Mannosidase beta

Overview
NameMannosidase beta
Smed IDSMED30005278
Length (bp)3229
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mannosidase beta (SMED30005278) t-SNE clustered cells

Violin plots show distribution of expression levels for Mannosidase beta (SMED30005278) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mannosidase beta (SMED30005278) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mannosidase beta (SMED30005278) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005278

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005278SMESG000055910.1 dd_Smed_v4_3209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005278SMESG000055910.1 dd_Smed_v4_3209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mannosidase beta vs. Ensembl Human
Match: MANBA (mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831])

HSP 1 Score: 401.749 bits (1031), Expect = 8.995e-124
Identity = 273/837 (32.62%), Postives = 423/837 (50.54%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXX---XXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNG-LVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP-ERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCN-VQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAA---NKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQ 2688
            SALFQ   I   +  FND+ YRW++  N+++  E       S     +L + G+D    I  N+  IG T + F   +F I +  V++  N I ++F S+++ A Q ++  + YQVPPDC P    G+CH+NF+RK Q SF WDWGPS    GI   V   + N     + +         +   W+ E+  + F +++       V+  I  ++++    +++     +VE   ++  ++ +++ WWPH  G    Y M     L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P     QD   +  +  L+ SVV ANMNT+R+WGGG  E + FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  +   WY+    D P  IK Y  L+ + I+ +V + D    FI SSP+NG E+     VS+NP S  FGDVHFY Y+ D WN  ++P  R  +E+G+QS P   T E  V S  D+  +     H QHH+ GNKQ++      F KL P +T  L   +K   YLTQ+ Q   +    +    S+  +  +  G T GA++WQLND W AP+W+++++ G WK+ HYF +  F+P   +  EN     N   I     + + Y++   + ++     SS+    + + +   MK      ++   +S+ +++        C+    L  +  ++S           L  P  A      +++  I Q      I + D+++  V+ FV L   S  G FS+NGF +T K+ +I FYPW+
Sbjct:   50 SALFQQGLIQDSYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETDNMFNRYSFDITN--VVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAYN--ICHLNYFTFSPIYDKSAQEWNLEIE-STFDVVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNI-TVETWWPHGHGNQTGYNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPADSF-QDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACALYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKDYVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDCWNWKVFPKARFASEYGYQSWPSFSTLE-KVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAGLHF-KL-PQSTDPL-RTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQ-GHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFEN----ENTFYIYGVSDLHSDYSM---TLSVRVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSADHELLSPTNYHF-----LSSPKEAVGLCKAQITAIISQQG---DIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWE 859          
BLAST of Mannosidase beta vs. Ensembl Human
Match: MANBA (mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831])

HSP 1 Score: 386.726 bits (992), Expect = 4.068e-118
Identity = 237/654 (36.24%), Postives = 350/654 (53.52%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXX---XXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQT-TGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNG-LVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP 2154
            SALFQ   I   +  FND+ YRW++  N+++  E       S     +L + G+D    I  N+  IG T + F   +F I +  V++  N I ++F S+++ A Q ++  + YQVPPDC P    G+CH+NF+RK Q SF WDWGPS    GI   V   + N        F  +  K+      W+ E+  + F +++       V+  I  ++++    +++     +VE   ++  ++ +++ WWPH  G    Y M     L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P     QD   +  +  L+ SVV ANMNT+R+WGGG  E + FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  +   WY+    D P  IK Y  L+ + I+ +V + D    FI SSP+NG E+     VS+NP S  FGDVHFY Y+ D WN  ++P  R  +E+G+QS P   T E  V S  D+  +     H QHH+ GNKQ++      F KL P +T  L   +K   YLTQ+ Q   +    +    S+  +  +  G T GA++WQLND W AP+W+++++ G WK+ HYF +  F+P
Sbjct:   50 SALFQQGLIQDSYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETDNMFNRYSFDITN--VVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSA---QEWNLEIE-STFDVVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNI-TVETWWPHGHGNQTGYNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPADSF-QDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACALYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKDYVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDCWNWKVFPKARFASEYGYQSWPSFSTLE-KVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAGLHF-KL-PQSTDPL-RTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQ-GHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFAQNFFAP 690          
BLAST of Mannosidase beta vs. Ensembl Human
Match: MANBA (mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831])

HSP 1 Score: 384.03 bits (985), Expect = 1.319e-116
Identity = 276/885 (31.19%), Postives = 426/885 (48.14%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXX---XXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQT-TGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNG-LVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPR-----------------------------------------------TYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP-ERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCN-VQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAA---NKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQ 2688
            SALFQ   I   +  FND+ YRW++  N+++  E       S     +L + G+D    I  N+  IG T + F   +F I +  V++  N I ++F S+++ A Q ++  + YQVPPDC P    G+CH+NF+RK Q SF WDWGPS    GI   V   + N        F  +  K+      W+ E+  + F +++       V+  I  ++++    +++     +VE   ++  ++ +++ WWPH  G    Y M     L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P                                                  L  +W N  ++  L+ SVV ANMNT+R+WGGG  E + FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  +   WY+    D P  IK Y  L+ + I+ +V + D    FI SSP+NG E+     VS+NP S  FGDVHFY Y+ D WN  ++P  R  +E+G+QS P   T E  V S  D+  +     H QHH+ GNKQ++      F KL P +T  L   +K   YLTQ+ Q   +    +    S+  +  +  G T GA++WQLND W AP+W+++++ G WK+ HYF +  F+P   +  EN     N   I     + + Y++   + ++     SS+    + + +   MK      ++   +S+ +++        C+    L  +  ++S           L  P  A      +++  I Q      I + D+++  V+ FV L   S  G FS+NGF +T K+ +I FYPW+
Sbjct:   50 SALFQQGLIQDSYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETDNMFNRYSFDITN--VVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSA---QEWNLEIE-STFDVVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNI-TVETWWPHGHGNQTGYNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPADSFQDRVTSELFHKKMKFFSRHSHGIIGSIFFLFKCSSPLPAGAGLAVVLQPNWAN--WLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACALYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKDYVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDCWNWKVFPKARFASEYGYQSWPSFSTLE-KVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAGLHF-KL-PQSTDPL-RTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQ-GHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFEN----ENTFYIYGVSDLHSDYSM---TLSVRVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSADHELLSPTNYHF-----LSSPKEAVGLCKAQITAIISQQG---DIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWE 905          
BLAST of Mannosidase beta vs. Ensembl Human
Match: MANBA (mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831])

HSP 1 Score: 334.724 bits (857), Expect = 1.930e-99
Identity = 228/711 (32.07%), Postives = 352/711 (49.51%), Query Frame = 1
Query:  580 GDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNG-LVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP-ERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCN-VQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAA---NKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQ 2688
            G+    F R  Q SF WDWGPS    GI   V   + N     + +         +   W+ E+  + F +++       V+  I  ++++    +++     +VE   ++  ++ +++ WWPH  G    Y M     L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P     QD   +  +  L+ SVV ANMNT+R+WGGG  E + FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  +   WY+    D P  IK Y  L+ + I+ +V + D    FI SSP+NG E+     VS+NP S  FGDVHFY Y+ D WN  ++P  R  +E+G+QS P   T E  V S  D+  +     H QHH+ GNKQ++      F KL P +T  L   +K   YLTQ+ Q   +    +    S+  +  +  G T GA++WQLND W AP+W+++++ G WK+ HYF +  F+P   +  EN     N   I     + + Y++   + ++     SS+    + + +   MK      ++   +S+ +++        C+    L  +  ++S           L  P  A      +++  I Q      I + D+++  V+ FV L   S  G FS+NGF +T K+ +I FYPW+
Sbjct:  117 GETDNMFNRYEQCSFSWDWGPSFPTQGIWKDVRIEAYN--ICHLNYFTFSPIYDKSAQEWNLEIE-STFDVVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNI-TVETWWPHGHGNQTGYNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPADSF-QDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACALYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKDYVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDCWNWKVFPKARFASEYGYQSWPSFSTLE-KVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAGLHF-KL-PQSTDPL-RTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQ-GHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFEN----ENTFYIYGVSDLHSDYSM---TLSVRVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSADHELLSPTNYHF-----LSSPKEAVGLCKAQITAIISQQG---DIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWE 802          
BLAST of Mannosidase beta vs. Ensembl Human
Match: MANBA (mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831])

HSP 1 Score: 253.447 bits (646), Expect = 3.497e-73
Identity = 158/455 (34.73%), Postives = 238/455 (52.31%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXX---XXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQT-TGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNG-LVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSA 1557
            SALFQ   I   +  FND+ YRW++  N+++  E       S     +L + G+D    I  N+  IG T + F   +F I +  V++  N I ++F S+++ A Q ++  + YQVPPDC P    G+CH+NF+RK Q SF WDWGPS    GI   V   + N        F  +  K+      W+ E+  + F +++       V+  I  ++++    +++     +VE   ++  ++ +++ WWPH  G    Y M     L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P     QD   +  +  L+ SVV ANMNT+R+WGGG  E + FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  +   WY+    D P  IK Y  L+ + I+ +V + 
Sbjct:   50 SALFQQGLIQDSYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETDNMFNRYSFDITN--VVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSA---QEWNLEIE-STFDVVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNI-TVETWWPHGHGNQTGYNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPADSF-QDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACALYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKDYVTLYVKNIRELVLAC 496          
BLAST of Mannosidase beta vs. Ensembl Celegans
Match: C33G3.4 (Probable beta-mannosidase [Source:UniProtKB/Swiss-Prot;Acc:Q93324])

HSP 1 Score: 353.214 bits (905), Expect = 5.976e-106
Identity = 231/681 (33.92%), Postives = 343/681 (50.37%), Query Frame = 1
Query:  199 PVDSFSALFQNSFIDWPWKGFNDIKYRWIAHQN--FSFQXXXXXXXXXXXXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQS----SYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHV---QSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTL---ANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQ-MDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDT---WEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKL-------------YPN-NTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFS 2151
            P D +S L+ +  ID P  G N +  +WIA  +  +S +     +  +    L +  +D   T+++N + +  ++++F+  +  +     L  N+I  IKF SS+  A + A +      + +PPDC P  ++G+CH NFIRK Q SF WDWGPS   VGI   +   + N   G+  F     KT      W      + F   A T      + ++   +S   + L  +K+     +  + L +      + WWP+ +G   LY++   V + GQV + KI   GF++V L Q  +       GR F F IN +P F+KGTNW+P +    D  N    EFL++SV    MN IR+WGGG  E+ HFY+ A   G+++W DLMFACALYP  E F+ +  +EV+  V+ +  H S++++SGNNE E  I   W+      + Q +K Y  L+  + K I     P   FIMSSPSNGVE+E+  GVSKNP    +GD+H+Y    +LW    Y   R  +E+G QS P ++T   W     +ESD+E     M H QHH  G   +   +  +F  L              P+   IS        +Y +Q++Q + L          +   T+EGLG T  AM+WQLND W APTWSTID+  +WK+ HY  +  FS
Sbjct:   48 PGDIYSDLYASGIIDNPLFGENHLNLKWIAEDDWTYSRKFRLIDLDDTVGAFLEIESVDTIATVYVNGQKVLHSRNQFLPYHVNVTDIIALGENDI-TIKFKSSVKYAEKRADEYKKIFGHSLPPDCNPDIYHGECHQNFIRKAQYSFAWDWGPSFPTVGIPSTI---TINIYRGQY-FHDFNWKTRFAHGKWKVAFEFDTFHYGARTIEYSVQIPELGIKESDYYR-LSATKSLQTRSKNIMSLSIPMEHEPERWWPNGMGEQKLYDV--VVSMGGQVKEKKI---GFKTVELVQDLIDPKKPEKGRNFYFKINDEPVFLKGTNWIPVSMFRSDRENIAKTEFLLDSVAEVGMNAIRVWGGGFYESNHFYYYASKKGILVWQDLMFACALYPTTEEFIQNAEEEVSYNVDRISQHTSVIVFSGNNENEAAIRGHWWKASNYTESQQVKDYVLLYQRLAK-IAKKVAPTIPFIMSSPSNGVETEEEGGVSKNPYDVRYGDIHYYNEFVNLWRDDTYLTPRCASEYGVQSYPMKETMLNW----INESDWEYTSKAMFHRQHHPGG---IATNLLMIFQHLPIPAECGSKSVSDVPSCKYISSASYMSRLAYFSQVHQSIALKTQTLHYRRFRNTTTNEGLGNTMCAMYWQLNDVWAAPTWSTIDFEQNWKMAHYEARRFFS 709          
BLAST of Mannosidase beta vs. Ensembl Celegans
Match: Y105E8B.9 (pep chromosome:WBcel235:I:14675600:14682566:-1 gene:WBGene00013693.1 transcript:Y105E8B.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y105E8B.9)

