: 154.066 bits (388), Expect = 5.742e-40
Identity = 100/294 (34.01%), Postives = 163/294 (55.44%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKFYNVD-VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNM----NNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ++R++    +E  I ++F N   + L+GS   G   R+SDLDI +     ++ + LN    K ++  +   L +      I  + +A++PI++ + K++ +  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+RN  P++P   +  D +   P+   + W+     N     N   SL +   S+ ELW+ F ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  682 SEQQNREQILAYLERFIRKEFNNHSRLCLFGSSKNGFGFRDSDLDICMTLEGHENAKKLNC---KEIIDGLAKVLKKHPGLKNILAITTAKVPIVKFEHKESGVEGDISLYNTLAQHNTRMLATYAAIDPRVKYLGYTVKFFAKRCDIGDASRGSLSSYAYILMVLYFLQQRNP-PVIPVLQEIYDGQE-TPQRMVDGWNAFFFDNTEELRNRFPSLGKNRESVGELWLGFLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 970          

HSP 2 Score: 98.5969 bits (244), Expect = 2.185e-21
Identity = 84/343 (24.49%), Postives = 150/343 (43.73%), Query Frame = 1
Query:  229 NTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILP----------DRPKYSDNKRPRPKNNCEM-WHYSDITNMNNAQS----------------------------------------LERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKILDAF 1098
            N +S+ +   RQ+    +E  I  K     + +YGS +T  A  +SD++I V F  + +  D+       +++ ++  +L+ + + E+E  + A++P++ CK KK+ L   +SA N  A   TE +     ++P +  L    ++   L  I     G + S+ + LM++ FLQKR   PILP          +  K  D       ++C + W Y   +N  N  S                                         + S+  LW++  K+YT+EF  E  V+S+R +  L +  KNW  + +AIEDP  +   +  ++  Q  ++ IL+ F
Sbjct:  142 NGVSQEDFLLRQEIVKSMEKIIQMKLPECSLRMYGSSLTRFAFTSSDINIDVKFPRKMNQPDV-------LIQVLD--ILKNSCYTEVESDFHAKVPVVFCKDKKSGLTCKVSAGNDTACLTTEFLEAIGKLEPVLIPLVMAFRYWARLCHIDCQAEGGIPSYCFALMVVFFLQKRQP-PILPAYLGPWIDGFESKKLDDYHLKGVSDDCYLDWEYRPSSNNENKGSSTTDGRGRTEQNHRKTAVSELESRKNKERQGRSALVFDHPPKESLGHLWLELLKFYTLEFAMEEHVISVRVQGLLSRDNKNWPRRRLAIEDPFALKRNVARSLNSQMVYEYILERF 474          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Tut4 (terminal uridylyl transferase 4 [Source:MGI Symbol;Acc:MGI:2445126])

HSP 1 Score: 147.517 bits (371), Expect = 7.458e-38
Identity = 98/294 (33.33%), Postives = 162/294 (55.10%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKF-YNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH--YSDITN--MNNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ +R++    +E  I +++     + L+GS   G   R+SDLDI +     ++ E LN    K +++ +   L +      I  + +A++PI++ + +++ L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D K+  P+   + W+  + D T        SL +   S+ ELW+   ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  984 SEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNC---KEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKP-PVIPVLQEIFDGKQ-IPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1272          

HSP 2 Score: 88.5817 bits (218), Expect = 3.265e-18
Identity = 78/356 (21.91%), Postives = 151/356 (42.42%), Query Frame = 1
Query:  154 LNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPD---------RPKYSDN---------------------------------KRPRPKNNCEMWHYSDITNMNNAQSLERSIT----------ELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            L ++ S    +   L   ++E      I+  + R RQ    ++   I        + LYGS +T  A ++SD++I + F  + +  DL        L ++   L +   + ++E  + A++P++ CK +K+ L   +SA N +A   T+++     ++P  + L    ++   L  I     G + S+ + LM++ FLQ+R   P+LP           PK  D+                                 K   PK++ +     + +N   A+  +  +T          +LW++  K+YT++F  E  V+ +R +  L +  KNW  + IAIEDP ++   +  ++
Sbjct:  361 LRSLPSPSSAHLAALSVAVVELAKEQGITDDDLRIRQDIVEEMSKVIMTFLPECSLRLYGSSLTKFALKSSDVNIDIKFPPKMNHPDL--------LIQVLGILKKSALYIDVESDFHAKVPVVVCKDRKSALLCRVSAGNDMACLTTDLLAALGKVEPVFTPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKP-PLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWEYNSSSATEKNLIADENKAKADEPKDDTKKTETDNQSNAAKAKHGKSPLTLEAPNQVPLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSL 707          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Tut4 (terminal uridylyl transferase 4 [Source:MGI Symbol;Acc:MGI:2445126])

HSP 1 Score: 147.517 bits (371), Expect = 8.264e-38
Identity = 98/294 (33.33%), Postives = 162/294 (55.10%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKF-YNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH--YSDITN--MNNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ +R++    +E  I +++     + L+GS   G   R+SDLDI +     ++ E LN    K +++ +   L +      I  + +A++PI++ + +++ L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D K+  P+   + W+  + D T        SL +   S+ ELW+   ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  984 SEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNC---KEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKP-PVIPVLQEIFDGKQ-IPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1272          

HSP 2 Score: 88.1965 bits (217), Expect = 3.768e-18
Identity = 78/356 (21.91%), Postives = 151/356 (42.42%), Query Frame = 1
Query:  154 LNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPD---------RPKYSDN---------------------------------KRPRPKNNCEMWHYSDITNMNNAQSLERSIT----------ELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            L ++ S    +   L   ++E      I+  + R RQ    ++   I        + LYGS +T  A ++SD++I + F  + +  DL        L ++   L +   + ++E  + A++P++ CK +K+ L   +SA N +A   T+++     ++P  + L    ++   L  I     G + S+ + LM++ FLQ+R   P+LP           PK  D+                                 K   PK++ +     + +N   A+  +  +T          +LW++  K+YT++F  E  V+ +R +  L +  KNW  + IAIEDP ++   +  ++
Sbjct:  361 LRSLPSPSSAHLAALSVAVVELAKEQGITDDDLRIRQDIVEEMSKVIMTFLPECSLRLYGSSLTKFALKSSDVNIDIKFPPKMNHPDL--------LIQVLGILKKSALYIDVESDFHAKVPVVVCKDRKSALLCRVSAGNDMACLTTDLLAALGKVEPVFTPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKP-PLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWEYNSSSATEKNLIADENKAKADEPKDDTKKTETDNQSNAAKAKHGKSPLTLEAPNQVPLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSL 707          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Tut7 (terminal uridylyl transferase 7 [Source:MGI Symbol;Acc:MGI:2387179])

HSP 1 Score: 146.747 bits (369), Expect = 1.173e-37
Identity = 90/294 (30.61%), Postives = 158/294 (53.74%), Query Frame = 1
Query:  247 EQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSL-------ERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            E ++R+    ++E+ I + F    + L+GS   G   + SDLD+ +  +  ++ E L+ +   R ++ +   L + +    I  + +A++PI++    +  L VDIS  NT+A+ NT ++  YS +DPRV  L   +K    + +IGDA  G+LSS+ YTLM+++FLQ+R+  V+P+L +   Y   K  +P+   + W+      +N   +           + +LW+   ++YT EFDF+  V+SIR+K  L    K W  K I IEDP ++ + +GA + +     I+ AF
Sbjct:  612 EDQAREHIRQNLESFIKQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGHETAEGLDCV---RTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRSPPVIPVLQE--IYKGEK--KPEILVDGWNIYFFDQINELPTCWPEYGKNTEPVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAF 898          

HSP 2 Score: 62.3882 bits (150), Expect = 6.850e-10
Identity = 52/217 (23.96%), Postives = 95/217 (43.78%), Query Frame = 1
Query:  544 NLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDR-----PKYSDNKRPR-----PKNNCEMWHYSDITNMNNAQSLERS------------------------ITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKIL 1089
             L   +SA N  A   T+ +     ++PR+  L    ++   L  I     G L  + + LM + FLQ+R   P+LP        ++S NK         + +  +W Y+D +  + + + E +                        + +LW++  ++Y +EF+    V+SIR K+ + + +K+W  K IAIEDP ++   +   +  Q  F+ IL
Sbjct:    2 GLLCKVSAGNENAWLTTKHLTALGKLEPRLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAVFFLQQRKE-PLLPVYLGSWIEEFSLNKLGNFSLKDVEKDSVVWEYTDNSTGDTSSAKEEAPKETAAKKGQVPLTFNIKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELISRESKDWPKKRIAIEDPYSVKRNVARTLNNQPVFEYIL 217          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Tut7 (terminal uridylyl transferase 7 [Source:MGI Symbol;Acc:MGI:2387179])

HSP 1 Score: 145.976 bits (367), Expect = 2.522e-37
Identity = 90/294 (30.61%), Postives = 158/294 (53.74%), Query Frame = 1
Query:  247 EQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSL-------ERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            E ++R+    ++E+ I + F    + L+GS   G   + SDLD+ +  +  ++ E L+ +   R ++ +   L + +    I  + +A++PI++    +  L VDIS  NT+A+ NT ++  YS +DPRV  L   +K    + +IGDA  G+LSS+ YTLM+++FLQ+R+  V+P+L +   Y   K  +P+   + W+      +N   +           + +LW+   ++YT EFDF+  V+SIR+K  L    K W  K I IEDP ++ + +GA + +     I+ AF
Sbjct: 1014 EDQAREHIRQNLESFIKQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGHETAEGLDCV---RTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRSPPVIPVLQE--IYKGEK--KPEILVDGWNIYFFDQINELPTCWPEYGKNTEPVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAF 1300          

