fas apoptotic inhibitory molecule 1-like

Overview
Namefas apoptotic inhibitory molecule 1-like
Smed IDSMED30005285
Length (bp)900
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of fas apoptotic inhibitory molecule 1-like (SMED30005285) t-SNE clustered cells

Violin plots show distribution of expression levels for fas apoptotic inhibitory molecule 1-like (SMED30005285) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of fas apoptotic inhibitory molecule 1-like (SMED30005285) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for fas apoptotic inhibitory molecule 1-like (SMED30005285) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005285

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30005285h1SMcG0021051 SmedASXL_004859SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005285h1SMcG0021051 dd_Smed_v4_9854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005285h1SMcG0021051 dd_Smed_v6_9854_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005285h1SMcG0021051 dd_Smed_v4_9854_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30005285h1SMcG0021051 dd_Smed_v4_9854_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Human
Match: FAIM (Fas apoptotic inhibitory molecule [Source:HGNC Symbol;Acc:HGNC:18703])

HSP 1 Score: 150.214 bits (378), Expect = 3.272e-44
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R+++MFKLVG E F +G +  K +I+    S  +Y Y L +NGK L K++E +SK    W++ +D  +       +RI+LEKD +D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:    5 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGEN-------FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPE 176          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Human
Match: FAIM (Fas apoptotic inhibitory molecule [Source:HGNC Symbol;Acc:HGNC:18703])

HSP 1 Score: 150.214 bits (378), Expect = 3.272e-44
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R+++MFKLVG E F +G +  K +I+    S  +Y Y L +NGK L K++E +SK    W++ +D  +       +RI+LEKD +D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:    5 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGEN-------FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPE 176          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Human
Match: FAIM (Fas apoptotic inhibitory molecule [Source:HGNC Symbol;Acc:HGNC:18703])

HSP 1 Score: 150.214 bits (378), Expect = 3.272e-44
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R+++MFKLVG E F +G +  K +I+    S  +Y Y L +NGK L K++E +SK    W++ +D  +       +RI+LEKD +D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:    5 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGEN-------FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPE 176          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Human
Match: FAIM (Fas apoptotic inhibitory molecule [Source:HGNC Symbol;Acc:HGNC:18703])

HSP 1 Score: 149.828 bits (377), Expect = 9.543e-44
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R+++MFKLVG E F +G +  K +I+    S  +Y Y L +NGK L K++E +SK    W++ +D  +       +RI+LEKD +D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:   27 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGEN-------FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPE 198          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Human
Match: FAIM (Fas apoptotic inhibitory molecule [Source:HGNC Symbol;Acc:HGNC:18703])

HSP 1 Score: 148.673 bits (374), Expect = 2.924e-43
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R+++MFKLVG E F +G +  K +I+    S  +Y Y L +NGK L K++E +SK    W++ +D  +       +RI+LEKD +D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:   39 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGEN-------FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPE 210          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Celegans
Match: C44B11.1 (pep chromosome:WBcel235:III:3155268:3158393:1 gene:WBGene00016633.1 transcript:C44B11.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C44B11.1)

HSP 1 Score: 141.354 bits (355), Expect = 4.670e-41
Identity = 70/178 (39.33%), Postives = 106/178 (59.55%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDS 592
            V  W +PL  ++H ++FEHGTT+G+RVI +D  EI R D+MFKLVG E F +G   C +++      +Y Y L VNGK  +KF E Q+K L  W   L       S   +R++L+K++++I  +GN ++T GEF +NGT T+F    +  +I   SSG K  G+ + L+V+    P +
Sbjct:    7 VATWNVPLHAQVHKIEFEHGTTTGKRVIRIDGNEILRRDWMFKLVGKEAFKVGDMKCIINVEALGTFAYEYSLDVNGKTFNKFKEEQNKRLHSWETTL-------SGHQWRVVLDKESMEIWANGNNIDTAGEFVDNGTVTHFELGKNPCKIIAQSSGKKKTGVTHTLYVNGEIVPST 177          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Fly
Match: CG10257 (gene:FBgn0033985 transcript:FBtr0087408)

HSP 1 Score: 130.954 bits (328), Expect = 1.850e-36
Identity = 65/191 (34.03%), Postives = 108/191 (56.54%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSKIDDDLNSELDVL 631
            V +W +P++ +++ ++ EHGTTSGRR+I+V+ +E+ R D+MFKLVG + F+I ++ C + +       Y Y L ++GK  D++ E  ++    WL   D     D+   YRI+L+ DTL + V+  +      F   GT T F   D    +   SSGNKH G+V+ L  + V  P++KI + +   + +L
Sbjct:   36 VAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVGEDTFHIDQTRCIIRVDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDA--AADAPQEYRIMLKLDTLSLYVNDELRTEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVPEAKIQEIMQEPVSIL 224          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Zebrafish
Match: faima (Fas apoptotic inhibitory molecule a [Source:ZFIN;Acc:ZDB-GENE-040718-323])

