Post-GPI attachment to proteins factor 3

Overview
NamePost-GPI attachment to proteins factor 3
Smed IDSMED30005292
Length (bp)1059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Post-GPI attachment to proteins factor 3 (SMED30005292) t-SNE clustered cells

Violin plots show distribution of expression levels for Post-GPI attachment to proteins factor 3 (SMED30005292) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Post-GPI attachment to proteins factor 3 (SMED30005292) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Post-GPI attachment to proteins factor 3 (SMED30005292) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005292

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005292h1SMcG0011297 dd_Smed_v4_11282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005292h1SMcG0011297 dd_Smed_v4_11282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005292h1SMcG0011297 dd_Smed_v4_11282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005292h1SMcG0011297 dd_Smed_v4_11282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005292h1SMcG0011297 dd_Smed_v4_11282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005292h1SMcG0011297 dd_Smed_v4_11282_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005292h1SMcG0011297 dd_Smed_v6_11282_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Human
Match: PGAP3 (post-GPI attachment to proteins phospholipase 3 [Source:HGNC Symbol;Acc:HGNC:23719])

HSP 1 Score: 174.096 bits (440), Expect = 4.568e-51
Identity = 110/303 (36.30%), Postives = 156/303 (51.49%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRN-RNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQK 1036
            SQGD+   +  CV  C  + C G    + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R +  +E ASAVAS LN + +  M  ++   VP SS  Y+        +  AW  +T+FH  DT LTEK DYF A    + + YL  +R   L    +     AL  +    HVSYL L++FDY YN+   V IG  NV+ W+ W L N R L   R  ++  + L  LS+LE  +F P+FW+ D+H++WH  TI + +  + F   D LYL K
Sbjct:   21 SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAG------------WTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCVAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFRALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVVLLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLK 311          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Human
Match: PGAP3 (post-GPI attachment to proteins phospholipase 3 [Source:HGNC Symbol;Acc:HGNC:23719])

HSP 1 Score: 150.984 bits (380), Expect = 1.602e-42
Identity = 103/303 (33.99%), Postives = 148/303 (48.84%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRN-RNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQK 1036
            SQGD+   +  CV  C  + C G    + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R +  +E ASAVAS LN + +  M  ++   VP SS  Y+         C+A+           W   K DYF A    + + YL  +R   L    +     AL  +    HVSYL L++FDY YN+   V IG  NV+ W+ W L N R L   R  ++  + L  LS+LE  +F P+FW+ D+H++WH  TI + +  + F   D LYL K
Sbjct:   21 SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAG------------WTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYH--------TCVAF----------AW---KMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFRALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVVLLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLK 290          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Human
Match: PGAP3 (post-GPI attachment to proteins phospholipase 3 [Source:HGNC Symbol;Acc:HGNC:23719])

HSP 1 Score: 122.865 bits (307), Expect = 3.115e-32
Identity = 91/303 (30.03%), Postives = 130/303 (42.90%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRN-RNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQK 1036
            SQGD+   +  CV  C  + C G    + +    I +++              W C ++CKY CMW TV ++  +G  VPQF                                                   H   +  AW  +T+FH  DT LTEK DYF A    + + YL  +R   L    +     AL  +    HVSYL L++FDY YN+   V IG  NV+ W+ W L N R L   R  ++  + L  LS+LE  +F P+FW+ D+H++WH  TI + +  + F   D LYL K
Sbjct:   21 SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAG------------WTCRDDCKYECMWVTVGLYLQEGHKVPQF---------------------------------------------------HGKVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFRALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVVLLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLK 260          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Human
Match: PGAP3 (post-GPI attachment to proteins phospholipase 3 [Source:HGNC Symbol;Acc:HGNC:23719])

HSP 1 Score: 81.2629 bits (199), Expect = 4.562e-18
Identity = 48/145 (33.10%), Postives = 69/145 (47.59%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISA 565
            SQGD+   +  CV  C  + C G    + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R +  +E ASAVAS LN + +  M  ++   VP SS  Y      +     AW+S 
Sbjct:   21 SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAG------------WTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMY------HTCVAFAWLSG 147          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Human
Match: PGAP3 (post-GPI attachment to proteins phospholipase 3 [Source:HGNC Symbol;Acc:HGNC:23719])

HSP 1 Score: 80.8777 bits (198), Expect = 7.099e-18
Identity = 45/129 (34.88%), Postives = 65/129 (50.39%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYN 517
            SQGD+   +  CV  C  + C G    + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R +  +E ASAVAS LN + +  M  ++   VP SS  Y+
Sbjct:   17 SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAG------------WTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYH 133          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Celegans
Match: R01B10.4 (Post-GPI attachment to proteins factor 3 [Source:UniProtKB/TrEMBL;Acc:O61975])

HSP 1 Score: 117.857 bits (294), Expect = 2.551e-30
Identity = 95/294 (32.31%), Postives = 155/294 (52.72%), Query Frame = 2
Query:  173 YCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNEC---KYICMWETVEVFKNDGLNVPQFFGKWPLLRV-----IGIEEIASAVASVLNLIVTTFMFNKF--LNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYEL------SRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMT---VFVVIGSFNVISWIFWGLRN-RNLHQSRFIMIWXXX-XXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITI 991
            + +++   GD+ I+ ++   +   + KY+ S K  F  L     +C   +Y CMW+T+  F ++   VPQF GKWP L +       I+E AS + S+LNL     M  +F  +  +P  +    +W ++       WIS+++FH+ D   TEK DYF A  F + A Y++VI   +L        ++I++L A ++   FM      ++  FDY YNMT   VF +I +   +  +++  RN  +L +S  ++I  I    L + LE  +FTP+FW+FDSHS++H  TI I I
Sbjct:   15 FVQLEASPGDRSIWYQECTQVC--ISKYNCSTK--FGTLDWARGDCFWCRYDCMWDTIGHFDSNFGVVPQFHGKWPFLAIPLPFGFIIQEPASMIFSLLNLFTVYKMLRRFKKMQNLPNRT----MWLVYAHVGMFTWISSSLFHMFDCDFTEKMDYFGAYSFVLFALYVSVIFTKQLQFLGRGGPKYIQILFALVYLNHFM-----KMMQNFDYGYNMTCCIVFSLITTCLYVHHLYYRKRNLGSLQESDIVLIRLIIWANLSTALEILDFTPVFWIFDSHSLFHLATIPIPI 295          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Fly
Match: PGAP3 (gene:FBgn0033088 transcript:FBtr0086119)