HSP 1 Score: 53.1434 bits (126), Expect = 9.189e-7
Identity = 41/188 (21.81%), Postives = 84/188 (44.68%), Query Frame = 1
Query:  916 HVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSL--------GLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVL 1455
             + + KLWWP  +G P LY ++  ++L G++ D   +  GFR+V+ + + +           IN KPF+  G        + +D+           +++T ++N +   GG    T H+ +  + +         +++    +        N N   HV K + ++++  + HPS++ WS  NE + +
Sbjct:  276 QISNPKLWWPRGMGKPDLYSLEVSLILDGELADIYREQFGFRTVTWSDSQIF----------INSKPFYCLGFG------MHEDFE--IIGRGFNQAIMTKDLNLLEWMGGNCYRTTHYPYSEERMFENDRRGIAVIVETPAVGLKGFSKANNNL--HV-KMLQDMIDRDKNHPSVIAWSLANEPQTM 442          
BLAST of Mannosidase beta vs. Ensembl Fly
Match: beta-Man (gene:FBgn0037215 transcript:FBtr0336704)

HSP 1 Score: 339.347 bits (869), Expect = 1.219e-100
Identity = 273/931 (29.32%), Postives = 441/931 (47.37%), Query Frame = 1
Query:   43 SIVQSSTLTNIMKFLALIFILFYCG---HVLETFEITKWTLXXXXXXXXXXXXXXPVDSFSALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQ---XXXXXXXXXXXXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTA---RQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVI------------NVFILLAETKTQICVVNK--ITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEM----KTYVLLTG-----QVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLF-GEVI---KTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGV--LMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYK-WFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITI--ENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQ--SSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQ-KFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSI----CL-------------LDVQSHYVSLFVTLTTPSWGTFSNNGFHIT 2652
             ++++ T   +M  + L+  L+ C      +E  E++ WT+ + +  + I N + P+  +SA F    +D     +ND+  R++A+ NF+F                +L+  G+D    I LN + +G T + F+  ++ ++S  +L++ N + ++  S ++ A   A   +++   VPP+C  + ++G+CH+N +RK QASF WDWGP+  + GI   VE          I+ V V   +  N S+W+  +               + +   E   +  VV++  I N+ S L   ++          F   +    +  WWP+  G   LY +    KT++   G     +   +K   VGFR++ L +    + +G  F F +N    F+KG+N++P   L +   N   I  L+ S   A+MN +R+WGGG  E+++FY LADSLGL+IW D+MFACA+YP N+ FLS VR+EV +    L  HPS+ ++  NNE E  + Q WY T     +    Y+ L+   VI   K +  S+ P    ++SSPSNG  SE    +S NPQ    GDVHFY Y  D W+  ++P  R  +EFGFQS P    W+      S  E D +  L+ H QHH  GN  +I  V       +P N     E Y     Y +QI Q   +   ++  L      T      T GA++WQLND W+AP+WS+ID++G+WKL HY+ ++  +P  I    E   DS+N+ LI        Q  +  R  N+   +   S ++  ++  +D       VQ    + +S  +Q +F  +N      E+ L+R + ++S               P++ A  V +    ++P   I    CL             + V+   V +++ L  P   T S NGF  T
Sbjct:    6 GLLRNGTTGAVM--VGLVCGLYVCSGQCDKVEVIELSNWTITNQNGSLTIANQTLPLGIYSA-FAPQVLD----SYNDVGLRYLAYDNFTFSNFFQFDVHHFNRGHINLTFHGIDTVSEIRLNHQLLGRTDNMFVRYSYEVSS--LLQAENFLEVEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMNMLRKMQASFSWDWGPAAPSAGIWKNVELEIYE--VAVIREVDV-DVSRVNGSYWNMHIRCFLDAGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNI-SHLAPVIE----------FDQAVPNGKVVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLDLVEDPAPDGVGNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQ-ISHLLRSAKEAHMNMLRVWGGGVYESDYFYQLADSLGLLIWQDMMFACAMYPVNDEFLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWYGTLFERDRFESEYRELYLANVIHELKLVSHSSRPQP--LVSSPSNGKASEPDNYISSNPQDNQNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQ-----RSKGEDDDLLGLITHRQHHPLGNVPVIALVERHLPLPFPEN-----ENYATALIYFSQIAQA--MATKVETELYRSLRDTPH---RTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYWARDFLAPISIVALYEKSTDSLNISLICD------QLEVDPRELNVVANVHLWSQLLPRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTN---AFLELQLRRGQDVISRTHFF----------PSSIAGAVGI----EDPGLEIASRTCLNTTNVVRNSVSISIQVKRPAVFVYLELLKPYRYTLSENGFMQT 872          
BLAST of Mannosidase beta vs. Ensembl Fly
Match: beta-Man (gene:FBgn0037215 transcript:FBtr0078964)

HSP 1 Score: 338.576 bits (867), Expect = 2.212e-100
Identity = 274/924 (29.65%), Postives = 443/924 (47.94%), Query Frame = 1
Query:   43 SIVQSSTLTNIMKFLALIFILFYCG---HVLETFEITKWTLXXXXXXXXXXXXXXPVDSFSALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQ---XXXXXXXXXXXXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTA---RQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVI------------NVFILLAETKTQICVVNK--ITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEM----KTYVLLTG-----QVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLF-GEVI---KTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGV--LMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYK-WFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITI--ENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQ--SSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQ-KFKCSNIRQCLFEVILKRNESIVS---------VDTLMLVYP-LQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSWGTFSNNGFHIT 2652
             ++++ T   +M  + L+  L+ C      +E  E++ WT+ + +  + I N + P+  +SA F    +D     +ND+  R++A+ NF+F                +L+  G+D    I LN + +G T + F+  ++ ++S  +L++ N + ++  S ++ A   A   +++   VPP+C  + ++G+CH+N +RK QASF WDWGP+  + GI   VE          I+ V V   +  N S+W+  +               + +   E   +  VV++  I N+ S L   ++          F   +    +  WWP+  G   LY +    KT++   G     +   +K   VGFR++ L +    + +G  F F +N    F+KG+N++P   L +   N   I  L+ S   A+MN +R+WGGG  E+++FY LADSLGL+IW D+MFACA+YP N+ FLS VR+EV +    L  HPS+ ++  NNE E  + Q WY T     +    Y+ L+   VI   K +  S+ P    ++SSPSNG  SE    +S NPQ    GDVHFY Y  D W+  ++P  R  +EFGFQS P    W+      S  E D +  L+ H QHH  GN  +I  V       +P N     E Y     Y +QI Q   +   ++  L      T      T GA++WQLND W+AP+WS+ID++G+WKL HY+ ++  +P  I    E   DS+N+ LI        Q  +  R  N+   +   S ++  ++  +D       VQ    + +S  +Q +F  +N      E+ L+R + ++S            + +  P L+ +I      N  +V +R      SI  + V+   V +++ L  P   T S NGF  T
Sbjct:    6 GLLRNGTTGAVM--VGLVCGLYVCSGQCDKVEVIELSNWTITNQNGSLTIANQTLPLGIYSA-FAPQVLD----SYNDVGLRYLAYDNFTFSNFFQFDVHHFNRGHINLTFHGIDTVSEIRLNHQLLGRTDNMFVRYSYEVSS--LLQAENFLEVEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMNMLRKMQASFSWDWGPAAPSAGIWKNVELEIYE--VAVIREVDV-DVSRVNGSYWNMHIRCFLDAGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNI-SHLAPVIE----------FDQAVPNGKVVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLDLVEDPAPDGVGNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQ-ISHLLRSAKEAHMNMLRVWGGGVYESDYFYQLADSLGLLIWQDMMFACAMYPVNDEFLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWYGTLFERDRFESEYRELYLANVIHELKLVSHSSRPQP--LVSSPSNGKASEPDNYISSNPQDNQNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQ-----RSKGEDDDLLGLITHRQHHPLGNVPVIALVERHLPLPFPEN-----ENYATALIYFSQIAQA--MATKVETELYRSLRDTPH---RTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYWARDFLAPISIVALYEKSTDSLNISLICD------QLEVDPRELNVVANVHLWSQLLPRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTN---AFLELQLRRGQDVISRTHFFPSSIAGAVGIEDPGLEFEIASRTCLNTTNV-VRN---SVSIS-IQVKRPAVFVYLELLKPYRYTLSENGFMQT 874          
BLAST of Mannosidase beta vs. Ensembl Fly
Match: beta-Man (gene:FBgn0037215 transcript:FBtr0306022)

HSP 1 Score: 338.576 bits (867), Expect = 2.212e-100
Identity = 274/924 (29.65%), Postives = 443/924 (47.94%), Query Frame = 1
Query:   43 SIVQSSTLTNIMKFLALIFILFYCG---HVLETFEITKWTLXXXXXXXXXXXXXXPVDSFSALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQ---XXXXXXXXXXXXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTA---RQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVI------------NVFILLAETKTQICVVNK--ITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEM----KTYVLLTG-----QVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLF-GEVI---KTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGV--LMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYK-WFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITI--ENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQ--SSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQ-KFKCSNIRQCLFEVILKRNESIVS---------VDTLMLVYP-LQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSWGTFSNNGFHIT 2652
             ++++ T   +M  + L+  L+ C      +E  E++ WT+ + +  + I N + P+  +SA F    +D     +ND+  R++A+ NF+F                +L+  G+D    I LN + +G T + F+  ++ ++S  +L++ N + ++  S ++ A   A   +++   VPP+C  + ++G+CH+N +RK QASF WDWGP+  + GI   VE          I+ V V   +  N S+W+  +               + +   E   +  VV++  I N+ S L   ++          F   +    +  WWP+  G   LY +    KT++   G     +   +K   VGFR++ L +    + +G  F F +N    F+KG+N++P   L +   N   I  L+ S   A+MN +R+WGGG  E+++FY LADSLGL+IW D+MFACA+YP N+ FLS VR+EV +    L  HPS+ ++  NNE E  + Q WY T     +    Y+ L+   VI   K +  S+ P    ++SSPSNG  SE    +S NPQ    GDVHFY Y  D W+  ++P  R  +EFGFQS P    W+      S  E D +  L+ H QHH  GN  +I  V       +P N     E Y     Y +QI Q   +   ++  L      T      T GA++WQLND W+AP+WS+ID++G+WKL HY+ ++  +P  I    E   DS+N+ LI        Q  +  R  N+   +   S ++  ++  +D       VQ    + +S  +Q +F  +N      E+ L+R + ++S            + +  P L+ +I      N  +V +R      SI  + V+   V +++ L  P   T S NGF  T
Sbjct:    6 GLLRNGTTGAVM--VGLVCGLYVCSGQCDKVEVIELSNWTITNQNGSLTIANQTLPLGIYSA-FAPQVLD----SYNDVGLRYLAYDNFTFSNFFQFDVHHFNRGHINLTFHGIDTVSEIRLNHQLLGRTDNMFVRYSYEVSS--LLQAENFLEVEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMNMLRKMQASFSWDWGPAAPSAGIWKNVELEIYE--VAVIREVDV-DVSRVNGSYWNMHIRCFLDAGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNI-SHLAPVIE----------FDQAVPNGKVVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLDLVEDPAPDGVGNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQ-ISHLLRSAKEAHMNMLRVWGGGVYESDYFYQLADSLGLLIWQDMMFACAMYPVNDEFLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWYGTLFERDRFESEYRELYLANVIHELKLVSHSSRPQP--LVSSPSNGKASEPDNYISSNPQDNQNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQ-----RSKGEDDDLLGLITHRQHHPLGNVPVIALVERHLPLPFPEN-----ENYATALIYFSQIAQA--MATKVETELYRSLRDTPH---RTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYWARDFLAPISIVALYEKSTDSLNISLICD------QLEVDPRELNVVANVHLWSQLLPRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTN---AFLELQLRRGQDVISRTHFFPSSIAGAVGIEDPGLEFEIASRTCLNTTNV-VRN---SVSIS-IQVKRPAVFVYLELLKPYRYTLSENGFMQT 874          
BLAST of Mannosidase beta vs. Ensembl Fly
Match: beta-Man (gene:FBgn0037215 transcript:FBtr0336703)