HSP 1 Score: 154.451 bits (389), Expect = 4.051e-46
Identity = 77/181 (42.54%), Postives = 116/181 (64.09%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSK 595
            V  W++ LSD +H ++FEHGTT+G+RVI++D KE+ R D+MFKLVG E FN+G +  K +I+    S  +Y Y L +NG+ L K++E +SK+   WL+ LD           R++LEKDT+DI  +G  +ET GEF E+GT T+F+  DH   I   SSG +  G+++ L VD +   +++
Sbjct:    6 VAVWEVALSDGVHRIEFEHGTTTGKRVIYIDGKEVIRRDWMFKLVGKETFNVGSTDTKATINIDAVSGFAYEYTLEINGQSLRKYMENRSKVTSTWLLNLDGID-------CRVVLEKDTMDIWCNGQKMETAGEFVEDGTETHFTLGDHDCCIKAVSSGKRRDGIIHTLLVDGMEISEAE 179          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Zebrafish
Match: faima (Fas apoptotic inhibitory molecule a [Source:ZFIN;Acc:ZDB-GENE-040718-323])

HSP 1 Score: 154.451 bits (389), Expect = 4.051e-46
Identity = 77/181 (42.54%), Postives = 116/181 (64.09%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSK 595
            V  W++ LSD +H ++FEHGTT+G+RVI++D KE+ R D+MFKLVG E FN+G +  K +I+    S  +Y Y L +NG+ L K++E +SK+   WL+ LD           R++LEKDT+DI  +G  +ET GEF E+GT T+F+  DH   I   SSG +  G+++ L VD +   +++
Sbjct:    6 VAVWEVALSDGVHRIEFEHGTTTGKRVIYIDGKEVIRRDWMFKLVGKETFNVGSTDTKATINIDAVSGFAYEYTLEINGQSLRKYMENRSKVTSTWLLNLDGID-------CRVVLEKDTMDIWCNGQKMETAGEFVEDGTETHFTLGDHDCCIKAVSSGKRRDGIIHTLLVDGMEISEAE 179          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Zebrafish
Match: faimb (Fas apoptotic inhibitory molecule b [Source:ZFIN;Acc:ZDB-GENE-040718-91])

HSP 1 Score: 150.984 bits (380), Expect = 9.368e-45
Identity = 79/185 (42.70%), Postives = 120/185 (64.86%), Query Frame = 2
Query:   53 GNVV-EWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSIS----TGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDS 592
            G++V  W + LSD ++ ++FEHG+T+G+RVI+++ KE+ R D+MFKLVG E F +G +  K +I+    TG   SY Y L +NGK L  F++ +SKI   W+++LD        + YRI+LEKDT+D+  +G  +ET GEFTENG+ T+F+  DH   I   +SG K  G+V+ L VD +   ++
Sbjct:    3 GDIVGAWDVSLSDGLYRIEFEHGSTTGKRVIYINGKEVLRRDWMFKLVGKETFPVGCTDAKATITIEAITGF--SYEYTLEINGKSLQTFLDNRSKISKTWVMKLDG-------ADYRIVLEKDTMDVWCNGQKLETMGEFTENGSETHFALGDHECYIKATTSGRKRNGIVHSLLVDGIRIEEA 178          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Xenopus
Match: chek1 (checkpoint kinase 1 [Source:Xenbase;Acc:XB-GENE-491846])

HSP 1 Score: 155.992 bits (393), Expect = 1.341e-45
Identity = 80/180 (44.44%), Postives = 115/180 (63.89%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDS 592
            V  W++ LSD IH ++FEHGTTSG+RV++VD KEI R+D+MFKLVG E F +G S  K +I+    S  +Y Y L +NGK L K++E +SK    W++ LD           R++LEKDT+D+  +G  +ET GEF + GT T+FS  +H+  I   SSG +  G+++ L VD+   P+S
Sbjct:   77 VAMWEVALSDGIHKIEFEHGTTSGKRVVYVDGKEIIRKDWMFKLVGKETFAVGASQTKATINIDAVSGFAYEYTLDINGKSLKKYMENRSKTTNTWVLHLDGED-------CRVVLEKDTMDVWCNGRNMETAGEFVDEGTETHFSIGNHSCCIKAVSSGKRREGIIHTLIVDDREIPES 249          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Mouse
Match: Faim (Fas apoptotic inhibitory molecule [Source:MGI Symbol;Acc:MGI:1344387])

HSP 1 Score: 150.214 bits (378), Expect = 2.271e-44
Identity = 76/179 (42.46%), Postives = 112/179 (62.57%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R ++MFKLVG E F +G +  K +I+    S  +Y Y L ++GK L K++E +SK    W++RLD           R++LEKDT+D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:    5 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRLDGED-------LRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPE 176          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Mouse
Match: Faiml (Fas apoptotic inhibitory molecule like [Source:MGI Symbol;Acc:MGI:3647754])