HSP 2 Score: 93.2041 bits (230), Expect = 9.433e-20
Identity = 74/306 (24.18%), Postives = 141/306 (46.08%), Query Frame = 1
Query:  280 IENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDR-----PKYSDNKRPR-----PKNNCEMWHYSDITNMNNAQSLERS------------------------ITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKIL 1089
            +E+    K  +  + LYGS  + L  R+SD++I V F           ++Q  +L  ++  L   + F +++  + AR+P++ C+ K++ L   +SA N  A   T+ +     ++PR+  L    ++   L  I     G L  + + LM + FLQ+R   P+LP        ++S NK         + +  +W Y+D +  + + + E +                        + +LW++  ++Y +EF+    V+SIR K+ + + +K+W  K IAIEDP ++   +   +  Q  F+ IL
Sbjct:  323 MESVFRHKLPDCSLRLYGSSCSRLGFRDSDVNIDVQFPAV--------MSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCRDKQSGLLCKVSAGNENAWLTTKHLTALGKLEPRLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAVFFLQQRKE-PLLPVYLGSWIEEFSLNKLGNFSLKDVEKDSVVWEYTDNSTGDTSSAKEEAPKETAAKKGQVPLTFNIKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELISRESKDWPKKRIAIEDPYSVKRNVARTLNNQPVFEYIL 619          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Tent2 (terminal nucleotidyltransferase 2 [Source:MGI Symbol;Acc:MGI:2140950])

HSP 1 Score: 108.997 bits (271), Expect = 2.285e-25
Identity = 83/322 (25.78%), Postives = 156/322 (48.45%), Query Frame = 1
Query:  148 PVLNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRI--ENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPK-YSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTK-NWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            P+L   +      K KL   +LE         S+ + ++     ++  I   F    ++L GS + G   R+SD D+ ++         +N  T+ R +  +  +++  +L+ + E   +  A++PI++ + K + +  D++ +NT+ I NT ++R Y+ ++ RV  L  ++K   + ++I DA  GTLSS+   LM++H+LQ     PILP   K Y ++          + H++           E S+ +L + F KYY  EFD+  +++S+R+ + + +     W  K I +E+P + TN   A   +  F  I D F
Sbjct:  140 PLLEPREITLPEAKDKLSQQILELFETCQQQASDLKKKELCRAQLQREIQLLFPQSRLFLVGSSLNGFGARSSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKVPIVKFRDKVSCVEFDLNVNNTVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHDINDASRGTLSSYSLVLMVLHYLQTLPE-PILPSLQKIYPESF--STSVQLHLVHHAPCNVPPYLSKNESSLGDLLLGFLKYYATEFDWNTQMISVREAKAIPRPDDMEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKDQF 458          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5VYS8|TUT7_HUMAN (Terminal uridylyltransferase 7 OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.162e-37
Identity = 92/292 (31.51%), Postives = 159/292 (54.45%), Query Frame = 1
Query:  247 EQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRPRP-KNNCEMWHYSDI----TNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            E ++R+    ++E+ I + F    + L+GS   G   + SDLD+ +  +  ++ E L+ +   R ++ +   L + +    I  + +A++PI++    +  L VDIS  NT+A+ NT ++  YS +DPRV  L   +K    + +IGDA  G+LSS+ YTLM+++FLQ+RN  V+P+L +   Y   K+P    +   ++ +  I    T  +       S+ +LW+   ++YT EFDF+  V+SIR+K  L    K W  K I IEDP ++ + +GA + +     I+ AF
Sbjct: 1018 EDQAREHIRQNLESFIRQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCV---RTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQE--IYKGEKKPEIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAF 1304          

HSP 2 Score: 90.5077 bits (223), Expect = 4.494e-18
Identity = 72/306 (23.53%), Postives = 137/306 (44.77%), Query Frame = 1
Query:  280 IENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILP----------DRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERS------------------------ITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKIL 1089
            +EN    K  +  + LYGS  + L  +NSD++I + F    +I     ++Q  +L  ++  L   + F +++  + AR+P++ C+ K++ L   +SA N  A   T+ +     ++P++  L    ++   L  I     G L  + + LM I FLQ+R   P+LP             K  +      + +  +W ++D    +   + E +                        + +LW++  ++Y +EF+    V+SIR K+ + +  K+W  K IAIEDP ++   +   +  Q  F+ IL
Sbjct:  323 MENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQF---PAI-----MSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQSGLLCKVSAGNENACLTTKHLTALGKLEPKLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAIFFLQQRKE-PLLPVYLGSWIEGFSLSKLGNFNLQDIEKDVVIWEHTDSAAGDTGITKEEAPRETPIKRGQVSLILDVKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELVSRELKDWPKKRIAIEDPYSVKRNVARTLNSQPVFEYIL 619          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|B2RX14|TUT4_MOUSE (Terminal uridylyltransferase 4 OS=Mus musculus OX=10090 GN=Tut4 PE=1 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 5.781e-37
Identity = 98/294 (33.33%), Postives = 162/294 (55.10%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKF-YNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH--YSDITN--MNNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ +R++    +E  I +++     + L+GS   G   R+SDLDI +     ++ E LN    K +++ +   L +      I  + +A++PI++ + +++ L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D K+  P+   + W+  + D T        SL +   S+ ELW+   ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  984 SEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNC---KEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKP-PVIPVLQEIFDGKQ-IPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1272          

HSP 2 Score: 88.1965 bits (217), Expect = 2.636e-17
Identity = 78/356 (21.91%), Postives = 151/356 (42.42%), Query Frame = 1
Query:  154 LNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPD---------RPKYSDN---------------------------------KRPRPKNNCEMWHYSDITNMNNAQSLERSIT----------ELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            L ++ S    +   L   ++E      I+  + R RQ    ++   I        + LYGS +T  A ++SD++I + F  + +  DL        L ++   L +   + ++E  + A++P++ CK +K+ L   +SA N +A   T+++     ++P  + L    ++   L  I     G + S+ + LM++ FLQ+R   P+LP           PK  D+                                 K   PK++ +     + +N   A+  +  +T          +LW++  K+YT++F  E  V+ +R +  L +  KNW  + IAIEDP ++   +  ++
Sbjct:  361 LRSLPSPSSAHLAALSVAVVELAKEQGITDDDLRIRQDIVEEMSKVIMTFLPECSLRLYGSSLTKFALKSSDVNIDIKFPPKMNHPDL--------LIQVLGILKKSALYIDVESDFHAKVPVVVCKDRKSALLCRVSAGNDMACLTTDLLAALGKVEPVFTPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKP-PLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWEYNSSSATEKNLIADENKAKADEPKDDTKKTETDNQSNAAKAKHGKSPLTLEAPNQVPLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSL 707          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5TAX3|TUT4_HUMAN (Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 8.415e-37
Identity = 98/294 (33.33%), Postives = 162/294 (55.10%), Query Frame = 1
Query:  244 SEQRSRQKEFYDIENCIDEKF-YNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH--YSDITN--MNNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            SEQ +R++    +E  I +++     + L+GS   G   R+SDLDI +     ++ E LN    K +++ +   L +      I  + +A++PI++ + +++ L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D K+  P+   + W+  + D T        SL +   S+ ELW+   ++YT EFDF+  V+SIRQK+ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  967 SEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHENAEKLNC---KEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKP-PVIPVLQEIFDGKQ-IPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1255          

HSP 2 Score: 83.1889 bits (204), Expect = 1.400e-15
Identity = 77/340 (22.65%), Postives = 150/340 (44.12%), Query Frame = 1
Query:  208 LLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDR------PKYSDN---------------------------------KRPRPKNNCEMWHYSDITNMNNAQ---------SLER----SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            ++E    + I+  + R RQ+   ++   I        + LYGS +T  A ++SD++I + F  + +  DL        L ++   L +   + ++E  + A++P++ C+ +K+ L   +SA N +A   T+++     ++P    L    ++   L  I     G + S+ + LM++ FLQ+R   +LP L         PK  D+                                 K  +PK++ +    ++  N +NA          +LE     S+ +LW++  K+YT++F  E  V+ +R +  L +  KNW  + IAIEDP ++   +  ++
Sbjct:  359 VIELAKEHGITDDDLRVRQEIVEEMSKVITTFLPECSLRLYGSSLTRFALKSSDVNIDIKFPPKMNHPDL--------LIKVLGILKKNVLYVDVESDFHAKVPVVVCRDRKSGLLCRVSAGNDMACLTTDLLTALGKIEPVFIPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKPPLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWECNSSSATEKNSIAEENKAKADQPKDDTKK---TETDNQSNAMKEKHGKSPLALETPNRVSLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSL 687          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5BLK4|TUT7_MOUSE (Terminal uridylyltransferase 7 OS=Mus musculus OX=10090 GN=Tut7 PE=1 SV=3)

HSP 1 Score: 145.976 bits (367), Expect = 1.552e-36
Identity = 90/294 (30.61%), Postives = 158/294 (53.74%), Query Frame = 1
Query:  247 EQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSL-------ERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            E ++R+    ++E+ I + F    + L+GS   G   + SDLD+ +  +  ++ E L+ +   R ++ +   L + +    I  + +A++PI++    +  L VDIS  NT+A+ NT ++  YS +DPRV  L   +K    + +IGDA  G+LSS+ YTLM+++FLQ+R+  V+P+L +   Y   K  +P+   + W+      +N   +           + +LW+   ++YT EFDF+  V+SIR+K  L    K W  K I IEDP ++ + +GA + +     I+ AF
Sbjct: 1014 EDQAREHIRQNLESFIKQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGHETAEGLDCV---RTIEELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRSPPVIPVLQE--IYKGEK--KPEILVDGWNIYFFDQINELPTCWPEYGKNTEPVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAF 1300          