HSP 1 Score: 170.629 bits (431), Expect = 4.897e-50
Identity = 104/308 (33.77%), Postives = 154/308 (50.00%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWG--LRNRNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGK 1048
            S GD+T  FH C   C    C  D    +++         K+           W C +EC+Y CMW TV  F   G  +PQF+GKWP LR++G++E AS + S LN +V   +  KF   V   S CY L  +  +T+   WI + IFH  D  LTE  DY  A    + + Y+ V+R+      F++ +I   F  +++ + +YL + +F+Y +NM V V  G    + W  W   +R R  +  R I+ + I +AL   LE  +F PI W+ D+H++WH  TI +    Y F I DC  L+K K  
Sbjct:   23 SNGDRTQFFHNCRQNCERTNCSADGLEIQEQ-------AVKFYQQSVFDRLFQWSCADECQYGCMWRTVFAFFERGWPIPQFYGKWPFLRLLGMQEPASVIFSCLNFVVHLRLLRKFRREVRPDSPCYMLTHIFAVTSLNGWIWSAIFHTRDFPLTELLDYAFAYSIILCSLYVMVMRMLHRYSLFLRGVITLAFLSYYINYFAYLSVGRFNYAFNMMVNVATGVIAAVGWFVWCHFVRTRRPYFRR-ILRFYILMALAMSLELLDFPPILWILDAHALWHLATIPLASLYYDFMIEDCRTLRKEKAA 322          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Fly
Match: PGAP3 (gene:FBgn0033088 transcript:FBtr0086118)

HSP 1 Score: 159.458 bits (402), Expect = 9.786e-46
Identity = 96/285 (33.68%), Postives = 144/285 (50.53%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWG--LRNRNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTI 979
            S GD+T  FH C   C    C  D    +++         K+           W C +EC+Y CMW TV  F   G  +PQF+GKWP LR++G++E AS + S LN +V   +  KF   V   S CY L  +  +T+   WI + IFH  D  LTE  DY  A    + + Y+ V+R+      F++ +I   F  +++ + +YL + +F+Y +NM V V  G    + W  W   +R R  +  R I+ + I +AL   LE  +F PI W+ D+H++WH  TI
Sbjct:   23 SNGDRTQFFHNCRQNCERTNCSADGLEIQEQ-------AVKFYQQSVFDRLFQWSCADECQYGCMWRTVFAFFERGWPIPQFYGKWPFLRLLGMQEPASVIFSCLNFVVHLRLLRKFRREVRPDSPCYMLTHIFAVTSLNGWIWSAIFHTRDFPLTELLDYAFAYSIILCSLYVMVMRMLHRYSLFLRGVITLAFLSYYINYFAYLSVGRFNYAFNMMVNVATGVIAAVGWFVWCHFVRTRRPYFRR-ILRFYILMALAMSLELLDFPPILWILDAHALWHLATI 299          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Zebrafish
Match: pgap3 (post-GPI attachment to proteins phospholipase 3 [Source:NCBI gene;Acc:100136873])

HSP 1 Score: 171.014 bits (432), Expect = 4.207e-50
Identity = 106/308 (34.42%), Postives = 158/308 (51.30%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKF--IYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIW------XXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYL 1030
            SQGD+   +  CV +C    C G +       + P++ L                W C ++C+Y CMW TV +++ +G ++PQF GKWP  R +  EE ASA+AS+LN +    M  ++ + VP+ S  Y+      + +  AW  +T+FH  DT+LTEK DYF A    + + YL  +R   L R  I  ++  L  + F  HVSYL  V FDY YNM     IG  N++ W+ W   NR     R +  W       + L  L++LE  +F P+FW+ D+H++WH  T+ +    Y F I D L+L
Sbjct:   17 SQGDKEPVYRDCVKHCVRTNCTGARLRGFQSTQPPYMALTG--------------WTCRDDCRYQCMWTTVGLYQAEGYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPRQSPMYHTITAFSLVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLLILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNR-----RILPYWWKCGMVVLLLHGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHL 305          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Zebrafish
Match: pgap3 (post-GPI attachment to proteins phospholipase 3 [Source:NCBI gene;Acc:100136873])

HSP 1 Score: 171.014 bits (432), Expect = 4.380e-50
Identity = 106/308 (34.42%), Postives = 158/308 (51.30%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKF--IYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIW------XXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYL 1030
            SQGD+   +  CV +C    C G +       + P++ L                W C ++C+Y CMW TV +++ +G ++PQF GKWP  R +  EE ASA+AS+LN +    M  ++ + VP+ S  Y+      + +  AW  +T+FH  DT+LTEK DYF A    + + YL  +R   L R  I  ++  L  + F  HVSYL  V FDY YNM     IG  N++ W+ W   NR     R +  W       + L  L++LE  +F P+FW+ D+H++WH  T+ +    Y F I D L+L
Sbjct:   21 SQGDKEPVYRDCVKHCVRTNCTGARLRGFQSTQPPYMALTG--------------WTCRDDCRYQCMWTTVGLYQAEGYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPRQSPMYHTITAFSLVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLLILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNR-----RILPYWWKCGMVVLLLHGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHL 309          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Zebrafish
Match: pgap3 (post-GPI attachment to proteins phospholipase 3 [Source:NCBI gene;Acc:100136873])

HSP 1 Score: 169.088 bits (427), Expect = 1.884e-49
Identity = 105/307 (34.20%), Postives = 157/307 (51.14%), Query Frame = 2
Query:  134 QGDQTFNFHRCVGYCRMKFCRGDKF--IYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIW------XXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYL 1030
            QGD+   +  CV +C    C G +       + P++ L                W C ++C+Y CMW TV +++ +G ++PQF GKWP  R +  EE ASA+AS+LN +    M  ++ + VP+ S  Y+      + +  AW  +T+FH  DT+LTEK DYF A    + + YL  +R   L R  I  ++  L  + F  HVSYL  V FDY YNM     IG  N++ W+ W   NR     R +  W       + L  L++LE  +F P+FW+ D+H++WH  T+ +    Y F I D L+L
Sbjct:   18 QGDKEPVYRDCVKHCVRTNCTGARLRGFQSTQPPYMALTG--------------WTCRDDCRYQCMWTTVGLYQAEGYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPRQSPMYHTITAFSLVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLLILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNR-----RILPYWWKCGMVVLLLHGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHL 305          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Xenopus
Match: lrba (LPS-responsive vesicle trafficking, beach and anchor containing [Source:Xenbase;Acc:XB-GENE-951020])