HSP 1 Score: 149.058 bits (375), Expect = 5.209e-44
Identity = 75/176 (42.61%), Postives = 113/176 (64.20%), Query Frame = 2
Query:   68 WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCK--LSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            W + LSD +H ++FEHGTTSG+RV++VD KE+ R+++MF LVG E F +G +  K  + I +G    ++Y L ++GK   KFVE +SK    W++ LD++        +RI+LEK T+D+  +G IVE+ GEF ++GT T+FS  +H   I   SSG K  G+++ L VDN   P+
Sbjct:    7 WDVILSDGVHKIEFEHGTTSGKRVVYVDGKEVIRKEWMFPLVGKETFCVGAAKNKAIIRILSGKGCGFSYTLEIDGKSFRKFVENRSKTTNTWVLHLDDKD-------FRIVLEKPTMDVWCNGKIVESVGEFVDDGTETHFSVGNHGCYIKAVSSGKKREGIIHTLIVDNREIPE 175          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Mouse
Match: Faiml (Fas apoptotic inhibitory molecule like [Source:MGI Symbol;Acc:MGI:3647754])

HSP 1 Score: 149.058 bits (375), Expect = 5.209e-44
Identity = 75/176 (42.61%), Postives = 113/176 (64.20%), Query Frame = 2
Query:   68 WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCK--LSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            W + LSD +H ++FEHGTTSG+RV++VD KE+ R+++MF LVG E F +G +  K  + I +G    ++Y L ++GK   KFVE +SK    W++ LD++        +RI+LEK T+D+  +G IVE+ GEF ++GT T+FS  +H   I   SSG K  G+++ L VDN   P+
Sbjct:    7 WDVILSDGVHKIEFEHGTTSGKRVVYVDGKEVIRKEWMFPLVGKETFCVGAAKNKAIIRILSGKGCGFSYTLEIDGKSFRKFVENRSKTTNTWVLHLDDKD-------FRIVLEKPTMDVWCNGKIVESVGEFVDDGTETHFSVGNHGCYIKAVSSGKKREGIIHTLIVDNREIPE 175          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Mouse
Match: Faim (Fas apoptotic inhibitory molecule [Source:MGI Symbol;Acc:MGI:1344387])

HSP 1 Score: 149.443 bits (376), Expect = 6.988e-44
Identity = 76/179 (42.46%), Postives = 112/179 (62.57%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R ++MFKLVG E F +G +  K +I+    S  +Y Y L ++GK L K++E +SK    W++RLD           R++LEKDT+D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:   27 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRLDGED-------LRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPE 198          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Mouse
Match: Faim (Fas apoptotic inhibitory molecule [Source:MGI Symbol;Acc:MGI:1344387])