HSP 2 Score: 93.2041 bits (230), Expect = 6.382e-19
Identity = 74/306 (24.18%), Postives = 141/306 (46.08%), Query Frame = 1
Query:  280 IENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDR-----PKYSDNKRPR-----PKNNCEMWHYSDITNMNNAQSLERS------------------------ITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI-RQNDFQKIL 1089
            +E+    K  +  + LYGS  + L  R+SD++I V F           ++Q  +L  ++  L   + F +++  + AR+P++ C+ K++ L   +SA N  A   T+ +     ++PR+  L    ++   L  I     G L  + + LM + FLQ+R   P+LP        ++S NK         + +  +W Y+D +  + + + E +                        + +LW++  ++Y +EF+    V+SIR K+ + + +K+W  K IAIEDP ++   +   +  Q  F+ IL
Sbjct:  323 MESVFRHKLPDCSLRLYGSSCSRLGFRDSDVNIDVQFPAV--------MSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCRDKQSGLLCKVSAGNENAWLTTKHLTALGKLEPRLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAVFFLQQRKE-PLLPVYLGSWIEEFSLNKLGNFSLKDVEKDSVVWEYTDNSTGDTSSAKEEAPKETAAKKGQVPLTFNIKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELISRESKDWPKKRIAIEDPYSVKRNVARTLNNQPVFEYIL 619          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O64642|URT1_ARATH (UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=URT1 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 5.278e-26
Identity = 90/321 (28.04%), Postives = 160/321 (49.84%), Query Frame = 1
Query:  235 ISRSEQRSRQKEFY-DIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPD-RPKYS---DNKRPRPKNNCEMWHYSDITNMNNAQSLER-SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKV------IAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEISRKIH 1152
            I   E+  +Q++    +EN + +++ +  +YLYGS         SD+D+ +      +IE  ++I +  ML ++   +L+ +    ++ +  AR+PI++       +  DI  +N +A+ NT+++R+Y+ +D R+  L  ++KH      + +   GTLSS+ Y LM IHFLQ+R   +LP L +  P YS   DN R      C   ++ ++  + N  S  R +I EL   FF Y+    D+   VVS+R    L K  K+W  +V      I IEDP   ++ +G         +++D F  + ++R      +R +H
Sbjct:  446 IPAEEELEKQRQLMAHLENLVAKEWPHAKLYLYGSCANSFGFPKSDIDVCL------AIEG-DDINKSEMLLKLAE-ILESDNLQNVQALTRARVPIVKLMDPVTGISCDICINNVLAVVNTKLLRDYAQIDVRLRQLAFIVKHWAKSRRVNETYQGTLSSYAYVLMCIHFLQQRRPPILPCLQEMEPTYSVRVDNIR------CT--YFDNVDRLRNFGSNNRETIAELVWGFFNYWAYAHDYAYNVVSVRTGSILGKREKDWTRRVGNDRHLICIEDPFETSHDLG---------RVVDKFS-IRVLREEFERAARIMH 740          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A131XI78 (Putative s-m checkpoint control protein cid1 (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 9.928e-42
Identity = 104/312 (33.33%), Postives = 164/312 (52.56%), Query Frame = 1
Query:  148 PVLNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKK-NLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSL----ERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            P L  +  +  +Y + L  +  + +S  T    E+ SR+K   ++E+ I +K+ +  + LYGS   G     SDLDI + F + K   D  + + K  +  +   L        I  + SA++PI++   K+ NL  DIS  NT+A  NT +++ YS++D RV ILG   KH      IGDA  G+LSS+ Y L+ +++LQ  K  V+P+L +     + K          W Y DI ++ +  S       ++ ELW+   K+YT EF+F+  VVSIRQK PL +  K W  K IAIEDP ++ + +G+ +
Sbjct:  653 PELKPLPDMTRSYTKILNDVCQDVMSVCTPDPEEEASREKLLLELESYIRKKYKDAKLTLYGSSCNGFGLIRSDLDICLTFEHSK---DGKDFSHKDRIMDLAKELKNHKGLKRITAITSAKVPIVKFFHKQTNLEGDISFYNTLAQHNTRLLKVYSEIDERVRILGYTFKHFAKTCAIGDASRGSLSSYAYILLTLYYLQQCKPPVIPVLQELYPEREQKPEVMVEGWNAWFYDDIDHLQSVWSEFGRNNETVGELWLGLLKFYTEEFNFQEHVVSIRQKAPLTRLQKMWTSKSIAIEDPFDLDHNLGSGV 961          

HSP 2 Score: 95.1301 bits (235), Expect = 4.809e-17
Identity = 70/280 (25.00%), Postives = 132/280 (47.14%), Query Frame = 1
Query:  208 LLEFISN-NTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCK-TKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRP----RPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDP 1029
            L+E ++  ++++  E   R++   D+E  I +   +V + L+GS   G   + S++++         +  L      ++     + L +  ++ ++   Y +++P IR K     L  +IS +N+ +   ++++ +Y+ +D RV ILG   +       +     GTL    + +M + FLQ+    P+LP   +  D K      +PK+    W   +          ERSI +LW++  ++Y +EF     VV IR+ QP+L   K W  + IAIEDP
Sbjct:  174 LVEKVAQEHSLTVEEVELRKRVVSDLETFIKKTLPDVRLNLHGSSANGFGLKTSNVNM--------DLTPLGKADCAQLFVGTGDLLQESTEYTQVTKDYLSKVPRIRFKDVASKLSCEISLNNSNSQKTSKLLDDYASLDRRVKILGVAFRLWAKHCGLDQQDRGTLPPHAFAIMTVFFLQQCKP-PVLPVLHEMKDGKESESYLKPKDLEGRWSCKN----------ERSIGQLWVELLRFYAVEFKLNKRVVCIRRSQPMLIVEKKWNKRYIAIEDP 434          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A1E1XGQ1 (Putative s-m checkpoint control protein cid1 OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.022e-41
Identity = 100/324 (30.86%), Postives = 166/324 (51.23%), Query Frame = 1
Query:  148 PVLNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSL----ERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            P L  +  +   Y + L  +  + ++  +    E+ +RQ+    +E+ I E + +  + LYGS   G     SDLDI + F + K  +DL      +M+K +   L +      I  + +A++PI++       L  DIS  NT+A  NT +++ YS++D RV +LG   KH     +IGDA  G+LSS+ Y LM +H+LQ  K  V+P+L +     + K          W + DI  + +  S       S+ ELW+   K+YT +F+F+  VVSIRQ+ P+ +  K W  + IAIEDP ++ + +G+ + +     I+ AF
Sbjct:  818 PELKQLPDMTRNYTKILNDVCQDVMNECSPKPDEEANRQEVLQKLESFIQELYPDAKLTLYGSSCNGFGLVRSDLDICLTFEDSKDGKDL---CHSKMIKALARKLHKHPDLNRIIAIATAKVPIVKFYHIPSGLEGDISLYNTLAQHNTRLLKAYSEIDHRVRVLGYTFKHFAKTCDIGDASRGSLSSYAYILMTLHYLQQCKPPVIPVLQELFPEGETKPEVMIEGWNAWFFDDIDRLQDVWSEFGQNNESVGELWLGMLKFYTEQFNFQEHVVSIRQRAPVTRLQKMWTSQCIAIEDPFDLDHNLGSGVSRKMNTYIMKAF 1138          

HSP 2 Score: 103.219 bits (256), Expect = 9.671e-20
Identity = 73/280 (26.07%), Postives = 134/280 (47.86%), Query Frame = 1
Query:  205 ILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQ-LNKFAEIEGVYSARIPIIR-CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDRPKYSDNKR-PRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDP 1029
            ++ + +  +++S  E   R++   D+E  I E   +V  +L+GS V+G   + S++++ +    +     L   T           LLQ   K+ ++   Y +++P IR  +    L  +IS +N  +   + ++ +Y+ +DPRV  LG   +       +     GTL +  + +M + FLQ  K  VLP+L +     +++   +PK+    W   +          +RS+ +LW++  ++Y  EF     VV IR+ QPLL + K W  + IAIEDP
Sbjct:  331 VIEKIVEEHSLSAEEVELRKRMAADLEAYIRETLPDVRFHLHGSSVSGFGLKTSNVNVDLSPAGKADCAQLFVGTGD---------LLQGCPKYEQVTKNYLSKVPRIRFMEVSSKLSCEISLNNCNSQKTSRLLDDYASLDPRVKTLGVAFRLWAKHCGLDQQDRGTLPAHAFAIMTVFFLQQCKPAVLPVLHEMKGAKESESYLKPKDLEGQWSCKN----------DRSVGQLWVELLRFYAAEFKLNKRVVCIRRSQPLLIAEKKWNKRYIAIEDP 591          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A2J7PSX7 (Uncharacterized protein (Fragment) OS=Cryptotermes secundus OX=105785 GN=B7P43_G03611 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.068e-41
Identity = 97/321 (30.22%), Postives = 181/321 (56.39%), Query Frame = 1
Query:  163 IDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPK---NNCEMWHYSDITNMNN-----AQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            +  ++G YK  L  +    ++  +I+  E   R++   D++  I + +    + L+GS   G     SD+DI + F + ++ ++ N +   R+++ ++N L +L   + +  V +A++PI++   K   L  DIS  NT+   NT+++R Y+++DPR  +LG +LK    + ++ DA  G+LSS+ Y LM+I+FLQ+ +  P+LP   + S+ + P+P+     C+ + Y D+  +        +++  S+ ELWI    +Y+ EFDF   V+SIRQ++ LL+  K W  K +AIEDP ++T+ +G  + +N    I+ +F
Sbjct:  618 LPPMEGCYKEVLDKLCAHILAKWSITPEEVEKRERIVLDMQEYIVQCYPTAKLELFGSSCNGFGLLKSDIDICLTFTDSETGKEHNFV---RIIEGLQNMLKKLGVMSNLVPVTTAKVPILKFFHKVSELEGDISIYNTLGQQNTKLLRTYAEIDPRAKMLGYMLKRFAKVCDMCDASRGSLSSYAYILMVIYFLQQCSP-PVLPVLQELSETQ-PKPRRFVEGCDTYFYEDLGKVEKLWPDYGKNMS-SVGELWIQLLGFYSAEFDFGKYVISIRQRERLLRFEKLWTSKCMAIEDPFDLTHNLGVGLSRNMHIYIIKSF 932          