HSP 1 Score: 314.694 bits (805), Expect = 6.105e-93
Identity = 224/703 (31.86%), Postives = 346/703 (49.22%), Query Frame = 1
Query:  454 SFVLKSNNIIVIKFISSLMLANQTA---RQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVI------------NVFILLAETKTQICVVNK--ITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEM----KTYVLLTG-----QVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLF-GEVI---KTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGV--LMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYK-WFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITI--ENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQ--SSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQ-KFKCSNIRQCLFEVILKRNESIVS 2448
            S +L++ N + ++  S ++ A   A   +++   VPP+C  + ++G+CH+N +RK QASF WDWGP+  + GI   VE          I+ V V   +  N S+W+  +               + +   E   +  VV++  I N+ S L   ++          F   +    +  WWP+  G   LY +    KT++   G     +   +K   VGFR++ L +    + +G  F F +N    F+KG+N++P   L +   N   I  L+ S   A+MN +R+WGGG  E+++FY LADSLGL+IW D+MFACA+YP N+ FLS VR+EV +    L  HPS+ ++  NNE E  + Q WY T     +    Y+ L+   VI   K +  S+ P    ++SSPSNG  SE    +S NPQ    GDVHFY Y  D W+  ++P  R  +EFGFQS P    W+      S  E D +  L+ H QHH  GN  +I  V       +P N     E Y     Y +QI Q   +   ++  L      T      T GA++WQLND W+AP+WS+ID++G+WKL HY+ ++  +P  I    E   DS+N+ LI        Q  +  R  N+   +   S ++  ++  +D       VQ    + +S  +Q +F  +N      E+ L+R + ++S
Sbjct:   10 SSLLQAENFLEVEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMNMLRKMQASFSWDWGPAAPSAGIWKNVELEIYE--VAVIREVDV-DVSRVNGSYWNMHIRCFLDAGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNI-SHLAPVIE----------FDQAVPNGKVVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLDLVEDPAPDGVGNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQ-ISHLLRSAKEAHMNMLRVWGGGVYESDYFYQLADSLGLLIWQDMMFACAMYPVNDEFLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWYGTLFERDRFESEYRELYLANVIHELKLVSHSSRPQP--LVSSPSNGKASEPDNYISSNPQDNQNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQ-----RSKGEDDDLLGLITHRQHHPLGNVPVIALVERHLPLPFPEN-----ENYATALIYFSQIAQA--MATKVETELYRSLRDTPH---RTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYWARDFLAPISIVALYEKSTDSLNISLICD------QLEVDPRELNVVANVHLWSQLLPRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTN---AFLELQLRRGQDVIS 671          
BLAST of Mannosidase beta vs. Ensembl Fly
Match: beta-Man (gene:FBgn0037215 transcript:FBtr0336702)

HSP 1 Score: 314.694 bits (805), Expect = 6.105e-93
Identity = 224/703 (31.86%), Postives = 346/703 (49.22%), Query Frame = 1
Query:  454 SFVLKSNNIIVIKFISSLMLANQTA---RQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVI------------NVFILLAETKTQICVVNK--ITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEM----KTYVLLTG-----QVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLF-GEVI---KTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGV--LMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYK-WFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITI--ENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQ--SSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQ-KFKCSNIRQCLFEVILKRNESIVS 2448
            S +L++ N + ++  S ++ A   A   +++   VPP+C  + ++G+CH+N +RK QASF WDWGP+  + GI   VE          I+ V V   +  N S+W+  +               + +   E   +  VV++  I N+ S L   ++          F   +    +  WWP+  G   LY +    KT++   G     +   +K   VGFR++ L +    + +G  F F +N    F+KG+N++P   L +   N   I  L+ S   A+MN +R+WGGG  E+++FY LADSLGL+IW D+MFACA+YP N+ FLS VR+EV +    L  HPS+ ++  NNE E  + Q WY T     +    Y+ L+   VI   K +  S+ P    ++SSPSNG  SE    +S NPQ    GDVHFY Y  D W+  ++P  R  +EFGFQS P    W+      S  E D +  L+ H QHH  GN  +I  V       +P N     E Y     Y +QI Q   +   ++  L      T      T GA++WQLND W+AP+WS+ID++G+WKL HY+ ++  +P  I    E   DS+N+ LI        Q  +  R  N+   +   S ++  ++  +D       VQ    + +S  +Q +F  +N      E+ L+R + ++S
Sbjct:   10 SSLLQAENFLEVEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMNMLRKMQASFSWDWGPAAPSAGIWKNVELEIYE--VAVIREVDV-DVSRVNGSYWNMHIRCFLDAGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNI-SHLAPVIE----------FDQAVPNGKVVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLDLVEDPAPDGVGNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQ-ISHLLRSAKEAHMNMLRVWGGGVYESDYFYQLADSLGLLIWQDMMFACAMYPVNDEFLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWYGTLFERDRFESEYRELYLANVIHELKLVSHSSRPQP--LVSSPSNGKASEPDNYISSNPQDNQNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQ-----RSKGEDDDLLGLITHRQHHPLGNVPVIALVERHLPLPFPEN-----ENYATALIYFSQIAQA--MATKVETELYRSLRDTPH---RTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYWARDFLAPISIVALYEKSTDSLNISLICD------QLEVDPRELNVVANVHLWSQLLPRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTN---AFLELQLRRGQDVIS 671          
BLAST of Mannosidase beta vs. Ensembl Zebrafish
Match: manba (mannosidase, beta A, lysosomal [Source:ZFIN;Acc:ZDB-GENE-040426-721])

HSP 1 Score: 402.905 bits (1034), Expect = 4.371e-124
Identity = 273/849 (32.16%), Postives = 424/849 (49.94%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXX---------XGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQG---VILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITR-------SFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKR-NESIVSVDTLMLVYPLQLD--IPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPW 2685
            +AL +   I  P+  FND+ YRWI+  N+++ +                         G+D   TI LN   IGTT + F   +F + +  +    NI+ +  +S++  A+Q +R  + Y+VPPDC P    G+CH+NFIRK Q+SF WDWGPS   +GI   V     N  T ++       K  +  S WS EV +  F ++  +K  + +   +   +++ Q  L   +     F   V    Q++ LWWP   G   LY ++  V L         + V FR+V L Q  + +  G  F F IN KP F+KG+NW+P  +  QD      I  L+ S   ANMN +R+WGGG  E + FY+L D  G+MIW D MFACALYP   +F+  VR+E+T+ V  L+ HPS+++WSGNNE E  IA  W+N    D P  +K Y +L+ + I+ IV   D    F++SSP+NGVESE+   V++NP    FGD H+Y Y  D W+ + +P TR  +E+GFQS P   T   +  S SD++       H QHH+DGN+Q++      +  + PN+T S+ ++Y+   Y+TQ+ Q     I   + +R  S      SEG G T G ++WQLND W  P+WS++++ G WK+ HY+  + ++P  +    I D  ++++    +    Q+++  +       SFN    L+S++         T         +F  ++S  + +      R C+    L    E I   + + L  P Q +    PN         + Q   +F++ L      + +++V L      G F+ NGF + SK T++ F  W
Sbjct:   64 TALQRQGVISDPYYRFNDLAYRWISLDNWTYTTSFSLPACVEEVQDVQGKGKVVLVFEGVDTISTISLNGVTIGTTDNMFRRYDFDV-TGLLKDQENILQVFIMSAVAYASQRSRAHTKYRVPPDCPPPVQKGECHVNFIRKAQSSFSWDWGPSFPTLGIWKGVRLEVFN--TFRVLSFTTSPKYDSADSSWSVEVEL-FFDVVVASKGLVHISIPLLLSEAEFQLSLTPGQRKTF-FILQVN-QFQNVSLWWPFGHGDQRLYNLEINVKLDDGETFKAQRMVAFRTVKLVQELIPSSPGLSFYFRINGKPIFLKGSNWIP-VHAFQDQVTTDMITVLLRSAQKANMNALRVWGGGVYEQDFFYNLCDMYGIMIWQDFMFACALYPTERDFIQTVREEITQQVRRLKSHPSVVIWSGNNENEAAIATDWFNISVADRPLYVKDYVNLYVDNIRDIVLQEDSSRPFLVSSPTNGVESEREGWVAQNPYDPNFGDTHYYNYFTDCWDWTAFPRTRFASEYGFQSWPSLSTLSKVSVS-SDWDFSSNFSAHRQHHEDGNQQMLRQAELHY--ILPNSTDSV-QRYRDTIYITQVMQAQCVKIQTEFYRRSRSD----ISEGKGHTMGTLYWQLNDIWQGPSWSSVEFGGKWKMLHYWAADFYAP--VLSVGIEDKGDLLIYAVSDRQSEQHSVKAKVKLFSWSSFNPVCSLESNM---------TTVKAGGSTLVFQQSMSALLSQCGNCTRRSCIITFHLSSAAEPISPHNHIFLSSPRQAEGLQKPNITFTVKDAGVVQ---NFAVTL---HCSFPAVYVWLDVDDVPGHFNLNGFLMLSKKTTVIFGAW 880          
BLAST of Mannosidase beta vs. Ensembl Zebrafish
Match: manba (mannosidase, beta A, lysosomal [Source:ZFIN;Acc:ZDB-GENE-040426-721])