HSP 1 Score: 172.555 bits (436), Expect = 1.352e-50
Identity = 107/306 (34.97%), Postives = 154/306 (50.33%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRF--IMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLK 1042
            S+GD+   +  CV  C    C G +    +    + + V              W C ++C+Y CMW TV ++  +G  VPQF GKWP  R +  +E ASA+AS LN + +  M  ++ + VP S Q Y       + +  AW  +TIFH  DT LTEK DYF A    + + YL  +R + L    I     A   + F  HVSYL L +FDY+YNM      G  N++ W+ W  R R  HQ      ++  ISL  L++LE  +F P+ W+ D+H++WHF T+ +    Y F   D LYL K+ 
Sbjct:   16 SRGDREPVYRDCVTLCERNNCTGSRLTDFRAEQPLYMRVTG------------WTCLDDCRYQCMWYTVSLYLKEGHEVPQFHGKWPFSRFLFFQEPASALASFLNGVASLLMLLRYRSSVPSSCQMYRTCLAFSMVSVNAWFWSTIFHTRDTALTEKMDYFCASSVILHSIYLCCMRTFGLQYPSIANGFGAFLVLLFACHVSYLTLGRFDYSYNMAANTGFGVLNLMWWLAWCFR-RRFHQPYLWKCVLVVISLQSLALLELLDFPPVMWILDAHALWHFSTVPLHFLFYSFLKDDSLYLLKIN 308          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Xenopus
Match: lrba (LPS-responsive vesicle trafficking, beach and anchor containing [Source:Xenbase;Acc:XB-GENE-951020])

HSP 1 Score: 159.073 bits (401), Expect = 1.406e-45
Identity = 102/306 (33.33%), Postives = 150/306 (49.02%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRF--IMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLK 1042
            S+GD+   +  CV  C    C G +    +    + + V              W C ++C+Y CMW TV ++  +G  VPQF GKWP  R +  +E ASA+AS LN + +  M  ++ + VP S Q Y       + +  AW  +TIFH  DT LTE        L  +S+  +  +R + L    I     A   + F  HVSYL L +FDY+YNM      G  N++ W+ W  R R  HQ      ++  ISL  L++LE  +F P+ W+ D+H++WHF T+ +    Y F   D LYL K+ 
Sbjct:   16 SRGDREPVYRDCVTLCERNNCTGSRLTDFRAEQPLYMRVTG------------WTCLDDCRYQCMWYTVSLYLKEGHEVPQFHGKWPFSRFLFFQEPASALASFLNGVASLLMLLRYRSSVPSSCQMYRTCLAFSMVSVNAWFWSTIFHTRDTALTE-------CLIPISSPCVCPLRTFGLQYPSIANGFGAFLVLLFACHVSYLTLGRFDYSYNMAANTGFGVLNLMWWLAWCFR-RRFHQPYLWKCVLVVISLQSLALLELLDFPPVMWILDAHALWHFSTVPLHFLFYSFLKDDSLYLLKIN 301          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Mouse
Match: Pgap3 (post-GPI attachment to proteins 3 [Source:MGI Symbol;Acc:MGI:2444461])

HSP 1 Score: 188.734 bits (478), Expect = 6.516e-57
Identity = 115/308 (37.34%), Postives = 161/308 (52.27%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRN-LHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGKI 1051
            SQGD+   +  CV  C  + C GD   + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R + I+E ASAVAS+LN + +  M  ++   VP SS  Y+        +  AW  +T+FH  DT LTEK DYF A    + + YL  +R   L    +     AL  +    H+SYL LV FDY YNM   V IG  N+  W+ W LRNR  L  +R  M+  + L  LS+LE  +F P+FW+ D+H++WH  TI +    ++F   D LYL K  G +
Sbjct:   21 SQGDREPVYRDCVLRCEERNCSGDALKHFRSRQPIYMSLAG------------WTCRDDCKYECMWFTVGLYLQEGHRVPQFHGKWPFSRFLFIQEPASAVASLLNGLASLVMLCRYRASVPASSPMYHTCMAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASAVILHSVYLCCVRTVGLQHPSVASAFGALLLLLLTGHISYLSLVHFDYGYNMMANVAIGLVNLAWWLVWCLRNRQRLPHTRRCMVVVVLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHTLFFRFLEDDSLYLLKESGAM 316          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Mouse
Match: Pgap3 (post-GPI attachment to proteins 3 [Source:MGI Symbol;Acc:MGI:2444461])