HSP 2 Score: 82.8037 bits (203), Expect = 3.889e-13
Identity = 70/312 (22.44%), Postives = 146/312 (46.79%), Query Frame = 1
Query:  196 LRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIR-CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLER--SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLK--STKNWIFKVIAIEDP----SNITNAIGANIRQNDFQKILDAF 1098
            L ++L E +  + +S ++  +RQ     + N I++      V LYGS ++G   + SD+++ +     KS          + L    + +  +  ++++E  ++A IP +R      NL   ++  +  +     ++ +Y+ +D RV  LG   +      ++ +A +GT     ++L++++FLQ  +  V+P+L +    + +       N ++  Y D  ++      E   S+ ELW++ F++Y ++FD    VV I Q  P L+  +   W  + IA++DP     N+T ++     Q  F+  +  F
Sbjct:  179 LDNLLREEVKLHGLSDTDILARQNIAAVLGNTIEKIMPGFTVRLYGSSLSGFGLKQSDVNLDLSVPEEKS--------PAQGLAAASDLIASIEAYSKVERDFTAEIPAVRFIDNGTNLPCVLTVQHNHSHKIALLLSQYATVDERVRTLGIAFRFWGQHCKLDNAEAGTWPPHAFSLLVVYFLQQVRSPVVPVLHELQTTAGSDL-----NPDI--YLDSKDLEGVWKSENTMSLGELWLELFRFYALDFDASRRVVCIEQSAPFLRHNNENRWAGRKIAVKDPFLPKRNVTRSMAT---QACFEYCIKCF 472          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A1S3H6L0 (terminal uridylyltransferase 4-like OS=Lingula unguis OX=7574 GN=LOC106152548 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.217e-41
Identity = 99/323 (30.65%), Postives = 179/323 (55.42%), Query Frame = 1
Query:  184 YKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPK---NNCEMWHYSDIT------NMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRG 1122
            Y + L  +L +   +   +  E   R +   ++E+ I E++ N  + L+GS   G   ++SDLDI + F N K+ E +N +    +++ +   L +      +  + +A++PI++ K +K+ L  DIS  NT+A  NT +++ YS++D RV I+G ++K    + +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D    +P+   + C  W + +++      + ++A     S+TELWI   ++YT EF+F   V+SIRQ +PL +  K W    IAIEDP ++++ +GA + +      ++ F    L+ G
Sbjct:  524 YIKLLDSVLQQVPDDFAPTDREVNERNQILRELEDYIREQYPNARLQLFGSSCNGFGFQHSDLDICMSFVNHKTAEGINCV---EIIEDLAKILKKHRGVYNVIAITTAKVPIVKFKHRKSQLEADISLYNTLAQHNTRLLQLYSELDERVKIIGYVMKVFAKICDIGDASRGSLSSYAYVLMVLYFLQQRKP-PVIPVLQEMYDPSTSKPEVIVDGCNAWFFQNVSHRTLSQHWSSAGQNRESVTELWIGLLRFYTEEFNFREHVISIRQLKPLTRFEKMWNGTCIAIEDPFDLSHNLGAGLSRK-----MNTFIRKALING 837          

HSP 2 Score: 117.857 bits (294), Expect = 1.318e-24
Identity = 81/265 (30.57%), Postives = 145/265 (54.72%), Query Frame = 1
Query:  325 LYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKT-KKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRPRPK---NNCEMWHYSDITNMNNAQSLE--RSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQND-FQKILD 1092
            LYGS V G   ++SDL+I V+  +  +I  +  +T   +LK  E+ L     F +    +SA+IP I      +  R  ++  N ++ + +++++ YS +D RV  LG L K+   L +     +G+L S+ ++L+ + FLQ+ N  VLP+L +       +RP+ K    NC  W++ DI N+++  + +  +S+ ELW++  K+Y++ FD    VV +RQKQ + +  K W  K +AIEDP ++   +  ++  +  F+ I D
Sbjct:    5 LYGSSVNGFGLKSSDLNIDVVVGSNANIAYVL-MTAYELLK--ESAL-----FNQAVSDFSAKIPSIYVPIDGETARCQLTVHNELSFETSQLLQLYSRIDNRVGKLGILFKYWAKLCKADRQDAGSLPSYAFSLLTVFFLQQHNPPVLPVLQEVLPKGCKERPQKKIDGKNC--WYFEDIDNLSSVWTSKNTQSLAELWLEMLKFYSLNFDIGNYVVCVRQKQLVTRDEKKWSSKKLAIEDPFSVKRNVTRSVSHSQIFEYIYD 259          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A1S3K3V4 (terminal uridylyltransferase 4 OS=Lingula unguis OX=7574 GN=LOC106178449 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.636e-41
Identity = 99/323 (30.65%), Postives = 179/323 (55.42%), Query Frame = 1
Query:  184 YKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPK---NNCEMWHYSDIT------NMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRG 1122
            Y + L  +L +   +   +  E   R +   ++E+ I E++ N  + L+GS   G   ++SDLDI + F N K+ E +N +    +++ +   L +      +  + +A++PI++ K +K+ L  DIS  NT+A  NT +++ YS++D RV I+G ++K    + +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D    +P+   + C  W + +++      + ++A     S+TELWI   ++YT EF+F   V+SIRQ +PL +  K W    IAIEDP ++++ +GA +      + ++ F    L+ G
Sbjct:  817 YIKLLDSVLQQVPDDFAPTDREVNERNQILRELEDYIREQYPNARLQLFGSSCNGFGFQHSDLDICMTFVNHKTAEGINCV---EIIEDLAKILKKHRGVYNVIAITTAKVPIVKFKHRKSQLEADISLYNTLAQHNTRLLQLYSELDERVKIIGYVMKVFAKICDIGDASRGSLSSYAYVLMVLYFLQQRKP-PVIPVLQEMYDPSTSKPEVIVDGCNAWFFQNVSHRTLSQHWSSAGQNRESVTELWIGLLRFYTEEFNFREHVISIRQLKPLTRFEKMWNGTCIAIEDPFDLSHNLGAGL-----SRKMNTFIRKALING 1130          

HSP 2 Score: 122.094 bits (305), Expect = 5.156e-26
Identity = 93/347 (26.80%), Postives = 176/347 (50.72%), Query Frame = 1
Query:   79 LMFYTNYSNNRRSFYLNGHFLYSPVLNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCK-TKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRPRPK---NNCEMWHYSDITNMNNAQSLE--RSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQND-FQKILD 1092
            L    N++ + R   L G    + +L  +      + + +   L + +    ++  + + R+     +E  I  K  +V + LYGS V G   ++SDL+I V+  +  +I  +  +T   +LK  E+ L     F +    +SA+IP I      +  R  ++  N ++ + +++++ YS +D RV  LG L K+   L +     +G+L S+ ++L+ + FLQ+ N  VLP+L +       +RP+ K    NC  W++ DI N+++  + +  +S+ ELW++  K+Y++ FD    VV +RQKQ + +  K W  K +AIEDP ++   +  ++  +  F+ I D
Sbjct:  216 LQICANHAKDNRHRRLKGLKESNTMLRHLAPPSSAHLQAVDKALNKVLEKQALTPQDIQKRENITKSLEEVIQTKLPDVYLRLYGSSVNGFGLKSSDLNIDVVVGSNANIAYVL-MTAYELLK--ESAL-----FNQAVSDFSAKIPSIYVPIDGETARCQLTVHNELSFETSQLLQLYSRIDNRVGKLGILFKYWAKLCKADRQDAGSLPSYAFSLLTVFFLQQHNPPVLPVLQEVLPKGCKERPQKKIDGKNC--WYFEDIDNLSSVWTSKNTQSLAELWLEMLKFYSLNFDIGNYVVCVRQKQLVTRDEKKWSSKKLAIEDPFSVKRNVTRSVSHSQIFEYIYD 552          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: TUT4 (terminal uridylyltransferase 4 [Source:NCBI gene;Acc:103031850])

HSP 1 Score: 157.918 bits (398), Expect = 1.733e-41
Identity = 95/293 (32.42%), Postives = 161/293 (54.95%), Query Frame = 1
Query:  247 EQRSRQKEFYDIENCIDEKFYN-VDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRN--VLPILPDRPKYSDNKRP-RPKNNCEMWHYSDITN----MNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
            EQ+ R++    +E  I +++ +   + L+GS   G   R+SDLDI +      + E LN    K +++ +   L +      I  + +A++PI++ + K++ L  DIS  NT+A  NT ++  Y+ +DPRV +LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   V+P+L +   Y  N  P R  +    + + D+      ++  Q    ++ ELW+   ++YT EFDF+  V+SIRQ++ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:  817 EQQKREQILCSLERFIRKEYNDKAQLCLFGSSKNGFGFRDSDLDICMTLEGHDTAEKLNC---KEIIEGLAKILKKHTGLRNILPITTAKVPIVKFEHKQSGLEGDISLYNTLAQHNTRMLATYAALDPRVQLLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRQPPVIPVLQE--IYDGNTMPQRMVDGWNAFFFDDLEELRLRLSEFQKNRETVGELWLGLLRFYTEEFDFKEHVISIRQRKRLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1104          

HSP 2 Score: 112.079 bits (279), Expect = 4.399e-26
Identity = 92/359 (25.63%), Postives = 161/359 (44.85%), Query Frame = 1
Query:  154 LNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCK-TKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILP---------------------------------DRP-KYSDNK---RPRPKNNC-EMWHYSDITNMNNAQSLER----SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIR-QNDFQKILDAF 1098
            L A+ +      R +   ++E    N IS  E + RQ     ++  I +      + LYGS +T  A + SDL+I V +          N+TQ  +L ++ + L +  +F+E+E  + A++P++ C+     L   +SA N +A   T  +   + ++PR+  L    ++   L  +     G + S+ ++LM+I FLQ+R   PILP                                  RP   SD +   RP+P+    E    S+         LE+    S+ +LW++  ++YT+EF  E  ++SIR K+ L +  KNW  + +AIEDP  +   +  ++  Q  F+ I + F
Sbjct:  246 LRALPAPSPAQMRAVDAAVMEAARQNGISEEEFQQRQGVLKRMQQIIQKHLPTCSLRLYGSCLTRFAFKTSDLNIDVAYPP--------NMTQPDVLIQVLDILKKSAEFSEVESDFHAKVPVVFCRDAASGLPCKVSAGNDVACLTTNHLAALARLEPRLVPLVLAFRYWAKLCHVDCQAEGGIPSYSFSLMVIFFLQQRK-QPILPVYLGCWIEGFDVKRVDEYHLTGVQTEGLYVGWEHRPGSASDGRRDSRPKPETQKREAEKKSENVQGKTRLVLEKTESVSLGQLWLELLRFYTLEFALEDYIISIRLKELLPRDAKNWPRRRLAIEDPFALKRNVARSLNSQMVFEYIQERF 595          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: tent2 (terminal nucleotidyltransferase 2 [Source:NCBI gene;Acc:103039892])