HSP 1 Score: 394.045 bits (1011), Expect = 1.773e-120
Identity = 272/880 (30.91%), Postives = 426/880 (48.41%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXX---------XGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGI-------------------------------RGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQG---VILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITR-------SFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKR-NESIVSVDTLMLVYPLQLD--IPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPW 2685
            +AL +   I  P+  FND+ YRWI+  N+++ +                         G+D   TI LN   IGTT + F   +F + +  +    NI+ +  +S++  A+Q +R  + Y+VPPDC P    G+CH+NFIRK Q+SF WDWGPS   +GI                                G   +   +Q+   + F+       +  S WS EV +  F ++  +K  + +   +   +++ Q  L   +     F   V    Q++ LWWP   G   LY ++  V L         + V FR+V L Q  + +  G  F F IN KP F+KG+NW+P  +  QD      I  L+ S   ANMN +R+WGGG  E + FY+L D  G+MIW D MFACALYP   +F+  VR+E+T+ V  L+ HPS+++WSGNNE E  IA  W+N    D P  +K Y +L+ + I+ IV   D    F++SSP+NGVESE+   V++NP    FGD H+Y Y  D W+ + +P TR  +E+GFQS P   T   +  S SD++       H QHH+DGN+Q++      +  + PN+T S+ ++Y+   Y+TQ+ Q     I   + +R  S      SEG G T G ++WQLND W  P+WS++++ G WK+ HY+  + ++P  +    I D  ++++    +    Q+++  +       SFN    L+S++         T         +F  ++S  + +      R C+    L    E I   + + L  P Q +    PN         + Q   +F++ L      + +++V L      G F+ NGF + SK T++ F  W
Sbjct:   64 TALQRQGVISDPYYRFNDLAYRWISLDNWTYTTSFSLPACVEEVQDVQGKGKVVLVFEGVDTISTISLNGVTIGTTDNMFRRYDFDV-TGLLKDQENILQVFIMSAVAYASQRSRAHTKYRVPPDCPPPVQKGECHVNFIRKAQSSFSWDWGPSFPTLGIWKGVRLEVFNTFRVLSFTTSPKYGMFCKLKSSGFSNYQHKSQSNAHMFFIYHFLYLDSADSSWSVEVEL-FFDVVVASKGLVHISIPLLLSEAEFQLSLTPGQRKTF-FILQVN-QFQNVSLWWPFGHGDQRLYNLEINVKLDDGETFKAQRMVAFRTVKLVQELIPSSPGLSFYFRINGKPIFLKGSNWIP-VHAFQDQVTTDMITVLLRSAQKANMNALRVWGGGVYEQDFFYNLCDMYGIMIWQDFMFACALYPTERDFIQTVREEITQQVRRLKSHPSVVIWSGNNENEAAIATDWFNISVADRPLYVKDYVNLYVDNIRDIVLQEDSSRPFLVSSPTNGVESEREGWVAQNPYDPNFGDTHYYNYFTDCWDWTAFPRTRFASEYGFQSWPSLSTLSKVSVS-SDWDFSSNFSAHRQHHEDGNQQMLRQAELHY--ILPNSTDSV-QRYRDTIYITQVMQAQCVKIQTEFYRRSRSD----ISEGKGHTMGTLYWQLNDIWQGPSWSSVEFGGKWKMLHYWAADFYAP--VLSVGIEDKGDLLIYAVSDRQSEQHSVKAKVKLFSWSSFNPVCSLESNM---------TTVKAGGSTLVFQQSMSALLSQCGNCTRRSCIITFHLSSAAEPISPHNHIFLSSPRQAEGLQKPNITFTVKDAGVVQ---NFAVTL---HCSFPAVYVWLDVDDVPGHFNLNGFLMLSKKTTVIFGAW 913          
BLAST of Mannosidase beta vs. Ensembl Xenopus
Match: rassf7 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 [Source:Xenbase;Acc:XB-GENE-956640])

HSP 1 Score: 394.43 bits (1012), Expect = 6.381e-121
Identity = 275/864 (31.83%), Postives = 427/864 (49.42%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQ-TTGKIKFVKVLTKT-TANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKL-HVQS---LKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKR--YQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPL---------QLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW---GTFSNNGFHITSKSTSINFYPWQTGA----ETFFNCSQL 2724
            +AL +   I+ P+  FND  Y+WIA   + +                 L   G+D   TI LN+  +  T + F  T + ++ + ++  +N I ++F S++  A   +  S+Y+VPPDC P+   G+CH+NFIRK+Q SF WDWGPS    GI  +V   + N      + FV V  K   A  S W+  +  +VF ++        V  KI ++     +   V   G  E +  VK+  V+S   + LWWP+  G+   Y +    L  G      +  + FRSV L +  +   LG  F   IN  P F+KG+NW+P     QD      +  L+ SVV ANMNT+R+WGGG  E++ FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  IA  W++    + +++ R  Y  L+ + I  +V   D    FI SSP+NG ES +   ++KNP    +GD+H+Y Y+ D W+   YP  R+ +E+GFQS P   T +  V    D+        H QHH  GN+Q++      +     N+ I   +++++  YLTQ+ Q   +    +    S   +   GLG T GA++WQLND W AP+WS+I++ G WK+ HY+ K  F+P   +    +D + +  +          + +T+  ++  E++   +Y  N L    + +   + IF VN S+  ++     +R+C       R  S+V    L    P           L          ++V I ++N  F+  L+   +  V+ FV L    W   G FS+NGF +  K+ ++ FYPWQT +    + F N + L
Sbjct:   58 TALAEQLLIEDPYVRFNDAVYKWIAQDEWIYSRTFSLPLDIRLWQKVILVFEGIDTVSTILLNNISVAKTYNMF--TRYTVDVTKIVAKDNNIEVQFQSAVNWAKDRSGNSTYKVPPDCPPQVQKGECHVNFIRKSQCSFSWDWGPSFPTQGIWKEVRIEAYNAFHLDYLSFVPVFGKYYNAQISQWTV-LFESVFDVITNGPLPGNVTVKIPDLNVDEMQTF-VLIPGQQELKMTVKISKVRSKIEVNLWWPNGYGSQNSYNLTVKFLFDGGYTYVFVVQIYFRSVELVEEPIQGSLGLSFYMKINQVPIFLKGSNWIPADSF-QDKITLNRLHNLLQSVVDANMNTLRVWGGGLYESDEFYRLCDELGIMVWQDFMFACALYPTDKWFLETVEAEVIHQMRRLRSHPSIIVWSGNNENEAAIADNWFSIS-AEKEDVYRMDYVTLYIKTIMPLVLKMDETRPFISSSPTNGKESVQEYWLAKNPYDNHYGDIHYYSYITDCWDWKSYPKPRLASEYGFQSWPSLSTLK-KVSVPVDWHYTSNFCSHRQHHSSGNEQMLSQAKLHYKNPENNDPI---KEFQYTLYLTQVMQAQCVKLQTEFYRRSMREIVG-GLGHTMGALYWQLNDIWQAPSWSSIEYGGKWKMLHYYAKNFFTPVAASAFEDKDVLQIYGV----------SDLTKLLSLQLEVK---VYRWNSLLPVCE-RLTEELIFNVNTSQIYKEPIPELLRRCQNST---RENSVVVFSLLNQGQPYSSMNWHYLTSLKHAQGLLQPNITVSITRENTGFAFHLV---TSSVAPFVWLDV--WDISGRFSDNGFLLAEKTKTVYFYPWQTTSVDELQRFLNVTTL 888          
BLAST of Mannosidase beta vs. Ensembl Xenopus
Match: rassf7 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 [Source:Xenbase;Acc:XB-GENE-956640])

HSP 1 Score: 394.045 bits (1011), Expect = 6.486e-121
Identity = 272/860 (31.63%), Postives = 423/860 (49.19%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQ-TTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQ-SLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKR--YQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPL---------QLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW---GTFSNNGFHITSKSTSINFYPWQTGA----ETFFNCSQL 2724
            +AL +   I+ P+  FND  Y+WIA   + +                 L   G+D   TI LN+  +  T + F  T + ++ + ++  +N I ++F S++  A   +  S+Y+VPPDC P+   G+CH+NFIRK+Q SF WDWGPS    GI  +V   + N      + FV V  K     S W+  +  +VF ++        V  KI ++     +   V   G  E +  VK+  +  + LWWP+  G+   Y +    L  G         + FRSV L +  +   LG  F   IN  P F+KG+NW+P     QD      +  L+ SVV ANMNT+R+WGGG  E++ FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  IA  W++    + +++ R  Y  L+ + I  +V   D    FI SSP+NG ES +   ++KNP    +GD+H+Y Y+ D W+   YP  R+ +E+GFQS P   T +  V    D+        H QHH  GN+Q++      +     N+ I   +++++  YLTQ+ Q   +    +    S   +   GLG T GA++WQLND W AP+WS+I++ G WK+ HY+ K  F+P   +    +D + +  +          + +T+  ++  E++   +Y  N L    + +   + IF VN S+  ++     +R+C       R  S+V    L    P           L          ++V I ++N  F+  L+   +  V+ FV L    W   G FS+NGF +  K+ ++ FYPWQT +    + F N + L
Sbjct:   48 TALAEQLLIEDPYVRFNDAVYKWIAQDEWIYSRTFSLPLDIRLWQKVILVFEGIDTVSTILLNNISVAKTYNMF--TRYTVDVTKIVAKDNNIEVQFQSAVNWAKDRSGNSTYKVPPDCPPQVQKGECHVNFIRKSQCSFSWDWGPSFPTQGIWKEVRIEAYNAFHLDYLSFVPVFDK----ISQWTV-LFESVFDVITNGPLPGNVTVKIPDLNVDEMQTF-VLIPGQQELKMTVKISKKIEVNLWWPNGYGSQNSYNLTVKFLFDGGYTVENTTKIYFRSVELVEEPIQGSLGLSFYMKINQVPIFLKGSNWIPADSF-QDKITLNRLHNLLQSVVDANMNTLRVWGGGLYESDEFYRLCDELGIMVWQDFMFACALYPTDKWFLETVEAEVIHQMRRLRSHPSIIVWSGNNENEAAIADNWFSIS-AEKEDVYRMDYVTLYIKTIMPLVLKMDETRPFISSSPTNGKESVQEYWLAKNPYDNHYGDIHYYSYITDCWDWKSYPKPRLASEYGFQSWPSLSTLK-KVSVPVDWHYTSNFCSHRQHHSSGNEQMLSQAKLHYKNPENNDPI---KEFQYTLYLTQVMQAQCVKLQTEFYRRSMREIVG-GLGHTMGALYWQLNDIWQAPSWSSIEYGGKWKMLHYYAKNFFTPVAASAFEDKDVLQIYGV----------SDLTKLLSLQLEVK---VYRWNSLLPVCE-RLTEELIFNVNTSQIYKEPIPELLRRCQNST---RENSVVVFSLLNQGQPYSSMNWHYLTSLKHAQGLLQPNITVSITRENTGFAFHLV---TSSVAPFVWLDV--WDISGRFSDNGFLLAEKTKTVYFYPWQTTSVDELQRFLNVTTL 870          
BLAST of Mannosidase beta vs. Ensembl Xenopus
Match: rassf7 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 [Source:Xenbase;Acc:XB-GENE-956640])