HSP 1 Score: 147.132 bits (370), Expect = 3.270e-43
Identity = 75/174 (43.10%), Postives = 110/174 (63.22%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDN 574
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R ++MFKLVG E F +G +  K +I+    S  +Y Y L ++GK L K++E +SK    W++RLD           R++LEKDT+D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN
Sbjct:    5 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRLDGED-------LRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDN 171          
BLAST of fas apoptotic inhibitory molecule 1-like vs. UniProt/SwissProt
Match: sp|Q0IIF6|FAIM1_BOVIN (Fas apoptotic inhibitory molecule 1 OS=Bos taurus OX=9913 GN=FAIM PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.426e-44
Identity = 76/179 (42.46%), Postives = 116/179 (64.80%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W++ LSD +H ++FEHGTTSG+RV++VD KE+ R+++MFKLVG E F +G +  K +I+    S  +Y Y L +NGK L K++E +SK    W++ LD+         +R++LEKDTLD+  +G  +ET GEF ++GT T+F+  +H   I   SSG +  G+++ L VDN   P+
Sbjct:   27 VAVWEVALSDGVHKIEFEHGTTSGKRVVYVDGKEVIRKEWMFKLVGKETFCVGAAKTKATINIDAVSGFAYEYTLEINGKSLKKYMENRSKTTNTWVLHLDSED-------FRVVLEKDTLDVWCNGKKMETAGEFVDDGTETHFNIGNHDCYIKAVSSGKRKEGIIHSLIVDNREIPE 198          
BLAST of fas apoptotic inhibitory molecule 1-like vs. UniProt/SwissProt
Match: sp|Q9NVQ4|FAIM1_HUMAN (Fas apoptotic inhibitory molecule 1 OS=Homo sapiens OX=9606 GN=FAIM PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.571e-43
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R+++MFKLVG E F +G +  K +I+    S  +Y Y L +NGK L K++E +SK    W++ +D  +       +RI+LEKD +D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:    5 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGEN-------FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPE 176          
BLAST of fas apoptotic inhibitory molecule 1-like vs. UniProt/SwissProt
Match: sp|Q9WUD8|FAIM1_MOUSE (Fas apoptotic inhibitory molecule 1 OS=Mus musculus OX=10090 GN=Faim PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.588e-43
Identity = 76/179 (42.46%), Postives = 112/179 (62.57%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R ++MFKLVG E F +G +  K +I+    S  +Y Y L ++GK L K++E +SK    W++RLD           R++LEKDT+D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:    5 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRLDGED-------LRVVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPE 176          
BLAST of fas apoptotic inhibitory molecule 1-like vs. UniProt/SwissProt
Match: sp|Q8R5H8|FAIM1_RAT (Fas apoptotic inhibitory molecule 1 OS=Rattus norvegicus OX=10116 GN=Faim PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.338e-42
Identity = 75/179 (41.90%), Postives = 111/179 (62.01%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            V  W + LSD +H ++FEHGTTSG+RV++VD KE  R ++MFKLVG E F +G +  K +I+    S  +Y Y L ++GK L K++E +SK    W++ LD           R++LEKDT+D+  +G  +ET GEF ++GT T+FS  +H   I   SSG +  G+++ L VDN   P+
Sbjct:   27 VAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTNTWVLHLDGEE-------LRVVLEKDTMDVWCNGQRMETAGEFVDDGTETHFSVGNHDCYIKAVSSGKRREGIIHTLIVDNREIPE 198          
BLAST of fas apoptotic inhibitory molecule 1-like vs. TrEMBL
Match: A0A182YTT8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106058175 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.827e-52
Identity = 85/179 (47.49%), Postives = 121/179 (67.60%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSK 595
            V  W+I LSD +H+V+FEHGTT+G+R+I +D KEI R+D+MFKLVG E F +GK+ C ++I      SY Y L VNGKPL KF+E QSK++  W+  +            RI+LEKDTLD+ V+G+ V+TTGEF ++GT T+F    H+  I   ++G +  G+++QLFVD V  P++K
Sbjct:    5 VATWEIALSDGVHIVEFEHGTTTGKRIIRIDGKEIYRQDWMFKLVGKEHFQVGKAKCVITIEAVSGFSYEYTLDVNGKPLKKFIENQSKVMKAWVHVIGGND-------MRIVLEKDTLDVWVNGSRVKTTGEFVDDGTETHFEIGSHSAYIKAVTTGKRRTGILHQLFVDGVEIPEAK 176          
BLAST of fas apoptotic inhibitory molecule 1-like vs. TrEMBL
Match: A0A267ECJ4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022478g2 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 4.379e-52
Identity = 88/178 (49.44%), Postives = 118/178 (66.29%), Query Frame = 2
Query:   68 WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSKID 601
            W++PLSDR+HVV+F+HGTTSGRR IF++ + IKREDFMFKLVG E F IG + C + I    + +Y Y L VNGK +  F E Q++IL CWL  +D           RI+LEKD+LD+ VDG +VET GEFT+ GT T+F+  DH   I   SSG +  G++  LF+D+    ++ ID
Sbjct:   25 WEVPLSDRVHVVQFDHGTTSGRRAIFLNGECIKREDFMFKLVGIEHFKIGSTPCTIEIVAADDFNYHYKLLVNGKSVQSFSENQARILKCWLPIIDG-------EFVRIVLEKDSLDVYVDGKVVETAGEFTDEGTETHFTVGDHACFIRAVSSGKRRTGIIQTLFIDDHEVTEAAID 195          
BLAST of fas apoptotic inhibitory molecule 1-like vs. TrEMBL
Match: A0A1S3I1E0 (fas apoptotic inhibitory molecule 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106160103 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 4.637e-52
Identity = 89/179 (49.72%), Postives = 122/179 (68.16%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSK 595
            V  W++ LSD +H V+FEHGTT+G+RVI++D KE+KR D+MFKLVGSE F IGK+ CK++I       Y Y + VNGK L KF E QSKI+ CW++ LD+          RI+LEKDTLDI V+G  ++TTGEFT++GT T+F+  +H+  +   SSG K  G+++ L VD    P +K
Sbjct:    5 VAVWEVALSDGVHKVEFEHGTTTGKRVIWLDGKEVKRTDWMFKLVGSETFQIGKTKCKINIDAVSGFMYEYTIEVNGKSLQKFSENQSKIMNCWVMTLDDVPT-------RIVLEKDTLDIWVNGQKLDTTGEFTDDGTETHFAIGEHSCYVKAVSSGKKREGIIHSLIVDGQEIPWTK 176          
BLAST of fas apoptotic inhibitory molecule 1-like vs. TrEMBL
Match: A0A267FLW8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030786g2 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 6.677e-52
Identity = 87/178 (48.88%), Postives = 118/178 (66.29%), Query Frame = 2
Query:   68 WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSKID 601
            W++PLSDR+HVV+F+HGTTSGRR IF++ + IKREDFMFKLVG E F IG + C + I    + +Y Y L VNGK +  F E Q++IL CWL  +D           RI+LEKD+LD+ VDG +VET GEFT+ GT T+F+  DH   I   SSG +  G++  LF+D+    ++ +D
Sbjct:   25 WEVPLSDRVHVVQFDHGTTSGRRAIFLNGECIKREDFMFKLVGIEHFKIGSTPCTIEIVAADDFNYHYKLLVNGKSVQSFSENQARILKCWLPIIDG-------EFVRIVLEKDSLDVYVDGKVVETAGEFTDEGTETHFTVGDHACFIRAVSSGKRRTGIIQTLFIDDHEVTEAAVD 195          
BLAST of fas apoptotic inhibitory molecule 1-like vs. TrEMBL
Match: A0A1S3JJ35 (fas apoptotic inhibitory molecule 1-like OS=Lingula unguis OX=7574 GN=LOC106173721 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 6.774e-52
Identity = 89/179 (49.72%), Postives = 122/179 (68.16%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSK 595
            V  W++ LSD +H V+FEHGTT+G+RVI++D KE+KR D+MFKLVGSE F IGK+ CK++I       Y Y + VNGK L KF E QSKI+ CW++ LD+          RI+LEKDTLDI V+G  ++TTGEFT++GT T+F+  +H+  +   SSG K  G+++ L VD    P +K
Sbjct:   15 VAVWEVALSDGVHKVEFEHGTTTGKRVIWLDGKEVKRTDWMFKLVGSETFQIGKTKCKINIDAVSGFMYEYTIEVNGKSLQKFSENQSKIMNCWVMTLDDVPT-------RIVLEKDTLDIWVNGQKLDTTGEFTDDGTETHFAIGEHSCYVKAVSSGKKREGIIHSLIVDGQEIPWTK 186          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Cavefish
Match: faima (Fas apoptotic inhibitory molecule a [Source:ZFIN;Acc:ZDB-GENE-040718-323])