HSP 1 Score: 87.8113 bits (216), Expect = 2.162e-18
Identity = 76/289 (26.30%), Postives = 141/289 (48.79%), Query Frame = 1
Query:  319 VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDRPKYSDNKRP---------RPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTK-NWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCE---VLLVRGNINEI 1137
            V+L GS + G   R+SD D+ ++  +    +  + +    +L R++  L +L+ + E   +  A++PI++ + +   +  D++ +N + I NT ++R Y+ ++ RV  +  ++K   +  +I DA  GTLSS+   LM++H+LQ     V+P L  +  Y +   P          P+N           + N +     S+ +L + F KYY   F ++  V+S+R+ + L +     W  K I +E+P + TN   A   +  F  I   F E   VL VR +++ I
Sbjct:  212 VFLAGSSLNGFGSRSSDADLCLVVQDGPVNQRTDAVY---ILSRVQRLLYKLS-YIERPQLIRAKVPILKFRDRISGVEFDLNVNNVVGIRNTFLLRTYAHIERRVRPIILVIKKWASHNKINDASRGTLSSYTLVLMVLHYLQTLPEPVIPCL--QKDYPECFSPVMDIHLVPDGPRN------IPPFVSKNQS-----SLGDLLLGFLKYYATVFRWDKFVISVREGKALPRPNSWEWKNKFICVEEPFDGTNTARAVHEKMKFDAIKAQFTESWQVLQVRKDLDYI 483          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: tent2 (terminal nucleotidyltransferase 2 [Source:NCBI gene;Acc:103039892])

HSP 1 Score: 87.8113 bits (216), Expect = 2.162e-18
Identity = 76/289 (26.30%), Postives = 141/289 (48.79%), Query Frame = 1
Query:  319 VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDRPKYSDNKRP---------RPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTK-NWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCE---VLLVRGNINEI 1137
            V+L GS + G   R+SD D+ ++  +    +  + +    +L R++  L +L+ + E   +  A++PI++ + +   +  D++ +N + I NT ++R Y+ ++ RV  +  ++K   +  +I DA  GTLSS+   LM++H+LQ     V+P L  +  Y +   P          P+N           + N +     S+ +L + F KYY   F ++  V+S+R+ + L +     W  K I +E+P + TN   A   +  F  I   F E   VL VR +++ I
Sbjct:  212 VFLAGSSLNGFGSRSSDADLCLVVQDGPVNQRTDAVY---ILSRVQRLLYKLS-YIERPQLIRAKVPILKFRDRISGVEFDLNVNNVVGIRNTFLLRTYAHIERRVRPIILVIKKWASHNKINDASRGTLSSYTLVLMVLHYLQTLPEPVIPCL--QKDYPECFSPVMDIHLVPDGPRN------IPPFVSKNQS-----SLGDLLLGFLKYYATVFRWDKFVISVREGKALPRPNSWEWKNKFICVEEPFDGTNTARAVHEKMKFDAIKAQFTESWQVLQVRKDLDYI 483          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: tent2 (terminal nucleotidyltransferase 2 [Source:NCBI gene;Acc:103039892])

HSP 1 Score: 77.0258 bits (188), Expect = 7.323e-15
Identity = 63/248 (25.40%), Postives = 122/248 (49.19%), Query Frame = 1
Query:  319 VYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPILPDRPKYSDNKRP---------RPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTK-NWIFKVIAIE 1023
            V+L GS + G   R+SD D+ ++  +    +  + +    +L R++  L +L+ + E   +  A++PI++ + +   +  D++ +N + I NT ++R Y+ ++ RV  +  ++K   +  +I DA  GTLSS+   LM++H+LQ     V+P L  +  Y +   P          P+N           + N +     S+ +L + F KYY   F ++  V+S+R+ + L +     W  K I +E
Sbjct:  212 VFLAGSSLNGFGSRSSDADLCLVVQDGPVNQRTDAVY---ILSRVQRLLYKLS-YIERPQLIRAKVPILKFRDRISGVEFDLNVNNVVGIRNTFLLRTYAHIERRVRPIILVIKKWASHNKINDASRGTLSSYTLVLMVLHYLQTLPEPVIPCL--QKDYPECFSPVMDIHLVPDGPRN------IPPFVSKNQS-----SLGDLLLGFLKYYATVFRWDKFVISVREGKALPRPNSWEWKNKFICVE 442          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: mtpap (mitochondrial poly(A) polymerase [Source:NCBI gene;Acc:103037561])

HSP 1 Score: 61.6178 bits (148), Expect = 6.893e-10
Identity = 45/167 (26.95%), Postives = 88/167 (52.69%), Query Frame = 1
Query:  490 IEGVYSARIPIIR-CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGT-LSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPK-----NNCEM-WHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQ 966
            ++ + +AR P++R      + R D++A+N +A+ ++E++  Y  +D R+  L   +++    + I ++  G  +++F  T++++ FLQ+R    +LP   +  D   P  K     N+C M    S IT   N  +LE+ + E    FF++Y   FDF    ++IR+
Sbjct:  304 VQKILNARCPLVRFSHQPSSFRCDLTANNRVAMKSSEMLFIYGSLDERLRFLVFTIRYWARAHGITNSFPGAWITNFSLTMLVVFFLQQRTP-ALLPTLNQLRDLAGPSDKCVIEGNDCTMVTDLSKITLQQNTDTLEKLLQE----FFEFYG-SFDFGKSSINIRK 464          
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Match: PAP2 (Non-canonical poly(A) polymerase; involved in nuclear RNA degradation as a component of TRAMP; catalyzes polyadenylation of hypomodified tRNAs, and snoRNA and rRNA precursors; required for mRNA surveillance and maintenance of genome integrity, serving as a link between RNA and DNA metabolism; overlapping but non-redundant functions with Trf5p; relocalizes to cytosol in response to hypoxia [Source:SGD;Acc:S000005475])

HSP 1 Score: 64.6994 bits (156), Expect = 9.085e-12
Identity = 71/313 (22.68%), Postives = 133/313 (42.49%), Query Frame = 1
Query:  214 EFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIR-CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLL--KSTKNWIFKV-----IAIEDPSNITNAIGA---NIRQNDFQKILDAFCEVLLVR 1119
            +F++  + SR E   R +    I   + + + + D++++GS+ T L    SD+D  V         +L     +  L  + ++L + N   E+E V  AR+PII+  +    + +D+S   T  I+  +++RE+ D  P +  L  ++K  ++   + +  +G L  F    ++  FL            P+   N+   PK+N  +                     L I+FF+ Y   F ++   +      P+   KST + I  +     +AI+DP + +N I     NIR  D +K      ++L  R
Sbjct:  185 DFVAYISPSREEIEIRNQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCVV-------TSELGGKESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFERTNGIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICLVFSFLHM---------HPRIITNEI-DPKDNLGV---------------------LLIEFFELYGKNFGYDDVALGSSDGYPVYFPKSTWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIR--DIKKAFAGAFDLLTNR 457          
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Match: TRF5 (Non-canonical poly(A) polymerase; involved in nuclear RNA degradation as a component of the TRAMP complex; catalyzes polyadenylation of hypomodified tRNAs, and snoRNA and rRNA precursors; overlapping but non-redundant functions with Pap2p [Source:SGD;Acc:S000005243])

HSP 1 Score: 60.4622 bits (145), Expect = 2.152e-10
Identity = 69/309 (22.33%), Postives = 130/309 (42.07%), Query Frame = 1
Query:  214 EFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIR-CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFK-------VIAIEDPSNITNAIG-ANIRQNDFQKILDAFCEVLL 1113
            +F+   + S++E + R +    +   + E + + D++++GS  T L    SD+D  V   NR   ED N I +  + + ++N  L +     +E +   R+PII+  + +  L +D+S   T  ++  +++RE+    P +  L  ++K  ++   + +  +G L  F    ++  FL                 N  PR K+N       DI  ++N       +  L IDFF+ Y   F ++   +SI            W           +AI+DP +  N I   +    D +K      E+L+
Sbjct:  182 DFVHYISPSKNEIKCRNRTIDKLRRAVKELWSDADLHVFGSFATDLYLPGSDIDCVVNSRNRDK-EDRNYIYE--LARHLKNKGLAI----RMEVIVKTRVPIIKFIEPQSQLHIDVSFERTNGLEAAKLIREWLRDSPGLRELVLIIKQFLHSRRLNNVHTGGLGGFTVICLVYSFL-----------------NMHPRIKSN-------DIDVLDN-------LGVLLIDFFELYGKNFGYDDVAISISDGYASYIPKSCWRTLEPSRSKFSLAIQDPGDPNNNISRGSFNMKDIKKAFAGAFELLV 452          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO43972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX54])

HSP 1 Score: 154.451 bits (389), Expect = 1.252e-42
Identity = 98/314 (31.21%), Postives = 169/314 (53.82%), Query Frame = 1
Query:  139 LYSPVLNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKNLR-VDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPR---PKNNCEMWHYSDITNMNNAQSLE--RSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANI 1062
            L  PV+ A+  +   Y+  +    +       ++  E + RQ+   ++E+ I E +    +YL+GS V G   + SDLDI +   + K+ +D++ I   +++  +   L Q +    +  + +A++PI++   +   R  DIS  NT+A++N+ ++R Y+D+D RV  LG  LK    + +IGDA  G+LSS+ Y LML+H+LQ     P++P   +  + + P       NC  W+Y+D+ N+      +   S+  LW+ F +YYT  FD+E +VV  R+ + L K  K W     AIEDP N+++ +GA I
Sbjct:   38 LKKPVIVALPRMTKVYQNIIDAACIRVGETMGLNHMEGQFRQEVLRNLEDYIREVYPAACLYLFGSSVNGFGFKESDLDICMTL-DGKTKDDVDPI---KVIHDLSKKLKQHSDIRNVLAITTAKVPIVKFYIRSVKREGDISLYNTLALENSRMLRTYADLDVRVRQLGFTLKIFAKVCDIGDASKGSLSSYAYILMLLHYLQTCQP-PVIPILQELHNGQCPNNMIEGWNC--WYYNDLPNLPKVWKSKNRESVGLLWLGFLRYYTETFDWEHDVVCCRRSKRLTKFEKMWTKHEFAIEDPFNLSHNLGAGI 344          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2S2])