HSP 1 Score: 393.66 bits (1010), Expect = 9.750e-121
Identity = 272/860 (31.63%), Postives = 423/860 (49.19%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQ-TTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQ-SLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKR--YQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPL---------QLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW---GTFSNNGFHITSKSTSINFYPWQTGA----ETFFNCSQL 2724
            +AL +   I+ P+  FND  Y+WIA   + +                 L   G+D   TI LN+  +  T + F  T + ++ + ++  +N I ++F S++  A   +  S+Y+VPPDC P+   G+CH+NFIRK+Q SF WDWGPS    GI  +V   + N      + FV V  K     S W+  +  +VF ++        V  KI ++     +   V   G  E +  VK+  +  + LWWP+  G+   Y +    L  G         + FRSV L +  +   LG  F   IN  P F+KG+NW+P     QD      +  L+ SVV ANMNT+R+WGGG  E++ FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  IA  W++    + +++ R  Y  L+ + I  +V   D    FI SSP+NG ES +   ++KNP    +GD+H+Y Y+ D W+   YP  R+ +E+GFQS P   T +  V    D+        H QHH  GN+Q++      +     N+ I   +++++  YLTQ+ Q   +    +    S   +   GLG T GA++WQLND W AP+WS+I++ G WK+ HY+ K  F+P   +    +D + +  +          + +T+  ++  E++   +Y  N L    + +   + IF VN S+  ++     +R+C       R  S+V    L    P           L          ++V I ++N  F+  L+   +  V+ FV L    W   G FS+NGF +  K+ ++ FYPWQT +    + F N + L
Sbjct:   59 TALAEQLLIEDPYVRFNDAVYKWIAQDEWIYSRTFSLPLDIRLWQKVILVFEGIDTVSTILLNNISVAKTYNMF--TRYTVDVTKIVAKDNNIEVQFQSAVNWAKDRSGNSTYKVPPDCPPQVQKGECHVNFIRKSQCSFSWDWGPSFPTQGIWKEVRIEAYNAFHLDYLSFVPVFDK----ISQWTV-LFESVFDVITNGPLPGNVTVKIPDLNVDEMQTF-VLIPGQQELKMTVKISKKIEVNLWWPNGYGSQNSYNLTVKFLFDGGYTVENTTKIYFRSVELVEEPIQGSLGLSFYMKINQVPIFLKGSNWIPADSF-QDKITLNRLHNLLQSVVDANMNTLRVWGGGLYESDEFYRLCDELGIMVWQDFMFACALYPTDKWFLETVEAEVIHQMRRLRSHPSIIVWSGNNENEAAIADNWFSIS-AEKEDVYRMDYVTLYIKTIMPLVLKMDETRPFISSSPTNGKESVQEYWLAKNPYDNHYGDIHYYSYITDCWDWKSYPKPRLASEYGFQSWPSLSTLK-KVSVPVDWHYTSNFCSHRQHHSSGNEQMLSQAKLHYKNPENNDPI---KEFQYTLYLTQVMQAQCVKLQTEFYRRSMREIVG-GLGHTMGALYWQLNDIWQAPSWSSIEYGGKWKMLHYYAKNFFTPVAASAFEDKDVLQIYGV----------SDLTKLLSLQLEVK---VYRWNSLLPVCE-RLTEELIFNVNTSQIYKEPIPELLRRCQNST---RENSVVVFSLLNQGQPYSSMNWHYLTSLKHAQGLLQPNITVSITRENTGFAFHLV---TSSVAPFVWLDV--WDISGRFSDNGFLLAEKTKTVYFYPWQTTSVDELQRFLNVTTL 881          
BLAST of Mannosidase beta vs. Ensembl Xenopus
Match: rassf7 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 [Source:Xenbase;Acc:XB-GENE-956640])

HSP 1 Score: 391.349 bits (1004), Expect = 5.607e-120
Identity = 270/860 (31.40%), Postives = 424/860 (49.30%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQ-TTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMK-SKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKR--YQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPL---------QLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW---GTFSNNGFHITSKSTSINFYPWQTGA----ETFFNCSQL 2724
            +AL +   I+ P+  FND  Y+WIA   + +                 L   G+D   TI LN+  +  T + F  T + ++ + ++  +N I ++F S++  A   +  S+Y+VPPDC P+   G+CH+NFIRK+Q SF WDWGPS    GI  +V   + N      + FV V  K     S W+  +  +VF ++        V  KI ++   ++Q  +      L+  +  +K+    + LWWP+  G+   Y +    L  G         + FRSV L +  +   LG  F   IN  P F+KG+NW+P     QD      +  L+ SVV ANMNT+R+WGGG  E++ FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  IA  W++    + +++ R  Y  L+ + I  +V   D    FI SSP+NG ES +   ++KNP    +GD+H+Y Y+ D W+   YP  R+ +E+GFQS P   T +  V    D+        H QHH  GN+Q++      +     N+ I   +++++  YLTQ+ Q   +    +    S   +   GLG T GA++WQLND W AP+WS+I++ G WK+ HY+ K  F+P   +    +D + +  +          + +T+  ++  E++   +Y  N L    + +   + IF VN S+  ++     +R+C       R  S+V    L    P           L          ++V I ++N  F+  L+   +  V+ FV L    W   G FS+NGF +  K+ ++ FYPWQT +    + F N + L
Sbjct:   51 TALAEQLLIEDPYVRFNDAVYKWIAQDEWIYSRTFSLPLDIRLWQKVILVFEGIDTVSTILLNNISVAKTYNMF--TRYTVDVTKIVAKDNNIEVQFQSAVNWAKDRSGNSTYKVPPDCPPQVQKGECHVNFIRKSQCSFSWDWGPSFPTQGIWKEVRIEAYNAFHLDYLSFVPVFDK----ISQWTV-LFESVFDVITNGPLPGNVTVKIPDLNVDEMQTFV------LIPGQQELKMTKIEVNLWWPNGYGSQNSYNLTVKFLFDGGYTVENTTKIYFRSVELVEEPIQGSLGLSFYMKINQVPIFLKGSNWIPADSF-QDKITLNRLHNLLQSVVDANMNTLRVWGGGLYESDEFYRLCDELGIMVWQDFMFACALYPTDKWFLETVEAEVIHQMRRLRSHPSIIVWSGNNENEAAIADNWFSIS-AEKEDVYRMDYVTLYIKTIMPLVLKMDETRPFISSSPTNGKESVQEYWLAKNPYDNHYGDIHYYSYITDCWDWKSYPKPRLASEYGFQSWPSLSTLK-KVSVPVDWHYTSNFCSHRQHHSSGNEQMLSQAKLHYKNPENNDPI---KEFQYTLYLTQVMQAQCVKLQTEFYRRSMREIVG-GLGHTMGALYWQLNDIWQAPSWSSIEYGGKWKMLHYYAKNFFTPVAASAFEDKDVLQIYGV----------SDLTKLLSLQLEVK---VYRWNSLLPVCE-RLTEELIFNVNTSQIYKEPIPELLRRCQNST---RENSVVVFSLLNQGQPYSSMNWHYLTSLKHAQGLLQPNITVSITRENTGFAFHLV---TSSVAPFVWLDV--WDISGRFSDNGFLLAEKTKTVYFYPWQTTSVDELQRFLNVTTL 868          
BLAST of Mannosidase beta vs. Ensembl Xenopus
Match: rassf7 (Ras association (RalGDS/AF-6) domain family (N-terminal) member 7 [Source:Xenbase;Acc:XB-GENE-956640])

HSP 1 Score: 387.497 bits (994), Expect = 3.488e-118
Identity = 274/883 (31.03%), Postives = 427/883 (48.36%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQ-TTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQ-SLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVP-------------RTYLTQDWNNATFIEF----------LMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKR--YQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPL---------QLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW---GTFSNNGFHITSKSTSINFYPWQTGA----ETFFNCSQL 2724
            +AL +   I+ P+  FND  Y+WIA   + +                 L   G+D   TI LN+  +  T + F  T + ++ + ++  +N I ++F S++  A   +  S+Y+VPPDC P+   G+CH+NFIRK+Q SF WDWGPS    GI  +V   + N      + FV V  K     S W+  +  +VF ++        V  KI ++     +   V   G  E +  VK+  +  + LWWP+  G+   Y +    L  G         + FRSV L +  +   LG  F   IN  P F+KG+NW+P              T +  D+    F+ F          L+ SVV ANMNT+R+WGGG  E++ FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  IA  W++    + +++ R  Y  L+ + I  +V   D    FI SSP+NG ES +   ++KNP    +GD+H+Y Y+ D W+   YP  R+ +E+GFQS P   T +  V    D+        H QHH  GN+Q++      +     N+ I   +++++  YLTQ+ Q   +    +    S   +   GLG T GA++WQLND W AP+WS+I++ G WK+ HY+ K  F+P   +    +D + +  +          + +T+  ++  E++   +Y  N L    + +   + IF VN S+  ++     +R+C       R  S+V    L    P           L          ++V I ++N  F+  L+   +  V+ FV L    W   G FS+NGF +  K+ ++ FYPWQT +    + F N + L
Sbjct:   59 TALAEQLLIEDPYVRFNDAVYKWIAQDEWIYSRTFSLPLDIRLWQKVILVFEGIDTVSTILLNNISVAKTYNMF--TRYTVDVTKIVAKDNNIEVQFQSAVNWAKDRSGNSTYKVPPDCPPQVQKGECHVNFIRKSQCSFSWDWGPSFPTQGIWKEVRIEAYNAFHLDYLSFVPVFDK----ISQWTV-LFESVFDVITNGPLPGNVTVKIPDLNVDEMQTF-VLIPGQQELKMTVKISKKIEVNLWWPNGYGSQNSYNLTVKFLFDGGYTVENTTKIYFRSVELVEEPIQGSLGLSFYMKINQVPIFLKGSNWIPADSFQDKITLNRMHTIIITDYICLLFMCFYEFPLTLLHNLLQSVVDANMNTLRVWGGGLYESDEFYRLCDELGIMVWQDFMFACALYPTDKWFLETVEAEVIHQMRRLRSHPSIIVWSGNNENEAAIADNWFSIS-AEKEDVYRMDYVTLYIKTIMPLVLKMDETRPFISSSPTNGKESVQEYWLAKNPYDNHYGDIHYYSYITDCWDWKSYPKPRLASEYGFQSWPSLSTLK-KVSVPVDWHYTSNFCSHRQHHSSGNEQMLSQAKLHYKNPENNDPI---KEFQYTLYLTQVMQAQCVKLQTEFYRRSMREIVG-GLGHTMGALYWQLNDIWQAPSWSSIEYGGKWKMLHYYAKNFFTPVAASAFEDKDVLQIYGV----------SDLTKLLSLQLEVK---VYRWNSLLPVCE-RLTEELIFNVNTSQIYKEPIPELLRRCQNST---RENSVVVFSLLNQGQPYSSMNWHYLTSLKHAQGLLQPNITVSITRENTGFAFHLV---TSSVAPFVWLDV--WDISGRFSDNGFLLAEKTKTVYFYPWQTTSVDELQRFLNVTTL 905          
BLAST of Mannosidase beta vs. Ensembl Mouse
Match: Manba (mannosidase, beta A, lysosomal [Source:MGI Symbol;Acc:MGI:88175])

HSP 1 Score: 407.912 bits (1047), Expect = 3.848e-126
Identity = 277/844 (32.82%), Postives = 432/844 (51.18%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLAN-QTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKN-GLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQN-IKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP---ERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITREL----QSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQTGAET 2703
            SAL Q+  I  P+  FND+ YRWI+  N+++ +E       S      L   G+D    I  N+  IG T + F   +F + +  V+K  N + ++F S++  A  Q+   +SY+VPP+C P E  G+CH+NFIRK Q SF WDWGPS  + GI   V   + N     + ++  L         W+ E+  + F + +       V   I  +K++    +++ +   +V+    ++  V +++ WWP   G    Y M     L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P     QD   +  ++ L  SVV ANMNT+R+WGGG  E + FY L D LG+M+W D MFA ALYP    FL+ VRKEVT  V  L+ HPSI++WSGNNE EV ++  W++    D +  I  Y  L+ + I+ IV S D    FI SSP+NG+++ +   +S +P S  +GD+HFY Y  D WN  ++P  R+ +E+G+QS P   T E  V S+ D+  +     H QHH+DGN Q++  V   F KL P  T  L   +K   YLTQ+ Q   +    +  L S+  +  +G G T GA++WQLND W AP+W+++++ G WK+ HYF +  F+P        E +     V  + K+    TQ T+    ++  + L     SSI+ +                +F + +S+ +++ +      C+       ++ + S      +  L+ D      AN ++V I Q     ++ + D+++  V+ FV L   S  G FS+NGF +  K  S+ FYPW+  +++
Sbjct:   50 SALHQHGLIQDPYYRFNDLNYRWISLDNWTYSTEFKIPFNLSEWQKVKLIFDGVDTVAEILFNNVTIGKTDNMFTGYSFDVTN--VVKDVNSLKLQFRSAVQYAECQSKAHTSYRVPPECPPVEQKGECHVNFIRKAQCSFSWDWGPSFPSQGIWKDVRIEAYN--IAHLDYLTFLPVYDNASQAWNIEIEAS-FDVASSKSVSGQVTVAIPQLKTQQTNDIELQQEQRIVKLLVKIRKDV-AVETWWPRGHGNQTGYNMTILFALDGGLKIEKAAKVYFRTVQLIEEGIKGSPGLSFYFKINGLPIFLKGSNWIPADSF-QDKVTSDRLQLLFQSVVDANMNTLRVWGGGIYEQDEFYALCDELGIMVWQDFMFASALYPTEPGFLASVRKEVTYQVRRLKSHPSIIIWSGNNENEVALSVNWFHVNPRDMKTYIDDYVTLYVKNIRKIVLSEDKSRPFIASSPTNGMKTMEEGWISYDPYSIQYGDIHFYNYADDCWNWKIFPKARLVSEYGYQSWPSFSTLE-KVSSQEDWAYNSRFSLHRQHHEDGNHQMLHQVKMHF-KL-PQGTDPL-RTFKDTIYLTQVMQAQCIKTETEFYLRSRSEIV-DGKGHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFARRFFAPLLPVGFEDEGVFYVYGVSDLHKDH--HTQLTVRLHHWSSPKPLCSLVNSSIVVKAG----------EAVVLFQMPVSELLKRCRGCTRETCVVSFYFSTDKELFSPTNYHFLSSLK-DAKGLLEAN-ITVNISQKG---NVFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMIRKKLSVLFYPWKPTSKS 864          
BLAST of Mannosidase beta vs. Ensembl Mouse
Match: Manba (mannosidase, beta A, lysosomal [Source:MGI Symbol;Acc:MGI:88175])