HSP 1 Score: 132.88 bits (333), Expect = 3.761e-36
Identity = 95/308 (30.84%), Postives = 133/308 (43.18%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRN-LHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGKI 1051
            SQGD+   +  CV  C  + C GD   + +    I +++              W C ++CKY CMW TV ++  +G  VPQF                                                   H   +  AW  +T+FH  DT LTEK DYF A    + + YL  +R   L    +     AL  +    H+SYL LV FDY YNM   V IG  N+  W+ W LRNR  L  +R  M+  + L  LS+LE  +F P+FW+ D+H++WH  TI +    ++F   D LYL K  G +
Sbjct:   21 SQGDREPVYRDCVLRCEERNCSGDALKHFRSRQPIYMSLAG------------WTCRDDCKYECMWFTVGLYLQEGHRVPQF---------------------------------------------------HGKVSLNAWFWSTVFHTRDTDLTEKMDYFCASAVILHSVYLCCVRTVGLQHPSVASAFGALLLLLLTGHISYLSLVHFDYGYNMMANVAIGLVNLAWWLVWCLRNRQRLPHTRRCMVVVVLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHTLFFRFLEDDSLYLLKESGAM 265          
BLAST of Post-GPI attachment to proteins factor 3 vs. UniProt/SwissProt
Match: sp|A2A559|PGAP3_MOUSE (Post-GPI attachment to proteins factor 3 OS=Mus musculus OX=10090 GN=Pgap3 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 4.558e-56
Identity = 115/308 (37.34%), Postives = 161/308 (52.27%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRN-LHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGKI 1051
            SQGD+   +  CV  C  + C GD   + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R + I+E ASAVAS+LN + +  M  ++   VP SS  Y+        +  AW  +T+FH  DT LTEK DYF A    + + YL  +R   L    +     AL  +    H+SYL LV FDY YNM   V IG  N+  W+ W LRNR  L  +R  M+  + L  LS+LE  +F P+FW+ D+H++WH  TI +    ++F   D LYL K  G +
Sbjct:   21 SQGDREPVYRDCVLRCEERNCSGDALKHFRSRQPIYMSLAG------------WTCRDDCKYECMWFTVGLYLQEGHRVPQFHGKWPFSRFLFIQEPASAVASLLNGLASLVMLCRYRASVPASSPMYHTCMAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASAVILHSVYLCCVRTVGLQHPSVASAFGALLLLLLTGHISYLSLVHFDYGYNMMANVAIGLVNLAWWLVWCLRNRQRLPHTRRCMVVVVLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHTLFFRFLEDDSLYLLKESGAM 316          
BLAST of Post-GPI attachment to proteins factor 3 vs. UniProt/SwissProt
Match: sp|A2V7M9|PGAP3_CRIGR (Post-GPI attachment to proteins factor 3 OS=Cricetulus griseus OX=10029 GN=PGAP3 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 6.326e-55
Identity = 112/306 (36.60%), Postives = 162/306 (52.94%), Query Frame = 2
Query:  122 SYCSQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRN-RNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQK 1036
            ++ SQGD+   +  CV  C  + C GD   + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R + I+E ASAVAS+LN + +  M  ++   VP SS  Y+        +  AW  +T+FH  DT LTEK DYF A    + + YL  +R   L    +     A   +  + H SYL LV+FDY+YNM   V IG  N+  W+ W LRN R L  +R  +   + L  LS+LE  +F P+FW+ D+H++WH  TI + +  ++F   D LYL K
Sbjct:   18 AWGSQGDREPVYRDCVLRCEERNCSGDALKHFRSLQPIYMSLAG------------WTCRDDCKYECMWITVGLYLQEGHRVPQFHGKWPFSRFLFIQEPASAVASLLNGLASLVMLCRYRASVPASSPMYHTCMAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASAVILHSIYLCCVRTVGLQHPSVARAFGATLLLMLLLHTSYLSLVRFDYSYNMMANVAIGLVNLAWWLAWCLRNHRRLPHTRKCVAVVLLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFRFLEDDSLYLLK 311          
BLAST of Post-GPI attachment to proteins factor 3 vs. UniProt/SwissProt
Match: sp|Q96FM1|PGAP3_HUMAN (Post-GPI attachment to proteins factor 3 OS=Homo sapiens OX=9606 GN=PGAP3 PE=1 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 2.194e-50
Identity = 110/303 (36.30%), Postives = 156/303 (51.49%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRN-RNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQK 1036
            SQGD+   +  CV  C  + C G    + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R +  +E ASAVAS LN + +  M  ++   VP SS  Y+        +  AW  +T+FH  DT LTEK DYF A    + + YL  +R   L    +     AL  +    HVSYL L++FDY YN+   V IG  NV+ W+ W L N R L   R  ++  + L  LS+LE  +F P+FW+ D+H++WH  TI + +  + F   D LYL K
Sbjct:   21 SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAG------------WTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCVAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFRALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVVLLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLK 311          
BLAST of Post-GPI attachment to proteins factor 3 vs. UniProt/SwissProt
Match: sp|Q0VFE3|PGAP3_XENTR (Post-GPI attachment to proteins factor 3 OS=Xenopus tropicalis OX=8364 GN=pgap3 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 7.161e-50
Identity = 107/306 (34.97%), Postives = 154/306 (50.33%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRF--IMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLK 1042
            S+GD+   +  CV  C    C G +    +    + + V              W C ++C+Y CMW TV ++  +G  VPQF GKWP  R +  +E ASA+AS LN + +  M  ++ + VP S Q Y       + +  AW  +TIFH  DT LTEK DYF A    + + YL  +R + L    I     A   + F  HVSYL L +FDY+YNM      G  N++ W+ W  R R  HQ      ++  ISL  L++LE  +F P+ W+ D+H++WHF T+ +    Y F   D LYL K+ 
Sbjct:   16 SRGDREPVYRDCVTLCERNNCTGSRLTDFRAEQPLYMRVTG------------WTCLDDCRYQCMWYTVSLYLKEGHEVPQFHGKWPFSRFLFFQEPASALASFLNGVASLLMLLRYRSSVPSSCQMYRTCLAFSMVSVNAWFWSTIFHTRDTALTEKMDYFCASSVILHSIYLCCMRTFGLQYPSIANGFGAFLVLLFACHVSYLTLGRFDYSYNMAANTGFGVLNLMWWLAWCFR-RRFHQPYLWKCVLVVISLQSLALLELLDFPPVMWILDAHALWHFSTVPLHFLFYSFLKDDSLYLLKIN 308          
BLAST of Post-GPI attachment to proteins factor 3 vs. UniProt/SwissProt
Match: sp|A7YWP2|PGAP3_BOVIN (Post-GPI attachment to proteins factor 3 OS=Bos taurus OX=9913 GN=PGAP3 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.089e-49
Identity = 108/302 (35.76%), Postives = 150/302 (49.67%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQK 1036
            SQGD+   +  CV  C  + C G    + +    I +++              W C ++CKY CMW TV ++  +G  VPQF GKWP  R +  +E ASAVAS LN + +  M  ++   VP SS  Y         +  AW  +T+FH  DT LTEK DYF A    + + YL  +R   L    +     AL  +    HVSYL L+ FDY YNM   V IG  N   W+ W L N+ L      +   + L  LS+LE  +F P+FW+ D+H++WH  TI + +  + F   D LYL K
Sbjct:   21 SQGDREPVYRDCVLRCEERNCSGGALKHFRSRQPIYMSLAG------------WTCRDDCKYECMWVTVGLYLQEGQKVPQFHGKWPFSRFLCFQEPASAVASFLNGLASLVMLCRYRTSVPASSPMYPTCVAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAMASAFRALLLLLLTAHVSYLSLIHFDYGYNMAANVAIGLLNAAWWLAWCLWNQRLPHVHKCVAVVLLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLK 310          
BLAST of Post-GPI attachment to proteins factor 3 vs. TrEMBL
Match: A0A267H0L8 (Post-GPI attachment to proteins factor 3 (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030374g1 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.378e-63
Identity = 121/316 (38.29%), Postives = 177/316 (56.01%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVS-----ASYLTVIRVYELSR---RFIKVLIAALFS-VFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRN-RNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGK 1048
            S+GDQ +  H C+  C  K    +  + + +  H L      S            C ++CK+ C+W+TV  F  DGL  P+F+G+WP LR++G++E ASA+ S LN     +MF  F   V   S  YN+W L+ + A   W+S+T+FH  D  LTE+ DYFSALL+ ++     A  LTV R  + S+     I +   A+ S VF++ HV YL  V FDY YNMTV + +G+ N I W+ W +R  R+   +R  ++    L  L +LE  +F PI+W+ D+HS+WH GT+ + +P Y+FAI DC YL   K K
Sbjct:   26 SEGDQAYVHHICMEKCLAKAGCSEAKVRRDRAAHPLTRWTTDS------------CEDQCKHDCLWQTVTAFHRDGLPTPKFYGRWPFLRLLGLQEPASALFSALNCACHVYMFAAFREQVNPQSPMYNVWHLYSLVAIATWLSSTVFHAKDIPLTEQLDYFSALLYLLTCLFCLACRLTVQRDNDYSKNRSNLIGLAAVAIASIVFYIRHVWYLSCVHFDYGYNMTVNLSVGAANCIGWLIWSIRRVRSQPYTRDCLLTVALLNGLVLLEVLDFPPIWWVLDAHSLWHGGTVLLAVPWYRFAIADCNYLLSEKQK 329          
BLAST of Post-GPI attachment to proteins factor 3 vs. TrEMBL
Match: A0A267GYF6 (Post-GPI attachment to proteins factor 3 (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006155g3 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 4.547e-63
Identity = 120/316 (37.97%), Postives = 177/316 (56.01%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVS-----ASYLTVIRVYELSR---RFIKVLIAALFS-VFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRN-RNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGK 1048
            S+GDQ +  H C+  C  K    +  + + +  H L      S            C ++CK+ C+W+TV  F  DGL  P+F+G+WP LR++G++E ASA+ S LN     +MF  F   V   S  YN+W L+ + A   W+S+T+FH  D  LTE+ DYFSALL+ ++     A  +TV R  + S+     I +   A+ S VF++ HV YL  V FDY YNMTV + +G+ N I W+ W +R  R+   +R  ++    L  L +LE  +F PI+W+ D+HS+WH GT+ + +P Y+FAI DC YL   K K
Sbjct:   26 SEGDQAYVHHICMEKCLAKAGCSEAKVRRDRAAHPLTRWTTDS------------CEDQCKHDCLWQTVTAFHRDGLPTPKFYGRWPFLRLLGLQEPASALFSALNCACHVYMFAAFREQVNPQSPMYNVWHLYSLVAIATWLSSTVFHAKDIPLTEQLDYFSALLYLLTCLFCLACRVTVQRDNDYSKNRSNLIGLAAVAIASIVFYIRHVWYLSCVHFDYGYNMTVNLSVGAANCIGWLIWSIRRVRSQPYTRDCLLTVALLNGLVLLEVLDFPPIWWVLDAHSLWHGGTVLLAVPWYRFAIADCNYLLSEKQK 329          
BLAST of Post-GPI attachment to proteins factor 3 vs. TrEMBL
Match: A0A3Q0KQM5 (Post-GPI attachment to proteins factor 3 OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.856e-62
Identity = 122/306 (39.87%), Postives = 173/306 (56.54%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKI---QFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIM---IWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYL 1030
            S GDQT  FH C   C  + C          +       DK+  S ++   + +ILW C +ECKY CMW+TV   + DG  VPQF GKWP +R+ GI+E ASA+ S LN +    MFN+F   VP  +  Y  W +  I +  AW+ +TIFH  DT  TEK DYFSAL F +++  +   R++  +R F  +L +AL   FF+ HV+Y+  V FDY YN+TV +  G  N   W+F+ +   +  +  +I+   +   S  +  +LE  +F PI W+FDSH++WH  ++ I IP YKF I DCLYL
Sbjct:   23 SVGDQTLVFHECNQKCIEEICESSLSNRHNYW-------DKHFNSSRVVIFENSILWDCESECKYRCMWDTVSALEKDGWPVPQFNGKWPFIRLCGIQEPASAIFSFLNFMFNCHMFNQFYRYVPYYTPMYKTWVMQIIFSMNAWVWSTIFHTRDTSFTEKMDYFSALAFVIASVMVLHRRIFNPNRLF-TILFSALLLAFFVNHVNYMTFVNFDYGYNLTVNISFGLINCFGWLFFCVYFCDYKRQPYIIYCWLAVTSSMVFMLLELCDFVPIGWIFDSHALWHASSLLIIIPWYKFIIGDCLYL 320          
BLAST of Post-GPI attachment to proteins factor 3 vs. TrEMBL
Match: A0A1S3JFM9 (Post-GPI attachment to proteins factor 3 OS=Lingula unguis OX=7574 GN=LOC106172808 PE=3 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.774e-59
Identity = 111/314 (35.35%), Postives = 173/314 (55.10%), Query Frame = 2
Query:  122 SYCSQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFP--HILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFI---MIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGK 1048
            ++ S GD T  F +C+  C +  CR     + ++ P    LLN               W CP+EC Y CMW  VE F+ DG  VPQF+GKWP +R+ G++E AS + S+LN +    +F KF   V  +S  +  W L+ + +   W+ + +FH  D  +TEK DYFSA L  ++  YL ++RV    ++   ++ A    +F+ +HV YL   +FDY YNM V + I + N I W+ W + +R   Q  ++   ++  ++  +L+ LE  +F PI+W FD+HS+WH GT  + +  Y+FAI DC YL+  K +
Sbjct:   24 TFGSLGDGTRVFQKCLQNCYLASCRVSDAAWAEQLPWYMRLLN---------------WTCPDECSYFCMWRAVEAFQKDGSPVPQFYGKWPFIRLFGLQEPASVIFSILNALAHLNLF-KFRREVSSASPMFYAWHLYALVSVWTWLCSAMFHARDWPITEKLDYFSAALLVLTQFYLLLLRVIGTEKKLKVIVTALPLLLFYTYHVHYLTYRRFDYGYNMKVNITIVAANAIGWVLWCISHRK--QQPYVWKCLVPVVTTGVLAALELGDFPPIWWTFDAHSLWHAGTPPLIVLFYRFAIDDCKYLEGQKQR 319          
BLAST of Post-GPI attachment to proteins factor 3 vs. TrEMBL
Match: C1LF79 (Post-GPI attachment to proteins factor 3 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.862e-59
Identity = 107/257 (41.63%), Postives = 158/257 (61.48%), Query Frame = 2
Query:  275 QFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIM---IWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQK 1036
            +  ILW C +EC+Y CMW TV  F+ DGL VPQF GKWP +R+ G++E AS + S+LNL+   +MF++F   VP +S  Y  W +  + +  AW+ + IFH  DT  TEK DYFSAL F + +  +   R++    R + +L +A+    F+ HV+Y+  VKFDY YN+TV V+ G  N   W+F+ +   +  +  +I+   +    L++  +LE  +F PI W+FDSH++WH  +I I IP YKF I DCLYL +
Sbjct:    3 EHTILWDCKSECRYRCMWNTVSAFEKDGLAVPQFNGKWPFVRLCGMQEPASVLFSLLNLVFICYMFSQFYKYVPFNSPMYKTWVVQTVFSMNAWVWSIIFHSRDTSFTEKMDYFSALAFVIVSVVVLHRRIFN-PNRLVTILFSAILIAVFVRHVNYMTFVKFDYGYNLTVNVLFGLINCFGWLFFSIYLCDYKKQPYIIYCWLSVTCLSVFMLLELCDFVPIGWIFDSHALWHASSILIIIPWYKFIIADCLYLLE 258          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Cavefish
Match: pgap3 (post-GPI attachment to proteins phospholipase 3 [Source:NCBI gene;Acc:100136873])