HSP 1 Score: 71.2478 bits (173), Expect = 3.082e-14
Identity = 63/205 (30.73%), Postives = 100/205 (48.78%), Query Frame = 1
Query:  499 VYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPK-------YSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPL-LKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKI 1086
            V  A +PI+  + + ++L  DIS  NT  + NT ++R Y ++D RV  L  ++K       I +AR   LS F   L++IH+LQ     P+LP   +       +S++   +   + E   Y+       +     SI EL + FF+YY+  F++   V+S+R    L L   K W    I IEDP++ TN   +  R   FQ+I
Sbjct:    4 VSGAVVPIVILQDRSRDLEGDISYENTNTVFNTFLMRCYGELDSRVKPLVIVIKAWAQSARITNARDHKLSGFALVLLVIHYLQVGCSPPVLPSLQQDPQFHGFFSESSALKVAEHLEN-EYTPPPVSLYSSRSSASIGELLVGFFRYYS-SFNW-ARVLSVRTAGFLPLPYNKKWRNPEIRIEDPTDRTNVARSVYRLYPFQEI 205          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000016466.3 (pep primary_assembly:ASM223467v1:4:22253493:22270034:-1 gene:ENSORLG00000013135.3 transcript:ENSORLT00000016466.3 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 8.919e-39
Identity = 90/270 (33.33%), Postives = 145/270 (53.70%), Query Frame = 1
Query:  313 VDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKK-NLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH---YSDITNMN----NAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAF 1098
              + L+GS   G   R+SDLDI +      S E LN    K +++ +   L +      I  + +A++PI++ + ++  L  DIS  NT+A  NT ++  Y+ +DPRV  LG  +K      +IGDA  G+LSS+ Y LM+++FLQ+R   P++P   +  D     P+   + W+   + DI ++       Q    S+ ELW+   ++YT EFDF+  V+SIRQ++ L    K W  K IAIEDP ++ + +GA + +     I+ AF
Sbjct:    3 AQLCLFGSSKNGFGFRDSDLDICMTLEGHDSAEKLNC---KEIIEGLAKVLKKHTGLRNILPITTAKVPIVKFEHRQSGLEGDISLYNTLAQHNTRMLATYAALDPRVQFLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRQP-PVIPVLQEIFDGTT-VPQRMVDGWNAFFFDDIADLRQRLAGRQPNMESVGELWLGLLRFYTEEFDFKEHVISIRQRKRLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 267          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000002130.2 (pep primary_assembly:ASM223467v1:9:5319511:5326523:-1 gene:ENSORLG00000001714.2 transcript:ENSORLT00000002130.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 1.507e-29
Identity = 80/245 (32.65%), Postives = 128/245 (52.24%), Query Frame = 1
Query:  301 KFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPI---LPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIE 1023
            +F    + L+GS   G   R SDLDI ++   +++I+D++ I   R+++ +   L +      I  + +A++PI++      +L  DIS  NT+A+ NT ++  Y+ +D RV IL  ++K    + +IGDA  G+LSS+ YTLM++ FL    V+ I   L  +P +     P+   N E                  SI ELW+   ++YT +FDF+  VVSIRQ+  L   +K W  K I IE
Sbjct:  296 QFAGARLQLFGSSKNGFGFRQSDLDICMVLEGKENIDDVDCI---RIIESLARCLKKNPDLKNILPITTAKVPIVKFYHINTSLEGDISLYNTLALHNTHLLASYAAIDRRVKILCYVMKVFAKMCDIGDASRGSLSSYAYTLMVLFFLHTLKVVWIFVLLLLQPSH----WPQHGKNTE------------------SIGELWLGLLRFYTEDFDFKEHVVSIRQRARLTTFSKQWTSKYIVIE 515          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: tent2 (terminal nucleotidyltransferase 2 [Source:NCBI gene;Acc:101155937])

HSP 1 Score: 108.612 bits (270), Expect = 2.096e-25
Identity = 88/306 (28.76%), Postives = 151/306 (49.35%), Query Frame = 1
Query:  292 IDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTK-KNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQ--KRNVLPIL----PD--RPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKS-TKNWIFKVIAIEDP---SNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEI--SRKIHNQES 1164
            I   F    +YL GS + GL  R+SD D+ ++    K  + L+ +++ R L R  +Y+       E   +  A++PI++ K K  +L  D++ +NT+ I NT ++R Y+  DPRV  +  ++K     ++I DA  GTLSS+   LM++H+LQ  +  VLP L    PD   P    +  P         H     + N +     S+ EL + F +YY  EF ++ +V+S+R+     K+  + W  K I +E+P   +N+  A+   ++ +  +         L  R ++N I   R I N+E+
Sbjct:  186 IQSIFSVARLYLTGSSMNGLGCRSSDADLCLVITGNKKPDPLSVLSRLRKLFRTLSYV-------EGTCLIRAKVPILKFKEKGSDLEFDLNINNTVGIRNTFLLRSYAHADPRVRPMILVVKKWACHHQINDASKGTLSSYTLVLMVLHYLQTVRDPVLPSLQRDHPDCFSPCMEIDMVPEGST-----HVPPYISRNQS-----SLGELLLGFLRYYASEFSWDKQVISVREATAFPKTYAQEWRKKFICVEEPFERNNVARAVHEKLKFDAIKAQFFQSSRKLQARRDLNSILPLRAIINKEA 474          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037624.1 (pep primary_assembly:ASM223467v1:9:5319511:5322186:-1 gene:ENSORLG00000001714.2 transcript:ENSORLT00000037624.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 1.558e-12
Identity = 52/176 (29.55%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  499 VYSARIPIIRC-KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIE 1023
            + +A++PI++      +L  DIS  NT+A+ NT ++  Y+ +D RV IL  ++K    +Y  G  +   L   G+    ++F      LP          +  P+   N E                  SI ELW+   ++YT +FDF+  VVSIRQ+  L   +K W  K I IE
Sbjct:   15 ITTAKVPIVKFYHINTSLEGDISLYNTLALHNTHLLASYAAIDRRVKILCYVMKVFAKIY-FGKHKPEVLVD-GWN---VYFFDDLKTLP----------SHWPQHGKNTE------------------SIGELWLGLLRFYTEDFDFKEHVVSIRQRARLTTFSKQWTSKYIVIE 157          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: mtpap (mitochondrial poly(A) polymerase [Source:NCBI gene;Acc:101160027])

HSP 1 Score: 68.1662 bits (165), Expect = 6.433e-12
Identity = 69/254 (27.17%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  304 FYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLN------NITQKRMLKRI--ENYLLQ---------LNKFAE----IEGVYSARIPIIR-CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGT-LSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPK-----NNCEMWHYSDITNMN---NAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQ 972
            F    +  +GS V G      DLD   +F +  SI   N       +  +  +KR   E  + Q         L+ F      ++ + +AR P++R        + D++A+N +A+ +TE++  Y ++DPRV  L   ++     + I  +  G  +S+F  T+M++ FLQKRN  PI+P   +  D   P  K     N+C     SD T +    N ++LE     L  +FF++Y   F F    V IR+ +
Sbjct:  223 FPECTIKPFGSSVNGFGKLGCDLD---MFLDLDSISGWNVKMPKSGLFTEYQMKRASSERAVTQSVLSVIGECLDHFGPGCVGVQKILNARCPLLRFVHQPSGFQCDLTANNRVAMKSTELLYLYGELDPRVRRLVFTVRCWARAHGITSSIPGAWISNFSLTVMVLFFLQKRNP-PIIPTLDQLRDLAGPADKSVIEGNDCTF--VSDFTKIQLRRNTEALE----HLLYEFFEFYAT-FPFSRMSVDIRKGK 465          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000007097.1 (SMESG000007097.1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 374/378 (98.94%), Postives = 376/378 (99.47%), Query Frame = 1
Query:   82 MFYTNYSNNRRSFYLNGHFLYSPVLNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEISRKIHNQESKSFYRQCSTFANEFSFL 1215
            MFYTNYSNNRRSFYLNGHFLYSPVLNAIDSIDGTYKRKLRHILLEFISNNTIS+SEQRSR+KEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKF EIEGVYSARIPIIRCKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMW YSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEISRKIHNQESKSFYRQCSTFANEFSFL
Sbjct:    1 MFYTNYSNNRRSFYLNGHFLYSPVLNAIDSIDGTYKRKLRHILLEFISNNTISKSEQRSRKKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFTEIEGVYSARIPIIRCKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWRYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEISRKIHNQESKSFYRQCSTFANEFSFL 378          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000007092.1 (SMESG000007092.1)