HSP 1 Score: 77.411 bits (189), Expect = 1.244e-15
Identity = 49/136 (36.03%), Postives = 75/136 (55.15%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXX---XXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLAN-QTARQSSYQVPPDCWPKEFNGDCHINFIRK 609
            SAL Q+  I  P+  FND+ YRWI+  N+++ +E       S      L   G+D    I  N+  IG T + F   +F + +  V+K  N + ++F S++  A  Q+   +SY+VPP+C P E  G+CH+NFIRK
Sbjct:   50 SALHQHGLIQDPYYRFNDLNYRWISLDNWTYSTEFKIPFNLSEWQKVKLIFDGVDTVAEILFNNVTIGKTDNMFTGYSFDVTN--VVKDVNSLKLQFRSAVQYAECQSKAHTSYRVPPECPPVEQKGECHVNFIRK 183          
BLAST of Mannosidase beta vs. Ensembl Mouse
Match: Gusb (glucuronidase, beta [Source:MGI Symbol;Acc:MGI:95872])

HSP 1 Score: 54.6842 bits (130), Expect = 5.931e-7
Identity = 51/204 (25.00%), Postives = 87/204 (42.65%), Query Frame = 1
Query:  910 KLHVQSLKLWWPHDLGT-PA-LYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGK------PETEHFYHLADSLGLMIWHDLMFACALYPD---NENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQM 1488
            +L V S  LWWP+ +   PA +Y ++  V  T  V DY    +G R+V++ ++           F IN KPF+ +G N     +   D     F   L+      + N +R  G         P +E    L D  G+++  +      + P    NE+   H+ + + E+V   + HP++++WS  NE    +    Y  K +
Sbjct:  278 QLQVPSANLWWPYLMHEHPAYMYSLEVKVTTTESVTDYYTLPIGIRTVAVTKSK----------FLINGKPFYFQGVN----KHEDSDIRGKGFDWPLL----VKDFNLLRWLGANSFRTSHYPYSEEVLQLCDRYGIVVIDECPGVGIVLPQSFGNESLRHHL-EVMEELVRRDKNHPAVVMWSVANEPSSALKPAAYYFKTL 462          
BLAST of Mannosidase beta vs. UniProt/SwissProt
Match: sp|Q8K2I4|MANBA_MOUSE (Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 3.995e-125
Identity = 278/844 (32.94%), Postives = 432/844 (51.18%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLAN-QTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKN-GLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQN-IKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP---ERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITREL----QSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQTGAET 2703
            SAL Q+  I  P+  FND+ YRWI+  N+++ +E       S      L   G+D    I  N+  IG T + F   +F I +  V+K  N + ++F S++  A  Q+   +SY+VPP+C P E  G+CH+NFIRK Q SF WDWGPS  + GI   V   + N     + ++  L         W+ E+  + F + +       V   I  +K++    +++ +   +V+    ++  V +++ WWP   G    Y M     L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P     QD   +  ++ L  SVV ANMNT+R+WGGG  E + FY L D LG+M+W D MFA ALYP    FL+ VRKEVT  V  L+ HPSI++WSGNNE EV ++  W++    D +  I  Y  L+ + I+ IV S D    FI SSP+NG+++ +   +S +P S  +GD+HFY Y  D WN  ++P  R+ +E+G+QS P   T E  V S+ D+  +     H QHH+DGN Q++  V   F KL P  T  L   +K   YLTQ+ Q   +    +  L S+  +  +G G T GA++WQLND W AP+W+++++ G WK+ HYF +  F+P        E +     V  + K+    TQ T+    ++  + L     SSI+ +                +F + +S+ +++ +      C+       ++ + S      +  L+ D      AN ++V I Q     ++ + D+++  V+ FV L   S  G FS+NGF +  K  S+ FYPW+  +++
Sbjct:   50 SALHQHGLIQDPYYRFNDLNYRWISLDNWTYSTEFKIPFNLSEWQKVKLIFDGVDTVAEILFNNVTIGKTDNMFTGYSFDITN--VVKDVNSLKLQFRSAVQYAECQSKAHTSYRVPPECPPVEQKGECHVNFIRKAQCSFSWDWGPSFPSQGIWKDVRIEAYN--IAHLDYLTFLPVYDNASQAWNIEIKAS-FDVASSKSVGGQVTVAIPQLKTQQTNDIELQQEQRIVKLLVKIRKDV-AVETWWPRGHGNQTGYNMTILFALDGGLKIEKAAKVYFRTVQLIEEGIKGSPGLSFYFKINGLPIFLKGSNWIPADSF-QDKVTSDRLQLLFQSVVDANMNTLRVWGGGIYEQDEFYALCDELGIMVWQDFMFASALYPTEPGFLASVRKEVTYQVRRLKSHPSIIIWSGNNENEVALSVNWFHVNPRDMKTYIDDYVTLYVKNIRKIVLSEDKSRPFIASSPTNGMKTMEEGWISYDPYSIQYGDIHFYNYADDCWNWKIFPKARLVSEYGYQSWPSFSTLE-KVSSQEDWAYNSRFSLHRQHHEDGNHQMLHQVKMHF-KL-PQGTDPL-RTFKDTIYLTQVMQAQCIKTETEFYLRSRSEIV-DGKGHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFARRFFAPLLPVGFEDEGVFYVYGVSDLHKDH--HTQLTVRLHHWSSPKPLCSLVNSSIVVKAG----------EAVVLFQMPVSELLKRCRGCTRETCVVSFYFSTDKELFSPTNYHFLSSLK-DAKGLLEAN-ITVNISQKG---NVFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMIRKKLSVLFYPWKPTSKS 864          
BLAST of Mannosidase beta vs. UniProt/SwissProt
Match: sp|Q95327|MANBA_CAPHI (Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 1.784e-124
Identity = 275/841 (32.70%), Postives = 432/841 (51.37%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQ-TARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSL-KLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQN-IKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTI-FTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAA---NKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQTGAET 2703
            SALF    I  P+  FN++ YRWIA  N+++  +       S     +L   G+D    + LN   IG T + F   +F I  + ++K+ NII ++F S ++ ANQ + R ++Y VPP+C P   +G+CH+NFIRK Q SFGWDWGPS    GI   V   + N     + +             W+ ++  +  ++ ++  +   +V  I  +  + +  +++ ++G    +  VK+    + + WWPH  G    Y+M     L G +   K   V FR+V L +  + N  G  F F IN  P F+KG+NW+P     QD   +  +  L+ SVV ANMN +R+WGGG  E + FY L D LG+MIW D MFACALYP +E+F+  VR+EVT  V  L+ HPSI+ WSGNNE E  +  GWY+TK       IK Y  L+ + I+TIV   D    FI+SSP+NG ++     +S NP    +GDVHFY Y+ D WN   +P  R  +E+G+QS P   T E  V SE D+  +     H QH  +GN +++  +   F KL PN+   L  ++K   YLTQ+ Q   +    +    S+  +  +G G T GA++WQLND W AP+WS++++ G WK+ HYF +  F+P  +      D  +V+ I     + + + ++     +     SS+    + L +   MK     + ++  + + ++       + C+    L  +  ++S      +  L+     NA       ++  I Q    F   + D+++  V+ FV L   S  G FS+NGF +T K+ ++ FYPW+  +++
Sbjct:   50 SALFNKRIIKDPYYRFNNLDYRWIALDNWTYIKKFKLHSDMSEWNKVNLVFEGIDTVAVVLLNSVPIGKTDNMFRRYSFDI--THMVKAVNIIEVRFQSPVIYANQRSERHTAYWVPPNCPPPVQDGECHVNFIRKMQCSFGWDWGPSFPTQGIWKDVRIEAYN--ICHLNYFMFTPIYDNYMETWNLKIESSFDVVSSKLVSGEAIV-AIPELNIQQRNNIEL-RHGERTVKLFVKIDKAVIVETWWPHGHGNQTGYDMTVTFELDGGLRFEKSAKVYFRTVELVEEPIQNSPGLTFYFKINGLPIFLKGSNWIPADSF-QDRVTSDMLRLLLQSVVDANMNALRVWGGGIYEQDEFYELCDELGIMIWQDFMFACALYPTDEDFMDSVREEVTHQVRRLKSHPSIITWSGNNENEAALMMGWYDTKPGYLHTYIKDYVTLYVKNIRTIVLEGDQTRPFIISSPTNGAKTTAEGWLSPNPYDLNYGDVHFYDYMSDCWNWRTFPKARFVSEYGYQSWPSFSTLE-KVSSEEDWSYESSFALHRQHLINGNSEMLQQIELHF-KL-PNSADQL-RRFKDTLYLTQVMQAQCVKTETEFYRRSRNEIV-DGKGHTMGALYWQLNDIWQAPSWSSLEYGGKWKMLHYFARRFFAP--LLPVGFEDK-DVLFIYGVSDLPSDHQMM---LTVRVHTWSSLELVCSELTNPFVMKAGESVVLYSKPVPELLKGCPGCTRQSCVVSFYLSTDGELLSPINYHFLSSLK-----NAKGLHKANITATISQQGNTF---VFDLKTSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTVFFYPWKPTSKS 864          
BLAST of Mannosidase beta vs. UniProt/SwissProt
Match: sp|Q29444|MANBA_BOVIN (Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 1.733e-123
Identity = 282/843 (33.45%), Postives = 424/843 (50.30%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXX---XXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQ-TARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQT-TGKIKFVKVLTK--TTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSL-KLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQN-IKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAA---NKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQTGAET 2703
            SALF    I  P+  FN++ YRWIA  N+++  +       S+    +L   G+D    + LN   IG T + F   +F I  +  +K+ NII ++F S ++ ANQ + R ++Y VPP+C P   +G+CH+NFIRK Q SFGWDWGPS    GI   V   + N        F  +      T N    S+  V++  ++  E    I  +N       +LQ       +G       VK+    + + WWPH  G    Y M     L G +   K   V FR+V L +  + N  G  F F IN  P F+KG+NW+P     QD   +  +  L+ SVV ANMN +R+WGGG  E + FY L D LG+MIW D MFACALYP +++F+  VR+EVT  V  L+ HPSI+ WSGNNE E  +  GWY+TK    Q  IK Y  L+ + I+TIV   D    FI SSP+NG ++     +S NP    +GDVHFY Y+ D WN   +P  R  +E+G+QS P   T E  V SE D+        H QH  +GN +++  +   F KL PN+T  L  ++K   YLTQ+ Q   +    +    S+  + + G G T GA++WQLND W AP+WS++++ G WK+ HYF +  F+P  +      D   + +         Q  ++T   +    L+  ++  E+     +    +V  ++T  + + ++       + C+    L  +  ++S      +  L+     NA       ++  I Q    F   + D+++  V+ FV L   S  G FS+NGF +T K+ ++ FYPW+  +++
Sbjct:   50 SALFNKRIIKDPYYRFNNLDYRWIALDNWTYIKKFKLHSDMSTWSKVNLVFEGIDTVAVVLLNSVPIGKTDNMFRRYSFDI--THTVKAVNIIEVRFQSPVVYANQRSERHTAYWVPPNCPPPVQDGECHVNFIRKMQCSFGWDWGPSFPTQGIWKDVRIEAYNVCHLNYFMFTPIYDNYMKTWNLKIESSFDVVSSKLVSGEAIVAIPELNIQQTNNIELQ-------HGERTVELFVKIDKAIIVETWWPHGHGNQTGYNMSVIFELDGGLRFEKSAKVYFRTVELVEEPIQNSPGLSFYFKINGLPIFLKGSNWIPADSF-QDRVTSAMLRLLLQSVVDANMNALRVWGGGVYEQDEFYELCDELGIMIWQDFMFACALYPTDKDFMDSVREEVTHQVRRLKSHPSIITWSGNNENEAALMMGWYDTKPGYLQTYIKDYVTLYVKNIRTIVLEGDQTRPFITSSPTNGAKTIAEGWLSPNPYDLNYGDVHFYDYVSDCWNWRTFPKARFVSEYGYQSWPSFSTLE-KVSSEEDWSYRSSFALHRQHLINGNNEMLHQIELHF-KL-PNSTDQL-RRFKDTLYLTQVMQAQCVKTETEFYRRSRSEIVN-GKGHTMGALYWQLNDIWQAPSWSSLEYGGKWKMLHYFARHFFAP--LLPVGFEDKDMLFIYGASHLHSDQQMMLTVRVHTWSSLE--LVCSESTNPFVIKAGESV-LLYTKPVPELLKGCPGCTRQSCVVSFYLSTDGELLSPINYHFLSSLK-----NAKGLHKANITATISQQGDTF---VFDLKTSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTVFFYPWKPTSKS 864          
BLAST of Mannosidase beta vs. UniProt/SwissProt
Match: sp|O00462|MANBA_HUMAN (Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3)