HSP 1 Score: 139.813 bits (351), Expect = 2.161e-38
Identity = 97/319 (30.41%), Postives = 150/319 (47.02%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKF--IYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIW------XXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYL---QKLKGKIE 1054
            SQGD+   +  CV  C    C G +       + P++ L  ++                    Y+C W    ++     N   +   WP  R +  EE ASA+AS+LN +    M  ++ + VP+ S  Y+      + +  AW  +T+FH  DT+LTEK DYF A    + + YL  +R   L R  +  ++  L  + F  HVSYL  V FDY YNM     IG  N++ W+ W  +NR     R +  W       + L  L++LE  +F P+FW+ D+H++WH  T+ +    Y F I D L+L   +K+  K+E
Sbjct:   24 SQGDKEPVYRDCVKQCSRTNCTGARLRGFQSTQPPYMALTGERM------------------PYVCFWFIFNIY----FNYVTYRQYWPFARFLCFEEPASALASLLNGLACLLMLLRYRSSVPRQSPMYHTITAFSLVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPGVSSMVGVLLILAFTSHVSYLTFVSFDYGYNMAANATIGMINLLWWLGWCWQNR-----RTLPYWWKCGVVVVLLHGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHLLNTEKIGVKLE 315          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Cavefish
Match: ENSAMXT00000034436.1 (pep primary_assembly:Astyanax_mexicanus-2.0:4:24378590:24385361:-1 gene:ENSAMXG00000039304.1 transcript:ENSAMXT00000034436.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 1.580e-18
Identity = 46/140 (32.86%), Postives = 68/140 (48.57%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKF--IYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITA 544
            + GD+   +  CV  C    C G +       + P++ L                W C ++C+Y CMW TV +++ +G  VPQF GKWP  R +  EE ASA+AS+LN +    M  ++ + VP+ S  Y     H ITA
Sbjct:    3 AAGDKEPVYRDCVKQCSRTNCTGARLRGFQSTQPPYMALTG--------------WTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSSVPRQSPMY-----HTITA 123          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Sea Lamprey
Match: pgap3 (post-GPI attachment to proteins phospholipase 3 [Source:NCBI gene;Acc:100136873])