HSP 1 Score: 148.288 bits (373), Expect = 1.933e-43
Identity = 76/177 (42.94%), Postives = 111/177 (62.71%), Query Frame = 2
Query:   68 WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDS 592
            W++ LSD +H ++FEHGTT+G+RVI VD KE+ R D+MFKLVG E F++G    K +I+    S  +Y Y L +NGK L K++E +SK+   WL+ LD           R++LEKDT+DI  +G  +ET GEF ++GT T+F+  DH   I   SSG +  G+++ L VD     ++
Sbjct:    9 WEVALSDGVHRIEFEHGTTTGKRVISVDGKEVLRRDWMFKLVGKETFHVGGLETKATINIEAVSGFAYEYTLEINGKSLRKYMENRSKVTSTWLLNLDGID-------CRVVLEKDTMDIWCNGQKMETAGEFVDDGTETHFTLGDHDCCIKAVSSGRRRDGLIHTLLVDGTEMSEA 178          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Cavefish
Match: faimb (fas apoptotic inhibitory molecule 1-like [Source:NCBI gene;Acc:103044688])

HSP 1 Score: 136.732 bits (343), Expect = 3.082e-39
Identity = 76/179 (42.46%), Postives = 113/179 (63.13%), Query Frame = 2
Query:   68 WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSIS----TGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDS 592
            W++ LSD I+ ++FEHGTT+GRRVI+++ KE+ R+D+MFKLVG E F +G +  K +I+    TG   SY Y L +NGK L  F+  +SKI   W+++LD           RI+LEKD++D+  +G  +ETTGEF++ GT T+F+  DH   I   SS  K  G+ + L+VD     ++
Sbjct:    9 WEVSLSDGIYQIEFEHGTTTGRRVIYINGKEVFRKDWMFKLVGKETFPVGSTGTKATINIEAITGF--SYEYTLEINGKSLQSFLNNRSKISRTWILKLDGVD-------CRIVLEKDSMDVWCNGQRMETTGEFSDEGTETHFAVGDHECCIKAASSEKKKKGISHSLYVDGTKVTEA 178          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Sea Lamprey
Match: FAIM (Fas apoptotic inhibitory molecule [Source:HGNC Symbol;Acc:HGNC:18703])

HSP 1 Score: 154.836 bits (390), Expect = 1.179e-46
Identity = 82/189 (43.39%), Postives = 118/189 (62.43%), Query Frame = 2
Query:   32 ATKMAQFGNVVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFS-FDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            A +MA    V  W++ LSD +H ++FEHGTTSG+RV++VD KE+ R D+MFKLVG E F +G +  K +I+    S  +Y Y L +NGK L KF+E +SK    W+++LD           R++LEKDT+DI  +G+ +ET GEF E GT T+F+  D H   I   SSG +  G+V+ L ++ V  P+
Sbjct:   20 ADRMADL--VAMWEVALSDGVHKIEFEHGTTSGKRVVYVDGKELIRRDWMFKLVGKETFTVGATETKATINIDAVSGFAYEYTLEINGKSLKKFIENRSKTSKTWVLQLDGVD-------IRVVLEKDTMDIWCNGDKMETAGEFVEEGTETHFTLLDRHECCIKAVSSGRRREGIVHSLILNGVEVPE 199          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Nematostella
Match: EDO34327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPL7])