HSP 1 Score: 401.749 bits (1031), Expect = 4.320e-123
Identity = 273/837 (32.62%), Postives = 423/837 (50.54%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXX---XXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNG-LVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP-ERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCN-VQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAA---NKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQ 2688
            SALFQ   I   +  FND+ YRW++  N+++  E       S     +L + G+D    I  N+  IG T + F   +F I +  V++  N I ++F S+++ A Q ++  + YQVPPDC P    G+CH+NF+RK Q SF WDWGPS    GI   V   + N     + +         +   W+ E+  + F +++       V+  I  ++++    +++     +VE   ++  ++ +++ WWPH  G    Y M     L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P     QD   +  +  L+ SVV ANMNT+R+WGGG  E + FY L D LG+M+W D MFACALYP ++ FL  V  EV   +  L+ HPSI++WSGNNE E  +   WY+    D P  IK Y  L+ + I+ +V + D    FI SSP+NG E+     VS+NP S  FGDVHFY Y+ D WN  ++P  R  +E+G+QS P   T E  V S  D+  +     H QHH+ GNKQ++      F KL P +T  L   +K   YLTQ+ Q   +    +    S+  +  +  G T GA++WQLND W AP+W+++++ G WK+ HYF +  F+P   +  EN     N   I     + + Y++   + ++     SS+    + + +   MK      ++   +S+ +++        C+    L  +  ++S           L  P  A      +++  I Q      I + D+++  V+ FV L   S  G FS+NGF +T K+ +I FYPW+
Sbjct:   50 SALFQQGLIQDSYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETDNMFNRYSFDITN--VVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAYN--ICHLNYFTFSPIYDKSAQEWNLEIE-STFDVVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNI-TVETWWPHGHGNQTGYNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPADSF-QDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACALYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKDYVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDCWNWKVFPKARFASEYGYQSWPSFSTLE-KVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAGLHF-KL-PQSTDPL-RTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQ-GHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFEN----ENTFYIYGVSDLHSDYSM---TLSVRVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSADHELLSPTNYHF-----LSSPKEAVGLCKAQITAIISQQG---DIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWE 859          
BLAST of Mannosidase beta vs. UniProt/SwissProt
Match: sp|Q4FZV0|MANBA_RAT (Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 1.534e-116
Identity = 272/858 (31.70%), Postives = 425/858 (49.53%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXX---XXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLAN-QTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQ-SLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQN-IKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDS----VNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQTGAETFFNCSQLNIDVFSLNEL 2754
            SAL Q+  I  P+  FND+ YRWI+  N+++ +E       S      L   G+D    I  N+  IG T + F   +F + +  V+K  N + ++F S++  A  Q+   + Y+VPP+C P E  G+CH+NFIRK Q SF WDWGPS  + GI   V   + N     +  +  L         W+ E+  + F +++       V   I  +K++    +++ ++G    +  VK+    +++ WWPH  G    Y       L G +   K   V FR+V L +  +    G  F F IN  P F+KG+NW+P     QD   +  ++ L+ S V ANMNT+R+WGGG  E + FY L D LG+M+W D MFA ALYP    FL  VRKEVT  V  L+ HPS+++WSGNNE EV +   W++    D    I  Y  L+ + I+ IV S D    FI SSP+NGV++     +SK+P S  +GD+HFY Y  D W+  ++P  R+ +E+G+QS P   T +  V  + D+        H QHH +GN +++  V   F      + +     +K   YLTQ+ Q   +    +  L S+  + + G G T GA++WQLND W AP+W+++++ G WK+ HYF +  F+P  +      D     V  +  L +++  T+ T+    ++  + L + +     I             +F + +SK +++ K      C+    L  +  + S      +  L+ D      AN ++V I Q   D  +  L   +  ++ FV L   S  G FS+NGF +  K  S+ FYPW+  +++     Q    V SL +L
Sbjct:   50 SALQQHGLIQDPYYRFNDLNYRWISLDNWTYSTEFKIPFNRSEWQKVKLIFDGVDTVAEILFNNVTIGKTDNMFTRYSFDVTN--VVKDVNSLKLRFQSAVQYAECQSKAHTQYRVPPECPPVEQKGECHVNFIRKEQCSFSWDWGPSFPSQGIWKDVRIEAYN--IAHLDHLTFLPLYDNTSQAWTIEIEAS-FDVVSTKPVGGQVTIAIPELKTQQANHIEL-QHGQRIVKLLVKIRKDVTVETWWPHGHGNQTGYNTTILFALDGGLKIEKAAKVYFRTVQLIEEPITGSPGLSFYFKINGLPIFLKGSNWIPADSF-QDKVTSELLQLLLQSAVDANMNTLRVWGGGIYEQDEFYALCDELGIMVWQDFMFASALYPTEPGFLESVRKEVTYQVRRLKSHPSVIIWSGNNENEVALRVNWFHVNPRDLGTYINDYVTLYVKTIREIVLSEDRSRPFIASSPTNGVKTMTEGWISKDPYSTQYGDMHFYDYFSDCWDWKVFPKARLVSEYGYQSWPSFSTLQ-KVSRQEDWSYSSRFSLHRQHHGNGNNEMLHQVQLHFQLPQRRDPV---RAFKDTIYLTQVMQAQCIKTETEFYLRSRSEIVN-GEGHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFAQRFFAP--LLPVGFEDEGVFYVYGVSDLHKDY-PTKLTVRLHRWSSQKPLCTFVSLSAVI------KAGEAMVLFQMPVSKLLKRCKECTRDTCVVSFYLSTDNELFSPTNYHFLSSLK-DAKGMVKAN-ITVSISQKG-DLFVFDLKSSTSAITPFVWLDVGSIPGRFSDNGFLMIKKELSVLFYPWKPTSKSEL---QQAFSVTSLTDL 880          
BLAST of Mannosidase beta vs. TrEMBL
Match: A0A1B6E8G1 (Uncharacterized protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.22189 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 2.745e-130
Identity = 263/832 (31.61%), Postives = 425/832 (51.08%), Query Frame = 1
Query:  259 FNDIKYRWIAHQNFSFQXXXXXXXXXXXXXX---XXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLV---------EFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLAN---HLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFN--ITRELQSSIIYEENILFDTLDMK-CNVQTIFTVNLSKFVQK-FKCSN----IRQCLFEVILKRNESIVSVDTLMLVYPLQLDIP-PNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFY 2679
             ND  YRW++H N+++           +         GLD   +++ N+  +GTT + F+   F +    + KS N + + F S +  A + A    Y+VPP C  KE+NG+CH+N++RK QASFGWDWGP+  +VGI   V     N   G+     +   T ++  +W  +V    ++ L + +  + ++ ++ +   KL+   +++++G V         ++ F+  +    ++ WWP+++G   LY +K       +  D  +  +GFR++ L Q  +       G  F F +N  PFF KG+N++P + L +  +N   +  ++ S   ANMN IR+WGGG  E+++FY+LAD+LGL++W D+ FAC+LYP +E FLS+V  EV + V  LQ HPS+ +W+GNNE E  +   WY + +        Y  L+ + IK  V   D    F++SSPSNG E+E   GV++NP S ++GDVHFY Y  +LW     P TR  +E+G  S+   +T       E +  +D  +++  QHH  G  QL+  +      L P   +S G     F Y +QINQ + +    +     +  L  +G G+T GA++WQLND W AP+WS+ID+ G WK+ HYF K  F P  I+         + LI  E       T+I   ++   T      II        T+DMK  NV  I   N++  + K  KC       ++C     +K++   +  D  +L  PL   +   N++   V V+  +D P+ S+  + + ++ ++ FV L      G FS NGF + SK  +++FY
Sbjct:   75 LNDQNYRWVSHDNWTYTKTFDVHDDLLAKKNIFLVFHGLDTVSSVYFNNHSLGTTNNMFVRYRFDV-KKLLQKSGNTLSVTFTSPITAARRYAEAGDYEVPPTCVNKEYNGECHVNYLRKMQASFGWDWGPAFPSVGIWKPVTLEGYNNAFGR----SISVTTASSGRNW--KVSATFYVELPKREDNVTIMLQLMDAGEKLK---EITRHGAVMRPDNNLEGKYTFNFIISKDKVETWWPNNMGKQKLYYLKCIFRKPDEDTDSGV-LMGFRTIELVQENVVEGEPDKGLTFYFKVNNVPFFAKGSNYIPASVLPELSSNQDTVTRILESAKEANMNMIRVWGGGLYESDYFYYLADTLGLLVWQDMTFACSLYPADEEFLSNVEVEVRQQVRRLQSHPSLAVWTGNNENEGALKDNWYGSDKNFSLFKNDYIRLYVDTIKKEVIREDKSRPFVLSSPSNGKETEDEGGVAQNPSSALYGDVHFYNYYANLWTTKPLPSTRFASEYGIMSMASMETLR-TAAHEWELTLDSQVIQSRQHHLGGYSQLLIEIA---RNLPP--IVSSG--LNTFVYFSQINQAMGIKTQTENYRRLRNSLQEDGRGMTMGALYWQLNDVWQAPSWSSIDFNGKWKMLHYFAKHFFHPVLISPSVTSGRFALNLISDELIDVENVTVIVSVYHWCCTTPQHKKII--------TVDMKAANVTQILQRNITSLLGKGRKCGKKWNAKKRCFLYFQVKKDGRKIGPDNFLLPSPLHSVVGMKNSSVEVVQVQKNEDKPNGSVVDVTISTNGIAAFVWLEAAGVPGHFSENGFVLVSKRKTVSFY 879          
BLAST of Mannosidase beta vs. TrEMBL
Match: A0A3B3BQC3 (Mannosidase, beta A, lysosomal OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 1.414e-128
Identity = 275/847 (32.47%), Postives = 440/847 (51.95%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXXX---GLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYN-TKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP-ERITIENIRDSVNVILI-------LKEEFVRTQYT------IITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESI--VSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQ 2688