HSP 1 Score: 162.925 bits (411), Expect = 8.581e-48
Identity = 102/309 (33.01%), Postives = 156/309 (50.49%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAIL--WKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIWXXX-----XXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQK 1036
            S GD+  ++ +CV  C    C G              +   + +S     + L  W C +EC+Y CMW+TV +F  +G +VPQF GKWP +R++ I+E  SA+AS+LN +        +   +P ++  Y       +     W+ +T+FH  DT  TEK DYFSA    + + Y   IR           +  A+   FF +HV Y+  V+FDY YN+     IG  N++ W+ W LR+   H+ R   +W  +     L  L++LE  +F P+ W  D+H++WH GTI + +  Y+F I D LYL K
Sbjct:   25 SLGDRQPHYAQCVKRCTRGNCTG--------------HAAGHLMSRTCGLSCLAGWLCEDECRYTCMWDTVALFLKEGRSVPQFHGKWPFVRLLCIQEPLSALASLLNGLSYYAAMVMYRKKIPSTAPIYQTVIAFSLIGMNTWLWSTVFHCKDTPWTEKMDYFSATSLILYSIYFCCIRTVGQRHPGAASVFGAVLVSFFAYHVWYMGFVRFDYGYNIIANATIGLVNLLWWLGWCLRS---HRER-PYVWRCAFVVLCLHGLALLELLDFPPLLWTLDAHALWHIGTIPLPLVFYRFLIEDSLYLLK 315          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Yeast
Match: PER1 (Protein of the endoplasmic reticulum; required for GPI-phospholipase A2 activity that remodels the GPI anchor as a prerequisite for association of GPI-anchored proteins with lipid rafts; functionally complemented by human ortholog PERLD1 [Source:SGD;Acc:S000000640])

HSP 1 Score: 91.2781 bits (225), Expect = 3.204e-21
Identity = 84/338 (24.85%), Postives = 140/338 (41.42%), Query Frame = 2
Query:  128 CSQGDQTFNFHRCVGYCRM-KFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCV-------PKSSQCYNLWWLHYITAC--IAWISATIFHISDTWLTEKCDYFSALLFAVSA-----SYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIM-----------------------IWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLY 1027
            CS GD    F  C   C   + C   +  Y     ++  +++ +         + W C ++C Y C         ++   + QF GKWP LRV+G +E  S + S+ N I     F KF   +        K+S+   +W   Y+T    +AW ++++FH  D  +TEK DYF A L  ++      + +T + +Y    +     +AA+F++  +      L V + YTYNM   +  G    I  I    +N +  Q + +M                       +  I   +   LE  +F    W  D+H++WH  TI+ +  LY F + D  Y
Sbjct:   18 CSPGDNLDEFIDCTYACEYNRRCPNSQINYIDPETNMFHDIEFFDTPPLYSKLLFWDCISDCDYQCQHIITRWRIDEEEEIYQFHGKWPFLRVLGTQEFFSTIFSIGNFIPHYKGFVKFSRIIREEGDRRRKNSRSILIWNYLYVTVAGMLAWTASSVFHCRDLIITEKLDYFFAGLTVLTGFHAIFARMTSMFLYPKIAQAFTASVAAIFALHIL-----RLYVDWSYTYNMRFNIFFGVLQYILLIMLSCQNYHALQKQKLMGEFKKTAYSSFKRQIFKLCVIPILLVIVTTMAMSLELFDFFSYEWQIDAHALWHLCTIWPSWVLYDFFLEDYAY 350          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Nematostella
Match: EDO42161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S221])