HSP 1 Score: 157.147 bits (396), Expect = 1.228e-47
Identity = 78/178 (43.82%), Postives = 109/178 (61.24%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDS 592
            V +W + ++D +H V+FEHGTTSG+RVI VD KEI R+++MF+LVG E FN+G     + I       Y Y L V GKPL KFVE + K    W + LD           RI+LEKDT+++ V+G +VET GEF ++GT T+F++ +H   I   SSG K  G+V+ L +D     +S
Sbjct:    5 VAKWDVAMADGVHQVQFEHGTTSGKRVIIVDGKEILRKNWMFRLVGQETFNVGSQKATVHIEAVSGFQYEYTLEVGGKPLKKFVENRKKTAKVWTLLLDGIET-------RIVLEKDTMEVWVNGEVVETAGEFDDDGTVTHFTWGNHACYIQAVSSGKKREGIVHSLIIDGNEITES 175          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Medaka
Match: faima (Fas apoptotic inhibitory molecule [Source:NCBI gene;Acc:101156368])

HSP 1 Score: 155.992 bits (393), Expect = 9.655e-47
Identity = 77/176 (43.75%), Postives = 115/176 (65.34%), Query Frame = 2
Query:   68 WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPD 589
            W++ LSD +H ++FEHGTT+G+RVI+VD KE+ R D+MFKLVG E FN+G+S  K +I+    S  +Y Y L +NGK L +++E +SK+   WL+ LD        S  RI+LEKDT+D+  +G  +ET GEF ++GT T+F+  +HT  +   SSG +  G+++ L VD     +
Sbjct:    9 WEVALSDGVHRIEFEHGTTTGKRVIYVDGKEVLRRDWMFKLVGKETFNVGQSDTKATINIDAVSGFAYEYTLEINGKSLKQYMENRSKVTSTWLLNLDG-------SDCRIVLEKDTMDVWCNGEKMETAGEFVDDGTETHFTLGEHTCCVKAVSSGKRRDGIIHTLLVDGTEIAE 177          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Medaka
Match: faima (Fas apoptotic inhibitory molecule [Source:NCBI gene;Acc:101156368])

HSP 1 Score: 144.05 bits (362), Expect = 5.017e-42
Identity = 73/183 (39.89%), Postives = 115/183 (62.84%), Query Frame = 2
Query:   68 WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSKIDDDL 610
            W++ LSD +H ++FEHGTT+G+RVI+VD KE+ R D+MFKLVG E FN+G+S  K +I+    S  +Y Y L +NGK L +++E +SK+   WL+ LD        S  RI+LEKDT+D+  +G  +ET GEF ++GT T+F+  +HT  +    + +     ++     + P P  +++ +L
Sbjct:    9 WEVALSDGVHRIEFEHGTTTGKRVIYVDGKEVLRRDWMFKLVGKETFNVGQSDTKATINIDAVSGFAYEYTLEINGKSLKQYMENRSKVTSTWLLNLDG-------SDCRIVLEKDTMDVWCNGEKMETAGEFVDDGTETHFTLGEHTCCVKAAEAESGPAPPLWTFL--SAPPPPQRVNLEL 182          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Medaka
Match: faimb (fas apoptotic inhibitory molecule 1-like [Source:NCBI gene;Acc:101165707])

HSP 1 Score: 105.145 bits (261), Expect = 3.446e-27
Identity = 56/135 (41.48%), Postives = 89/135 (65.93%), Query Frame = 2
Query:   53 GNVVE-WKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNS--SYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVET 448
            G+VV  W I LSD ++ ++F HGTT+G+R+I+V+ KE+ ++D+MFKLVG E F IG +  K +I+    S  +Y Y L ++GK L KFV+ ++K    W+ ++D        + YR++LEKDT+D+  +G  +ET
Sbjct:    4 GDVVAVWDIALSDGVYRIEFAHGTTTGKRIIYVNGKEVVKKDWMFKLVGKETFTIGSTNIKATINIEAVSGFAYEYSLDIDGKSLQKFVDDRAKTTKTWVFQVDG-------TDYRVVLEKDTVDVWCNGQKMET 131          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Planmine SMEST
Match: SMESG000017306.1 (SMESG000017306.1)

HSP 1 Score: 400.979 bits (1029), Expect = 4.346e-143
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 2
Query:   41 MAQFGNVVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSKIDDDLNSELDVL 631
            MAQFGNVVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSKID DLNSELDVL
Sbjct:    1 MAQFGNVVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSKIDYDLNSELDVL 197          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Planmine SMEST
Match: SMESG000037979.1 (SMESG000037979.1)