HSP 1 Score: 464.922 bits (1195), Expect = 1.096e-163
Identity = 229/364 (62.91%), Postives = 281/364 (77.20%), Query Frame = 1
Query:   79 LMFYTNYSNNRRSFYLNGHFLYSPVLNAIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLER---SITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEISRKIHNQE 1161
            L+ +   SN + SFYLN H LYS V ++IDSI+  YKRKL  +L EF ++NT+  SEQ S+++E  DI + I + F+N DVYL+GS +TGLAH+ SDLDITVLF++R S+ DL N TQ   L  IENY  QLN+F+EIEG+YSAR PI++ KTK NL VDISASNTIA+DNTE++R YS +DPR+ ILGR+LKHVV LYEI D R+GTLSSFGYTLMLIHFLQKRNVLPIL DRP YS N+RPRP  +CEMWH  D   +NNA +      SI ELWI FFKYYTMEFDF+ EV++IRQ QPLLKSTK W   +++IEDP++ TN +G NI    +QKILDAFCEVLL +GNIN+IS KIH+Q+
Sbjct:    2 LLCHAANSNPKTSFYLNRHRLYSQVKDSIDSINDDYKRKLWQVLYEFFNSNTMHPSEQESKKRELADIRSYIKQTFFNTDVYLFGSAITGLAHKGSDLDITVLFYHRNSVLDLTNKTQINKLATIENYFTQLNRFSEIEGIYSARRPILKVKTKTNLSVDISASNTIAVDNTELIRLYSILDPRLEILGRMLKHVVKLYEICDTRTGTLSSFGYTLMLIHFLQKRNVLPILSDRPTYSKNRRPRPIYSCEMWHVPDSVKLNNAWTCNSPGLSINELWIAFFKYYTMEFDFQTEVINIRQIQPLLKSTKMWTHIMMSIEDPTDTTNNVGYNISFLYYQKILDAFCEVLLAKGNINDISEKIHSQK 365          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000007068.1 (SMESG000007068.1)

HSP 1 Score: 229.95 bits (585), Expect = 9.506e-72
Identity = 133/338 (39.35%), Postives = 210/338 (62.13%), Query Frame = 1
Query:  160 AIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEISRKIHNQESKSF 1173
             + SID  +K +LR +L +F   N I+ +EQ   +  F +I   I++ F N  +Y+YGSHV+GLA + SDLDI VLFH+RK+   L    QK  L  +  Y  ++ K+ ++  +  ARIP+I+ +T   + VD+S  N  A+++TE++R YS +     +L +LLK+VV LY IG+A  GTLSS+GY +MLIHFLQK+ +LP+L ++  + +  RP  K  C+ +   +I  + N  + +  + +LWIDFF+YYT+EF+   EVVSIR  +P+ K  K W    +AIE+P + ++  G+++ + +F KI D+F +VL  +G++N I +      S SF
Sbjct:   21 VLHSIDNEWKTELREVLKQFYHKNHITVNEQEEIKALFNEIACIINDNFSNAIIYVYGSHVSGLAIKYSDLDIAVLFHDRKNFIYLPKGGQKFKLDMMYTYFSRMKKYLKLIFISKARIPLIKFQTFDGVDVDVSVDNFQAMESTELLRIYSSLSSYFVVLAQLLKNVVKLYGIGEAYEGTLSSYGYMVMLIHFLQKKEILPVLHEKYNHYE-IRPNFK-ACQNFFVPNINEIKNLWN-DFLLVDLWIDFFRYYTLEFNVLYEVVSIRHSRPVTKCEKKWR-SFLAIENPLDPSSDCGSHLNETNFNKIFDSFRDVLFAKGDVNRIFQNRPPGNSTSF 354          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000007086.1 (SMESG000007086.1)

HSP 1 Score: 219.55 bits (558), Expect = 1.167e-64
Identity = 132/343 (38.48%), Postives = 201/343 (58.60%), Query Frame = 1
Query:  160 AIDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWHYSDITNMN---NAQSLERSITELWIDFFKYYT--MEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEI---SRKIHNQES 1164
            A+ SID      L+ IL +      +S  E++  +++FY++ N + +K  NV+VY+YGS+ TG A+R SDLD T+L  + K +  L+  +Q++ LK+           + I  V  A +PI++ K K N+  D+SAS+   I NT + R YS+ DPRV IL +LLKHV  LY I   + GTLSS  Y +M+IHFLQ++++L IL   P+ S ++     +  + W Y D   +N    + S+  SI+ LWI+FFKY+T    FD E +VV+I Q  PL KSTKNW    ++IE+P      +G ++ + +F  I DAF E+L ++G+I +I   SR I  + S
Sbjct:   22 AVASIDENCIENLQTILCQVYRKFQVSEEEEKILKEQFYEVSNLLKQKMTNVNVYVYGSYATGFANRKSDLDTTLLSFSGKRLNQLSKRSQRKKLKQALIIFQAWKGISIIVNVLDATVPILKFKMKNNIDADLSASSIDGIYNTALFRRYSESDPRVLILIQLLKHVTELYNISSRKDGTLSSLSYYIMVIHFLQQKHILKIL---PRSSLDQGLSKFDEDQNWFYRDEEKINKIWKSNSVPDSISSLWIEFFKYFTNRSTFDMENQVVTINQLPPLAKSTKNW-RSFLSIENPIQTNIDLGKDLTKPNFTLIKDAFSEILFLKGDIEKIKIQSRNIKTENS 360          

HSP 2 Score: 137.887 bits (346), Expect = 3.438e-35
Identity = 98/286 (34.27%), Postives = 150/286 (52.45%), Query Frame = 1
Query:  271 FYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFH--NRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIG--DARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEMWH--YSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVL 1110
            FY I N I +K+ ++DV L+GSHVTGL +RNS L+I +LFH  + K ++++N  ++K+ + ++ +YL                    +  T  N  + I A     +    ++R YSD D R+ IL  L++      +IG  +  S  LSS  Y++MLIHFLQK++ L +L +    S N   R    C+MW+     + N  N  +  +SI ELWI FF+YYT EFD +  VVSIR    + KS       ++ IEDP   +  +  NI +   +KI+  F  V+
Sbjct:  402 FYGISNQIKQKYRHLDVCLFGSHVTGLGNRNSKLEINILFHDNDHKILQNINEKSKKKRMNKVNSYL--------------------QIYTNNNSVLKIFAKELHEVFLMILLRRYSDFDSRLCILMILVEEFAVNNQIGCENDNSEMLSSLAYSIMLIHFLQKKHNLKVLSEIE--SANLISRNNFKCDMWYKPTEKVENAWNCAASGKSIAELWIGFFEYYTKEFDAKNLVVSIRHDHTVSKSAIQKSHDLV-IEDPIKPSINLAVNIGKVKLEKIMKIFFLVI 664          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000041562.1 (SMESG000041562.1)

HSP 1 Score: 185.267 bits (469), Expect = 4.928e-51
Identity = 115/333 (34.53%), Postives = 188/333 (56.46%), Query Frame = 1
Query:  163 IDSIDGTYKRKLRHILLEFISNNTISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDITVLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRCKTKKN-LRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPK-NNCEMWHYSDITNMN---NAQS-LERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNINEISR 1143
            ++SID  +  KLR  L     +   +    +  +K F  I   +   +      L+GS + G   + SDLD+ + F+    ++ L+N      LK I   L +LN    I+ +  A++PII+   K N ++ DIS +N++ + NT++++ Y+D+ P V +LG L+K+V    EIGDA  GTLSS+ Y LMLIHFLQKR +LPIL +     + +RP    +  + W+ ++IT +N   N +S    +I  LW+DFF YY +EFD + EVV+IRQ + L K  KNW    +A+EDP N+++ +  ++   + + IL+ F  +L +  N + ++R
Sbjct:  732 LESIDLAWLVKLRAELNAKFKSIVPNNDRPKIAEKIFDKITEIVKALYPIARPQLFGSTINGFMTKASDLDVCLEFYVDDKLQSLSNNEVSNRLKTIGRELKKLNTVQRIDYILKAKVPIIKFYMKNNNIQGDISINNSLGLQNTKMLKVYADLSPCVKLLGNLIKYVAKSCEIGDASQGTLSSYAYMLMLIHFLQKRGILPILQE---LYEGERPTLYIDGWDAWYQTNITIINKLWNKKSNCNINIEYLWLDFFYYYAVEFDIDKEVVTIRQSKQLFKIDKNWQSAYMAVEDPFNLSHNLCGSLSLENARYILECFAHILKLHSNSDNLNR 1061          