HSP 1 Score: 168.703 bits (426), Expect = 7.569e-50
Identity = 105/302 (34.77%), Postives = 155/302 (51.32%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFI---MIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLY 1027
            S GD+ + F  C+  C           YKK +P  L       L+ ++     W C +ECKY CM E  E        + QF+GKWP +R+ GI+E ASA+ S+LN +     + ++ N VP   + YNLW  + +    AW+ +T+FH  D   TEK DYFSA    + + +   +RV    +R +     A+  + F  H+ YL +VK DY+YN+   V IG  N+  WI W    +NL Q  ++   ++ + SL  L  LE  +F P++W+FD+HS+WH  TI      Y F I DC Y
Sbjct:   21 SWGDKMYRFQDCLTEC-------SALCYKKGYPKDL------PLTLRV---FGWACGDECKYQCMHEVTEYDVQHSRPIKQFYGKWPFVRLFGIQEPASAIFSLLNGVGHLIGWRRYRNSVPPHHKMYNLWRSYMLVNINAWLWSTVFHSRDISWTEKLDYFSATSLVLCSIFCFFVRVAGPEKRLVCGCFGAVLLILFCCHMFYLGMVKMDYSYNIAANVAIGIINMTGWILWC--AKNLRQQPYLWKCIVISASLFFLVGLEVFDFPPLWWIFDAHSLWHLSTIPFCYFWYSFLIDDCRY 304          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Medaka
Match: pgap3 (post-GPI attachment to proteins phospholipase 3 [Source:NCBI gene;Acc:101169071])

HSP 1 Score: 185.267 bits (469), Expect = 2.201e-55
Identity = 111/318 (34.91%), Postives = 164/318 (51.57%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFI-YKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIW------XXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYL---QKLKGKIE 1054
            SQGD+   +  CV  C    C G +   ++ K PH +                 W C ++C+Y CMW TV +++ +G  +PQF GKWP  R +  EE ASA+AS+LN +    M  ++ + VP+ S  Y+      + +  AW  +T+FH  DT+LTEK DYF A    + + YL  +R   L R  +  ++ AL  + F  HVSYL  V FDY YNM     IG  N++ W+ W  +NR     R +  W       + L  L++LE  +F P+ W+ D+H++WH  TI +    Y F I D LYL   +K+  K+E
Sbjct:   44 SQGDKEPVYRDCVKLCVRTNCTGARLRGFEAKQPHYMALTG-------------WTCRDDCRYQCMWTTVGLYQAEGFRIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSTVPRQSPMYHTINAFSLISLNAWFWSTVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLRRPGLSSMVGALLILVFTSHVSYLTFVSFDYGYNMAANTAIGMVNLLWWLCWCWQNR-----RTLPYWWKCGSVVLLLHGLALLELLDFPPLLWILDAHAVWHLSTIPVHFLFYSFLIDDSLYLLNTEKMGVKVE 343          
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Medaka
Match: pgap3 (post-GPI attachment to proteins phospholipase 3 [Source:NCBI gene;Acc:101169071])