HSP 1 Score: 146.747 bits (369), Expect = 5.033e-42
Identity = 66/174 (37.93%), Postives = 116/174 (66.67%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVP 580
            V  W+ P+S + + V+FEH + SG+R+I V+++ +K+ D++F+LVG+E F + +  CKL I+     SY+Y L +N K L+KF++ Q  ++ CW+V L  +        Y+++L+K+TLDI +DG  VE+ GEF+++GT+ +F  ++++  I   SSG +  GM+Y L V+++P
Sbjct:   97 VARWQFPISGKTYTVEFEHSSISGKRIIRVNNEIVKKVDYLFELVGNEYFKVDRYNCKLVIANNSTFSYSYTLFINNKSLEKFIDQQDLLIKCWVVDLQGKE-------YKVVLDKNTLDIFIDGMKVESAGEFSDSGTNNHFQINNNSCVIMIESSGQRGHGMIYSLLVNDIP 263          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Planmine SMEST
Match: SMESG000037979.1 (SMESG000037979.1)

HSP 1 Score: 146.362 bits (368), Expect = 1.194e-41
Identity = 66/174 (37.93%), Postives = 116/174 (66.67%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVP 580
            V  W+ P+S + + V+FEH + SG+R+I V+++ +K+ D++F+LVG+E F + +  CKL I+     SY+Y L +N K L+KF++ Q  ++ CW+V L  +        Y+++L+K+TLDI +DG  VE+ GEF+++GT+ +F  ++++  I   SSG +  GM+Y L V+++P
Sbjct:  123 VARWQFPISGKTYTVEFEHSSISGKRIIRVNNEIVKKVDYLFELVGNEYFKVDRYNCKLVIANNSTFSYSYTLFINNKSLEKFIDQQDLLIKCWVVDLQGKE-------YKVVLDKNTLDIFIDGMKVESAGEFSDSGTNNHFQINNNSCVIMIESSGQRGHGMIYSLLVNDIP 289          
BLAST of fas apoptotic inhibitory molecule 1-like vs. Planmine SMEST
Match: SMESG000037979.1 (SMESG000037979.1)