HSP 2 Score: 80.4925 bits (197), Expect = 7.934e-16
Identity = 58/186 (31.18%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  529 CKTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEIGDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKY--------SDNKRPRPKNNCEMWHYSD----ITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLLKSTKNWIFKVIAIEDPSNITNAI 1050
            CK K  +   ISASN +   N+E++R Y  +D R   L +L ++  +   I   + G   S  +++++I +LQ+ ++ PILP+  K         SD    R   N     Y +    I  + N  + E S+ ELWI   K+Y ++F+    +VSIR  +P+LKS ++ + + +AIEDP +I   I
Sbjct:  209 CKDKLGVTYHISASNRLQHLNSELIRLYLKIDSRAENLAKLFRYFAHKAFIDQIQDGLFPSESFSILVIFYLQQLSI-PILPNLHKLAELQSQELSDVSVSRVLVNDTQLSYVNGMQWIKQLWNPPANEMSLAELWIGLLKFYLVDFNSWFYMVSIRCTEPVLKSDRHIVNRRLAIEDPFDIKRNI 393          
The following BLAST results are available for this feature:
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUT72.990e-3831.51terminal uridylyl transferase 7 [Source:HGNC Symbo... [more]
TUT74.502e-3831.51terminal uridylyl transferase 7 [Source:HGNC Symbo... [more]
TUT46.160e-3833.33terminal uridylyl transferase 4 [Source:HGNC Symbo... [more]
TUT41.752e-3733.33terminal uridylyl transferase 4 [Source:HGNC Symbo... [more]
TUT41.753e-3733.33terminal uridylyl transferase 4 [Source:HGNC Symbo... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cid-14.692e-2430.36Caffeine Induced Death (S. pombe Cid) homolog [So... [more]
pup-23.444e-2225.87Poly(U) Polymerase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
gld-28.744e-1930.18Poly(A) RNA polymerase gld-2 [Source:UniProtKB/Sw... [more]
gld-28.993e-1929.74Poly(A) RNA polymerase gld-2 [Source:UniProtKB/Sw... [more]
gld-29.361e-1930.18Poly(A) RNA polymerase gld-2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wisp1.561e-1627.65gene:FBgn0260780 transcript:FBtr0073573[more]
wisp1.561e-1627.65gene:FBgn0260780 transcript:FBtr0342743[more]
wisp1.575e-1627.65gene:FBgn0260780 transcript:FBtr0342742[more]
Gld23.578e-1626.91gene:FBgn0038934 transcript:FBtr0305038[more]
Gld23.578e-1626.91gene:FBgn0038934 transcript:FBtr0310204[more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01065131.11.117e-3330.07pep chromosome:GRCz11:23:42272588:42289293:1 gene:... [more]
tent26.983e-2329.49terminal nucleotidyltransferase 2 [Source:NCBI gen... [more]
CABZ01032476.14.616e-2124.92terminal uridylyl transferase 7 [Source:NCBI gene;... [more]
tut41.331e-1030.51terminal uridylyl transferase 4 [Source:ZFIN;Acc:Z... [more]
tent4a2.004e-823.53terminal nucleotidyltransferase 4A [Source:ZFIN;Ac... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyms2.185e-4034.01thymidylate synthetase [Source:Xenbase;Acc:XB-GENE... [more]
tyms3.789e-4034.01thymidylate synthetase [Source:Xenbase;Acc:XB-GENE... [more]
tyms3.795e-4034.01thymidylate synthetase [Source:Xenbase;Acc:XB-GENE... [more]
tyms4.784e-4034.01thymidylate synthetase [Source:Xenbase;Acc:XB-GENE... [more]
tyms5.742e-4034.01thymidylate synthetase [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tut47.458e-3833.33terminal uridylyl transferase 4 [Source:MGI Symbol... [more]
Tut48.264e-3833.33terminal uridylyl transferase 4 [Source:MGI Symbol... [more]
Tut71.173e-3730.61terminal uridylyl transferase 7 [Source:MGI Symbol... [more]
Tut72.522e-3730.61terminal uridylyl transferase 7 [Source:MGI Symbol... [more]
Tent22.285e-2525.78terminal nucleotidyltransferase 2 [Source:MGI Symb... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5VYS8|TUT7_HUMAN2.162e-3731.51Terminal uridylyltransferase 7 OS=Homo sapiens OX=... [more]
sp|B2RX14|TUT4_MOUSE5.781e-3733.33Terminal uridylyltransferase 4 OS=Mus musculus OX=... [more]
sp|Q5TAX3|TUT4_HUMAN8.415e-3733.33Terminal uridylyltransferase 4 OS=Homo sapiens OX=... [more]
sp|Q5BLK4|TUT7_MOUSE1.552e-3630.61Terminal uridylyltransferase 7 OS=Mus musculus OX=... [more]
sp|O64642|URT1_ARATH5.278e-2628.04UTP:RNA uridylyltransferase 1 OS=Arabidopsis thali... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131XI789.928e-4233.33Putative s-m checkpoint control protein cid1 (Frag... [more]
A0A1E1XGQ11.022e-4130.86Putative s-m checkpoint control protein cid1 OS=Am... [more]
A0A2J7PSX71.068e-4130.22Uncharacterized protein (Fragment) OS=Cryptotermes... [more]
A0A1S3H6L01.217e-4130.65terminal uridylyltransferase 4-like OS=Lingula ung... [more]
A0A1S3K3V41.636e-4130.65terminal uridylyltransferase 4 OS=Lingula unguis O... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUT41.733e-4132.42terminal uridylyltransferase 4 [Source:NCBI gene;A... [more]
tent22.162e-1826.30terminal nucleotidyltransferase 2 [Source:NCBI gen... [more]
tent22.162e-1826.30terminal nucleotidyltransferase 2 [Source:NCBI gen... [more]
tent27.323e-1525.40terminal nucleotidyltransferase 2 [Source:NCBI gen... [more]
mtpap6.893e-1026.95mitochondrial poly(A) polymerase [Source:NCBI gene... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PAP29.085e-1222.68Non-canonical poly(A) polymerase; involved in nucl... [more]
TRF52.152e-1022.33Non-canonical poly(A) polymerase; involved in nucl... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO439721.252e-4231.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419753.082e-1430.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000016466.38.919e-3933.33pep primary_assembly:ASM223467v1:4:22253493:222700... [more]
ENSORLT00000002130.21.507e-2932.65pep primary_assembly:ASM223467v1:9:5319511:5326523... [more]
tent22.096e-2528.76terminal nucleotidyltransferase 2 [Source:NCBI gen... [more]
ENSORLT00000037624.11.558e-1229.55pep primary_assembly:ASM223467v1:9:5319511:5322186... [more]
mtpap6.433e-1227.17mitochondrial poly(A) polymerase [Source:NCBI gene... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007097.10.000e+098.94SMESG000007097.1[more]
SMESG000007092.11.096e-16362.91SMESG000007092.1[more]
SMESG000007068.19.506e-7239.35SMESG000007068.1[more]
SMESG000007086.11.167e-6438.48SMESG000007086.1[more]
SMESG000041562.14.928e-5134.53SMESG000041562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005298 ID=SMED30005298|Name=CCHC-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1261bp
TTTCAATAATATAAATTAAGAGACTATTATTAGAATAGAATATTATTGGT
TGAAATTTATGCATGATATTGATTTCATTTAATGTTTTACACAAATTACT
CCAATAACAGAAGATCATTTTATTTAAATGGACATTTTTTATATTCACCT
GTACTAAATGCAATAGACTCCATTGATGGTACCTATAAAAGAAAACTACG
GCATATTTTACTTGAATTTATTTCTAACAATACAATATCTAGAAGTGAAC
AAAGATCCAGACAAAAAGAATTTTATGATATAGAAAATTGTATTGACGAA
AAATTCTATAATGTGGATGTTTATCTATACGGTTCTCATGTCACGGGATT
AGCTCACAGAAACAGTGATTTAGATATCACTGTTCTGTTCCATAACAGAA
AATCAATAGAAGATTTAAATAATATAACACAGAAAAGGATGTTAAAAAGA
ATTGAAAATTATTTACTTCAACTGAACAAATTTGCTGAAATTGAAGGAGT
TTACAGTGCTAGGATACCAATAATAAGATGTAAAACTAAAAAGAACTTGC
GTGTGGACATTTCGGCCAGCAATACGATTGCAATAGACAACACAGAAATT
GTCAGAGAGTATAGTGACATGGATCCTCGAGTATCTATTTTGGGCAGATT
GCTGAAACATGTTGTAAACCTTTATGAAATTGGTGATGCGCGTTCCGGAA
CTTTATCGTCGTTCGGTTACACATTGATGCTAATCCATTTTTTGCAAAAA
AGAAATGTTTTACCAATTCTACCAGATAGACCTAAGTATTCCGACAATAA
ACGCCCAAGGCCAAAGAATAACTGCGAAATGTGGCATTATTCTGACATTA
CAAATATGAATAATGCACAGTCATTAGAACGATCAATTACGGAACTTTGG
ATTGATTTTTTCAAATATTATACAATGGAATTTGATTTTGAAGTCGAGGT
TGTCAGTATTCGGCAGAAACAACCTTTGTTAAAATCCACAAAAAATTGGA
TTTTTAAAGTGATTGCAATTGAAGATCCATCCAATATCACCAATGCCATT
GGAGCTAATATTCGTCAAAATGATTTCCAAAAAATTCTCGATGCATTCTG
TGAAGTTCTTTTGGTCAGAGGAAATATAAATGAAATTTCAAGAAAGATTC
ATAATCAGGAGTCAAAGTCATTTTACAGACAATGTTCAACATTCGCAAAT
GAATTTTCATTTTTATAATAAATTTATTATCCATTATTGTTTCAAATAAA
ATTCTGAATAT
back to top

protein sequence of SMED30005298-orf-1

>SMED30005298-orf-1 ID=SMED30005298-orf-1|Name=SMED30005298-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=379bp
MFYTNYSNNRRSFYLNGHFLYSPVLNAIDSIDGTYKRKLRHILLEFISNN
TISRSEQRSRQKEFYDIENCIDEKFYNVDVYLYGSHVTGLAHRNSDLDIT
VLFHNRKSIEDLNNITQKRMLKRIENYLLQLNKFAEIEGVYSARIPIIRC
KTKKNLRVDISASNTIAIDNTEIVREYSDMDPRVSILGRLLKHVVNLYEI
GDARSGTLSSFGYTLMLIHFLQKRNVLPILPDRPKYSDNKRPRPKNNCEM
WHYSDITNMNNAQSLERSITELWIDFFKYYTMEFDFEVEVVSIRQKQPLL
KSTKNWIFKVIAIEDPSNITNAIGANIRQNDFQKILDAFCEVLLVRGNIN
EISRKIHNQESKSFYRQCSTFANEFSFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0016779nucleotidyltransferase activity
GO:0000166nucleotide binding
GO:0003674molecular_function
GO:0004652polynucleotide adenylyltransferase activity
GO:0005524ATP binding
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002058PAP_assoc
IPR002934Polymerase_NTP_transf_dom
Vocabulary: biological process
TermDefinition
GO:0002244hematopoietic progenitor cell differentiation
GO:0071044histone mRNA catabolic process
GO:1990603dark adaptation
GO:0006397mRNA processing
GO:0021766hippocampus development
GO:0030182neuron differentiation
GO:0043631RNA polyadenylation
GO:0060041retina development in camera-type eye
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.460.10coord: 60..180
e-value: 1.9E-64
score: 219.7
NoneNo IPR availableGENE3DG3DSA:1.10.1410.10coord: 181..340
e-value: 1.9E-64
score: 219.7
NoneNo IPR availablePANTHERPTHR12271POLY A POLYMERASE CID PAP -RELATEDcoord: 29..350
NoneNo IPR availableCDDcd05402NT_PAP_TUTasecoord: 60..178
e-value: 8.03723E-24
score: 93.0055
NoneNo IPR availableSUPERFAMILYSSF81301Nucleotidyltransferasecoord: 37..178
NoneNo IPR availableSUPERFAMILYSSF81631PAP/OAS1 substrate-binding domaincoord: 182..350
IPR002058PAP/25A-associatedPFAMPF03828PAP_assoccoord: 268..321
e-value: 1.9E-13
score: 50.4
IPR002934Polymerase, nucleotidyl transferase domainPFAMPF01909NTP_transf_2coord: 67..125
e-value: 4.8E-9
score: 36.4