HSP 1 Score: 176.022 bits (445), Expect = 2.848e-52
Identity = 103/299 (34.45%), Postives = 154/299 (51.51%), Query Frame = 2
Query:  131 SQGDQTFNFHRCVGYCRMKFCRGDKFI-YKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIW------XXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKF 1006
            SQGD+   +  CV  C    C G +   ++ K PH +                 W C ++C+Y CMW TV +++ +G  +PQF GKWP  R +  EE ASA+AS+LN +    M  ++ + VP+ S  Y+      + +  AW  +T+FH  DT+LTEK DYF A    + + YL  +R   L R  +  ++ AL  + F  HVSYL  V FDY YNM     IG  N++ W+ W  +NR     R +  W       + L  L++LE  +F P+ W+ D+H++WH  TI +    Y+F
Sbjct:   22 SQGDKEPVYRDCVKLCVRTNCTGARLRGFEAKQPHYMALTG-------------WTCRDDCRYQCMWTTVGLYQAEGFRIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSTVPRQSPMYHTINAFSLISLNAWFWSTVFHTRDTYLTEKMDYFCATAVILYSIYLCCVRTLGLRRPGLSSMVGALLILVFTSHVSYLTFVSFDYGYNMAANTAIGMVNLLWWLCWCWQNR-----RTLPYWWKCGSVVLLLHGLALLELLDFPPLLWILDAHAVWHLSTIPVHFLFYRF 302          
BLAST of Post-GPI attachment to proteins factor 3 vs. Planmine SMEST
Match: SMESG000077193.1 (SMESG000077193.1)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 291/291 (100.00%), Postives = 291/291 (100.00%), Query Frame = 2
Query:  182 MKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIWXXXXXXXXXXEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGKIE 1054
            MKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIWAISLALLSILEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGKIE
Sbjct:    1 MKFCRGDKFIYKKKFPHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQFFGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWWLHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYELSRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWIFWGLRNRNLHQSRFIMIWAISLALLSILEFKEFTPIFWLFDSHSMWHFGTIFITIPLYKFAIMDCLYLQKLKGKIE 291          
The following BLAST results are available for this feature:
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGAP34.568e-5136.30post-GPI attachment to proteins phospholipase 3 [S... [more]
PGAP31.602e-4233.99post-GPI attachment to proteins phospholipase 3 [S... [more]
PGAP33.115e-3230.03post-GPI attachment to proteins phospholipase 3 [S... [more]
PGAP34.562e-1833.10post-GPI attachment to proteins phospholipase 3 [S... [more]
PGAP37.099e-1834.88post-GPI attachment to proteins phospholipase 3 [S... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R01B10.42.551e-3032.31Post-GPI attachment to proteins factor 3 [Source:... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PGAP34.897e-5033.77gene:FBgn0033088 transcript:FBtr0086119[more]
PGAP39.786e-4633.68gene:FBgn0033088 transcript:FBtr0086118[more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgap34.207e-5034.42post-GPI attachment to proteins phospholipase 3 [S... [more]
pgap34.380e-5034.42post-GPI attachment to proteins phospholipase 3 [S... [more]
pgap31.884e-4934.20post-GPI attachment to proteins phospholipase 3 [S... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lrba1.352e-5034.97LPS-responsive vesicle trafficking, beach and anch... [more]
lrba1.406e-4533.33LPS-responsive vesicle trafficking, beach and anch... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pgap36.516e-5737.34post-GPI attachment to proteins 3 [Source:MGI Symb... [more]
Pgap33.761e-3630.84post-GPI attachment to proteins 3 [Source:MGI Symb... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2A559|PGAP3_MOUSE4.558e-5637.34Post-GPI attachment to proteins factor 3 OS=Mus mu... [more]
sp|A2V7M9|PGAP3_CRIGR6.326e-5536.60Post-GPI attachment to proteins factor 3 OS=Cricet... [more]
sp|Q96FM1|PGAP3_HUMAN2.194e-5036.30Post-GPI attachment to proteins factor 3 OS=Homo s... [more]
sp|Q0VFE3|PGAP3_XENTR7.161e-5034.97Post-GPI attachment to proteins factor 3 OS=Xenopu... [more]
sp|A7YWP2|PGAP3_BOVIN1.089e-4935.76Post-GPI attachment to proteins factor 3 OS=Bos ta... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H0L81.378e-6338.29Post-GPI attachment to proteins factor 3 (Fragment... [more]
A0A267GYF64.547e-6337.97Post-GPI attachment to proteins factor 3 (Fragment... [more]
A0A3Q0KQM52.856e-6239.87Post-GPI attachment to proteins factor 3 OS=Schist... [more]
A0A1S3JFM91.774e-5935.35Post-GPI attachment to proteins factor 3 OS=Lingul... [more]
C1LF792.862e-5941.63Post-GPI attachment to proteins factor 3 OS=Schist... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pgap32.161e-3830.41post-GPI attachment to proteins phospholipase 3 [S... [more]
ENSAMXT00000034436.11.580e-1832.86pep primary_assembly:Astyanax_mexicanus-2.0:4:2437... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgap38.581e-4833.01post-GPI attachment to proteins phospholipase 3 [S... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PER13.204e-2124.85Protein of the endoplasmic reticulum; required for... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO421617.569e-5034.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pgap32.201e-5534.91post-GPI attachment to proteins phospholipase 3 [S... [more]
pgap32.848e-5234.45post-GPI attachment to proteins phospholipase 3 [S... [more]
back to top
BLAST of Post-GPI attachment to proteins factor 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077193.10.000e+0100.00SMESG000077193.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005292 ID=SMED30005292|Name=Post-GPI attachment to proteins factor 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1059bp
ATTTTATATTATATCAGTTTTAAAGTTTTGCTTTTTAAAATAATTTAAAT
ATATTAAATTTCTTTTATTTTTTACAATGTTTTGCTTTCATATTATTTTT
ATTGTTTTTTTTATTGGTTTCTCTTACTGCTCACAAGGTGATCAGACATT
TAATTTTCATAGATGTGTCGGATACTGTCGAATGAAATTTTGCAGAGGAG
ATAAATTTATTTATAAAAAAAAATTTCCTCATATTCTTTTAAATGTTGAT
AAATATAGTTTGAGTCATAAAATACAATTTGCTATATTATGGAAATGCCC
AAACGAATGCAAATACATTTGCATGTGGGAAACTGTGGAAGTATTTAAAA
ATGATGGTTTAAATGTTCCTCAGTTTTTCGGAAAGTGGCCTTTATTGAGA
GTTATTGGAATAGAGGAAATTGCCTCTGCAGTTGCATCAGTTCTGAATTT
AATCGTTACTACATTTATGTTTAACAAGTTCTTGAATTGTGTTCCAAAAA
GTAGTCAGTGTTATAATTTGTGGTGGCTCCATTACATTACAGCTTGTATA
GCGTGGATAAGTGCGACTATTTTTCACATTTCTGATACTTGGCTAACTGA
GAAATGCGATTATTTTAGTGCGCTTCTTTTTGCAGTTTCCGCTTCATATT
TGACAGTGATCAGAGTATACGAATTGTCTAGAAGATTTATTAAAGTTTTA
ATTGCAGCATTGTTTTCGGTCTTCTTTATGTTTCATGTTTCTTATTTATT
GCTTGTCAAATTTGATTACACGTACAATATGACTGTATTCGTTGTAATTG
GTTCTTTCAATGTTATTTCTTGGATCTTCTGGGGACTGAGAAATCGTAAT
TTACACCAATCAAGATTTATAATGATTTGGGCTATTAGTTTAGCACTTTT
GTCAATTTTAGAATTTAAAGAATTTACTCCGATATTCTGGTTATTTGATT
CTCATTCAATGTGGCATTTTGGTACTATTTTCATCACAATTCCTTTATAC
AAATTTGCGATAATGGATTGTTTATATTTACAAAAGTTAAAAGGGAAAAT
CGAATAGGT
back to top

protein sequence of SMED30005292-orf-1

>SMED30005292-orf-1 ID=SMED30005292-orf-1|Name=SMED30005292-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
MFCFHIIFIVFFIGFSYCSQGDQTFNFHRCVGYCRMKFCRGDKFIYKKKF
PHILLNVDKYSLSHKIQFAILWKCPNECKYICMWETVEVFKNDGLNVPQF
FGKWPLLRVIGIEEIASAVASVLNLIVTTFMFNKFLNCVPKSSQCYNLWW
LHYITACIAWISATIFHISDTWLTEKCDYFSALLFAVSASYLTVIRVYEL
SRRFIKVLIAALFSVFFMFHVSYLLLVKFDYTYNMTVFVVIGSFNVISWI
FWGLRNRNLHQSRFIMIWAISLALLSILEFKEFTPIFWLFDSHSMWHFGT
IFITIPLYKFAIMDCLYLQKLKGKIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007217Per1-like
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031227intrinsic component of endoplasmic reticulum membrane
Vocabulary: biological process
TermDefinition
GO:0006505GPI anchor metabolic process
GO:0006506GPI anchor biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016788hydrolase activity, acting on ester bonds
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007217Per1-likePFAMPF04080Per1coord: 70..315
e-value: 4.4E-71
score: 239.6
IPR007217Per1-likePANTHERPTHR13148PER1-RELATEDcoord: 4..320
NoneNo IPR availablePANTHERPTHR13148:SF0POST-GPI ATTACHMENT TO PROTEINS FACTOR 3coord: 4..320
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.861
NoneNo IPR availableTMHMMTMhelixcoord: 264..286
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
NoneNo IPR availableTMHMMTMhelixcoord: 179..198
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 231..253
NoneNo IPR availableTMHMMTMhelixcoord: 205..227
NoneNo IPR availableTMHMMTMhelixcoord: 147..169
NoneNo IPR availableTMHMMTMhelixcoord: 296..318