HSP 1 Score: 146.362 bits (368), Expect = 2.463e-41
Identity = 66/174 (37.93%), Postives = 116/174 (66.67%), Query Frame = 2
Query:   59 VVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKLVGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCWLVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFSFDDHTGRIDTFSSGNKHFGMVYQLFVDNVP 580
            V  W+ P+S + + V+FEH + SG+R+I V+++ +K+ D++F+LVG+E F + +  CKL I+     SY+Y L +N K L+KF++ Q  ++ CW+V L  +        Y+++L+K+TLDI +DG  VE+ GEF+++GT+ +F  ++++  I   SSG +  GM+Y L V+++P
Sbjct:  151 VARWQFPISGKTYTVEFEHSSISGKRIIRVNNEIVKKVDYLFELVGNEYFKVDRYNCKLVIANNSTFSYSYTLFINNKSLEKFIDQQDLLIKCWVVDLQGKE-------YKVVLDKNTLDIFIDGMKVESAGEFSDSGTNNHFQINNNSCVIMIESSGQRGHGMIYSLLVNDIP 317          
The following BLAST results are available for this feature:
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAIM3.272e-4441.90Fas apoptotic inhibitory molecule [Source:HGNC Sym... [more]
FAIM3.272e-4441.90Fas apoptotic inhibitory molecule [Source:HGNC Sym... [more]
FAIM3.272e-4441.90Fas apoptotic inhibitory molecule [Source:HGNC Sym... [more]
FAIM9.543e-4441.90Fas apoptotic inhibitory molecule [Source:HGNC Sym... [more]
FAIM2.924e-4341.90Fas apoptotic inhibitory molecule [Source:HGNC Sym... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C44B11.14.670e-4139.33pep chromosome:WBcel235:III:3155268:3158393:1 gene... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG102571.850e-3634.03gene:FBgn0033985 transcript:FBtr0087408[more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
faima4.051e-4642.54Fas apoptotic inhibitory molecule a [Source:ZFIN;A... [more]
faima4.051e-4642.54Fas apoptotic inhibitory molecule a [Source:ZFIN;A... [more]
faimb9.368e-4542.70Fas apoptotic inhibitory molecule b [Source:ZFIN;A... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chek11.341e-4544.44checkpoint kinase 1 [Source:Xenbase;Acc:XB-GENE-49... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Faim2.271e-4442.46Fas apoptotic inhibitory molecule [Source:MGI Symb... [more]
Faiml5.209e-4442.61Fas apoptotic inhibitory molecule like [Source:MGI... [more]
Faiml5.209e-4442.61Fas apoptotic inhibitory molecule like [Source:MGI... [more]
Faim6.988e-4442.46Fas apoptotic inhibitory molecule [Source:MGI Symb... [more]
Faim3.270e-4343.10Fas apoptotic inhibitory molecule [Source:MGI Symb... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q0IIF6|FAIM1_BOVIN1.426e-4442.46Fas apoptotic inhibitory molecule 1 OS=Bos taurus ... [more]
sp|Q9NVQ4|FAIM1_HUMAN1.571e-4341.90Fas apoptotic inhibitory molecule 1 OS=Homo sapien... [more]
sp|Q9WUD8|FAIM1_MOUSE1.588e-4342.46Fas apoptotic inhibitory molecule 1 OS=Mus musculu... [more]
sp|Q8R5H8|FAIM1_RAT3.338e-4241.90Fas apoptotic inhibitory molecule 1 OS=Rattus norv... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182YTT81.827e-5247.49Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A267ECJ44.379e-5249.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1S3I1E04.637e-5249.72fas apoptotic inhibitory molecule 1 isoform X1 OS=... [more]
A0A267FLW86.677e-5248.88Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1S3JJ356.774e-5249.72fas apoptotic inhibitory molecule 1-like OS=Lingul... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
faima1.933e-4342.94Fas apoptotic inhibitory molecule a [Source:ZFIN;A... [more]
faimb3.082e-3942.46fas apoptotic inhibitory molecule 1-like [Source:N... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
FAIM1.179e-4643.39Fas apoptotic inhibitory molecule [Source:HGNC Sym... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO343271.228e-4743.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
faima9.655e-4743.75Fas apoptotic inhibitory molecule [Source:NCBI gen... [more]
faima5.017e-4239.89Fas apoptotic inhibitory molecule [Source:NCBI gen... [more]
faimb3.446e-2741.48fas apoptotic inhibitory molecule 1-like [Source:N... [more]
back to top
BLAST of fas apoptotic inhibitory molecule 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000017306.14.346e-14399.49SMESG000017306.1[more]
SMESG000037979.15.033e-4237.93SMESG000037979.1[more]
SMESG000037979.11.194e-4137.93SMESG000037979.1[more]
SMESG000037979.12.463e-4137.93SMESG000037979.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005285 ID=SMED30005285|Name=fas apoptotic inhibitory molecule 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=900bp
ATATAAATCTTATATGAATTTTTAACTTATTGCAACAAAGATGGCTCAAT
TTGGCAATGTCGTTGAATGGAAAATACCTTTAAGCGACCGAATTCATGTT
GTCAAATTTGAGCATGGTACAACCAGTGGTCGAAGAGTTATTTTTGTAGA
TGATAAAGAGATTAAACGTGAAGATTTCATGTTTAAATTAGTCGGCTCAG
AATGTTTTAATATCGGAAAATCCGTTTGCAAATTGAGTATCAGCACTGGA
ATGAATTCTTCGTATACTTACGATTTGACCGTTAATGGAAAACCACTTGA
TAAATTTGTGGAATGCCAATCTAAGATCCTGATGTGCTGGCTAGTGAGAT
TAGATAATAGGCATAAAGGCGACTCACAGTCGGTATATCGAATCATTCTT
GAAAAAGATACATTGGACATTCTAGTTGACGGAAATATTGTCGAAACAAC
AGGTGAATTCACGGAAAATGGAACCTCGACCTATTTTTCATTTGACGACC
ACACCGGACGTATTGATACGTTTTCTAGCGGTAACAAGCACTTTGGAATG
GTTTACCAATTGTTTGTGGATAACGTCCCCTATCCCGATTCTAAAATAGA
TGACGACCTTAATTCTGAGCTAGATGTGTTATAGTTTGTAATTCATTTTG
CTAGATGTTTACTCAGTATCCCAGCCCCCCCCCTGTAATGCAGTATGATC
CTAGATAATGTTCTCCCTGTTATGTAAAGTAGTAGTAAATATTTCTTTCT
CTGAATATCCAATTATCTATAATTTCAAATTATTTATTTCAATTATCCGC
TCCCCCTTCCCTCCTTAATCAGATTATTCTAATTTTAGAAATATTATTTA
TTTTTATCGATTGTGATCATTTAGAAATCTCTCGTTTGGCAGAAATTTTC
back to top

protein sequence of SMED30005285-orf-1

>SMED30005285-orf-1 ID=SMED30005285-orf-1|Name=SMED30005285-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MAQFGNVVEWKIPLSDRIHVVKFEHGTTSGRRVIFVDDKEIKREDFMFKL
VGSECFNIGKSVCKLSISTGMNSSYTYDLTVNGKPLDKFVECQSKILMCW
LVRLDNRHKGDSQSVYRIILEKDTLDILVDGNIVETTGEFTENGTSTYFS
FDDHTGRIDTFSSGNKHFGMVYQLFVDNVPYPDSKIDDDLNSELDVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038513FAIM1_dom_sf
IPR010695FAIM1
Vocabulary: biological process
TermDefinition
GO:0043066negative regulation of apoptotic process
GO:0006915apoptotic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038513FAIM1 domain superfamilyGENE3DG3DSA:2.40.128.180coord: 98..184
e-value: 7.7E-23
score: 82.2
IPR038513FAIM1 domain superfamilyGENE3DG3DSA:2.40.128.180coord: 5..90
e-value: 2.2E-30
score: 106.6
IPR010695Fas apoptotic inhibitory molecule 1PFAMPF06905FAIM1coord: 7..182
e-value: 9.4E-59
score: 198.0
IPR010695Fas apoptotic inhibitory molecule 1PANTHERPTHR13088FAMILY NOT NAMEDcoord: 7..182