            SAL +   I  P+  FND+ YRWIA +N+++ +   +     +         G+D   +I LN   +G T + F   +F I    + +++N++ ++F+S ++ A++ +R   SY+VPP+C P    G+CH+NFIRK Q+SF WDWGPS   VG+   V   + +  T +++ +  L     + S W  +V + V   +  T  Q+       +++   Q    +S      F FH++ + Q ++LWWP   G    Y++   V   G ++  +   V FR+V L Q  +    G  F F IN KP F+KG+NW+P  +  QD      ++ L+ S V ANMN +R+WGGG  E + FY + D +G+M+W D MFACA+YP   +F+  VR+EV + V  L+ HPSI++WSGNNE E  +A  W+N +    P  +K Y  L+ + I+ IV   DP   F++SSP+NGVESE+   V+ +P    +GDVHFY YL D W+ + +P TR  +E+GFQS P   T + +   E D+        H QHH++GN+Q++      F    PN+T  L  ++    Y+TQ+ Q   +    +   SS+  +  EG G T GA++WQLND W AP+WS++++ G WK+ HYF +  F+P   +++E+  D   VI +       LK   V T ++      + +R+ ++     SS +         L   C                 +C+ +  CL    L+ +      S +   L  P + +    A    ++VK++QD   FS+ L   QS  V+ FV L   +  G FS+NGF + S++ ++ F  W+
Sbjct:   51 SALLREGLIQDPYFRFNDVSYRWIALENWTYSTTFAASAQLRAKQEVELIFDGVDTVASITLNGNLVGKTDNMFRRYDFSIRE-LLKEADNLLQVQFLSPVVYASERSRAHQSYRVPPECPPDVQKGECHVNFIRKEQSSFSWDWGPSFPTVGLWRSVRLEAFD--TLQLQQLSYLPLYNGSGSQWELQVELLV-DAVRTTGVQVAFSMSELDLEQVFQTQF-LSGRTKKTFTFHIQKNSQ-VRLWWPSGHGDQPFYKLSVRVFGDGLLMLNREVKVFFRTVELIQDPIPGSPGLSFYFKINGKPIFLKGSNWIP-AHAFQDQVTPAVLKNLLQSAVDANMNALRVWGGGVYEQDLFYDMCDEMGIMVWQDFMFACAMYPTEADFIQTVREEVVQQVGRLKSHPSIIIWSGNNENEAALATNWFNISTPQRPVYVKDYVTLYVDNIQKIVLKEDPSRPFLVSSPTNGVESEREGWVAADPYDPHYGDVHFYSYLSDCWDWTTFPRTRFASEYGFQSWPSFSTLQPVSVKE-DWTFGSNFSSHRQHHENGNQQMLQQAALHFH--LPNSTDPL-RRFTDTLYITQVMQAQCVKAQTEFYRSSRSQIV-EGKGHTMGALYWQLNDIWPAPSWSSLEFGGKWKMLHYFARSFFAPLLPVSVED--DGALVIYVVSDLSADLKLRVVVTVHSWANLDPVCSRTSDLQVVPGSSAVALYKQPVAALLAGCG----------------RCTRL-TCLLTFHLEDSAGSWRGSDNYHFLSSPREAEGLQRA---NITVKVQQDGAAFSVTL---QSSSVAAFVWLDAGNIPGRFSSNGFLMLSRNKTVGFEAWR 860          
BLAST of Mannosidase beta vs. TrEMBL
Match: A0A3B3T8H3 (Mannosidase, beta A, lysosomal OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 5.831e-128
Identity = 272/848 (32.08%), Postives = 432/848 (50.94%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXXX---GLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLML-ANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVF--ILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMD-PQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLI--DAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSI-IYEENILFDTLDMKCNVQT------------IFTVNLSKFVQKFKCSNIRQCLFEVILKR-NESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPW 2685
            SAL +   I  P+   ND+ YRWI+  N+++ +       +           G+D   TI LND  +GTT + F   +F + S  + + +N++V+  +S++   A ++   ++Y+VPP C P    G+CH+NFIRK Q+SF WDWGPS    GI   V   S +    ++ ++       ++ S WS EV + VF  ++  E   ++ + +  T    +       S N    F  HV      + LWWP   G    Y+M   ++L G ++   +  V FR+V L Q  +    G  F F IN +P F+KG+NW+P  +  QD      ++ L+ S V ANMNT+R+WGGG  E + FY + D LGLMIW D MFACALYP   +F+  VR+EVT  +  L+ HPSI++WSGNNE E  IA  W+   Q + PQ +K Y  L+ + I++IV   D    F+ SSP+NG ESEK   V++NP    +GD H+Y YL D W+   +P TR+ +E+GFQS P   T   +   E D+    +   H QHH  GN +++   A++F      P +   L ++Y+   YLTQ+ Q   +    +    S+  +  EG G T GA++WQLND W  P+W++I++ G WK+ HYF K+ F+P  +     +D  N+++          Y +     N  + L + I +Y+    + +L+  C V +            ++   L + +       ++ CL    L+     +  ++ L+L  P +           ++ K++QD   F++    +Q+  ++ F+ L      G F +NGF + +KS S+ FYPW
Sbjct:   59 SALLRQGLIQDPYYRLNDLAYRWISLDNWTYTTTFSVPRGTRQKQRVSLVFDGVDTVSTISLNDVIVGTTDNMFRRYDFDV-SMTLRQGDNVLVVDLVSAVGYSARRSQAHTTYKVPPACPPPVQKGECHVNFIRKAQSSFSWDWGPSFPTQGIWRDVRLESYD--ILRLLYLSAAPAFDSSSSLWSVEVEL-VFDTVMAVEGYVKLALADLATQQTFQASLPPGQSNN---TFILHVN-KSSPVDLWWPAGYGKQNRYQMNVQMMLDGGLVLDTVTQVYFRTVELIQKPIPGSPGMSFYFQINGRPVFLKGSNWIP-AHSFQDQVTPETLKNLLQSAVDANMNTLRVWGGGIYEQDQFYSICDELGLMIWQDFMFACALYPTESDFMETVREEVTHQLRRLKSHPSIIVWSGNNENEAAIATNWFGIPQSEQPQYVKDYTSLYVDNIRSIVLRVDRTRPFLTSSPTNGAESEKEGWVAQNPYDTHYGDTHYYNYLADCWDWRNFPRTRLASEYGFQSWPSLSTLMKVSVPE-DWRYSSLFSSHRQHHLAGNMEMLLQAALHFHL----PQSPHPL-QEYRDTLYLTQVMQAQCVKAQTEFYRRSRSEII-EGQGHTMGALYWQLNDIWQGPSWASIEFGGKWKMLHYFAKDFFAP--VLPVGFQDQGNLLI----------YAV--SDLNNNKTLSAVITVYQ----WSSLEPVCTVTSGAAPVSGGTALPLYKTPLKELLANCANCTVQTCLLTFHLEEAGRQLGPMNHLLLSSPKEAQ---GLQKPDITTKVQQDGNTFTVT---IQTSAIAPFLWLDVGDIPGRFDSNGFLMVTKSRSVQFYPW 866          
BLAST of Mannosidase beta vs. TrEMBL
Match: A0A1S3HNS4 (beta-mannosidase isoform X1 OS=Lingula unguis OX=7574 GN=LOC106156122 PE=4 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 2.160e-127
Identity = 281/877 (32.04%), Postives = 436/877 (49.71%), Query Frame = 1
Query:  199 PVDSFSALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXXX---GLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQV---LDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQH----LFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSS--IIYEENILFDTLD-----------MKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPS-WGTFSNNGFHITSKSTSINFYPWQTGAETFFNCSQLNIDVFSLNELH 2757
            P   ++ L +N  +  P+  FND +YRW+A  +++F        P    S       GLD   ++++N++ +G + + F+   F I  +     N + ++        ++  ++   Y+VPP+C P+  +G+CH+NFIRK Q SF WDWGP+   +GI   +    +N     I+ V V TK   + S W   V  N F  L  +     V+         +QK       G+      +K+    +K WWP+  G   LY ++  VL T Q    L  K   VGFR+V L Q  + N  G  F F IN KP F+KG+NW+P     Q+     ++  L+ S    +MN +R+WGGG  E+E FY LAD LG++IW D MFACALYP +E FL  ++ EVT  +  LQ HPSI +WSGNNE E  IA  WYN       + KRY+     L+ + I  I    D    FI SSPSNG+E+++   V+K PQ   FGD+H Y Y    W  + Y I R  +E+GF++ P  +  E +  +E D+  +     H QHH DGNKQ++  + +      P+N   + +Q+K + YLTQINQ + +    +    SQ  + + G+G+T GA++WQL D W AP+W++I++ G WK+ HY+ +  FSP  ++       + V+L++              + +  R LQ S   +Y +   +D L             K     IF  N++  ++  KCS+++ C+F   L  N+    V   +L  PL+  +        +S   ++D+  + I L       V+ FV L      G FS+N F +   +T+I FY W+T   T  N  +  + V SL +++
Sbjct:   47 PGSIYTDLIKNGTLKDPYYRFNDEEYRWVAKDDWTFTRTFTVTSPMLKASSIKLVCDGLDTVASVYVNNQKVGESINMFVKYKFDIKHTLKAGPNEVKLVYQSPVKYASDMASKHWEYKVPPECPPEVQHGECHVNFIRKEQCSFSWDWGPAFPTIGIWKNISVEISNSVV--IEAVMVETKPVGDYSSWMLSV--NTFFDLYGSGKYPGVLEIRVPEVGLVQKLSTTVGGGVKNITATLKIDKGKVKTWWPNGHGEQPLYYVE--VLFTSQTTSELTAKRVRVGFRTVELIQDKIPNASGLSFYFKINGKPIFMKGSNWIPADSF-QERLTPKYLRSLLTSAQAVHMNMLRVWGGGIYESETFYSLADELGILIWQDFMFACALYPVDEYFLDSIQTEVTHQILRLQAHPSIAVWSGNNENEGAIANNWYNIT-----DFKRYKADYVTLYIDNIMNITQKLDRTRPFIPSSPSNGIETQQEGWVAKQPQDVHFGDIHHYDYGTKSWEWNHYQIPRFCSEYGFEAWPSFENLEKVSVTE-DWNYNSEFCDHRQHHGDGNKQMVTQLGYYLN--LPSNPDPV-QQFKDYIYLTQINQAMSIKTETELFRRSQSTVVN-GVGMTMGALYWQLQDIWQAPSWASIEYGGKWKMLHYYARHFFSPVLVSPYIDGAVLKVVLVVD-------------TLSSGRALQKSGNTLYIQCYSWDNLKPLYTWTQKVDAPKVAASQIFQANVTAMLKTAKCSSLQHCVFFFFL--NDVHTEVRNWVLPVPLKTAVGMKKPNVTISTVTQKDSQTYQIKLTTAA---VAPFVWLEANGILGRFSDNSFLMVQSTTNIVFYAWET---TDLNSLKKALTVRSLMDVY 885          
BLAST of Mannosidase beta vs. TrEMBL
Match: A0A3P9HDD6 (Mannosidase, beta A, lysosomal OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 5.498e-127
Identity = 268/849 (31.57%), Postives = 440/849 (51.83%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXXX---GLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMK-SKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYN-TKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP---------ERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQ------SSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIV--SVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQ 2688
            SAL +   I  P+  FND+ YRWIA +N+++ +   +     S         G+D   +I LN   +G T + F   +F +    + +++N++ ++F+S ++ A++ ++   SY+VPP C P    G+CH+NFIRK Q+SF WDWGPS   +G+   V     +    +++ +  L     + S W  +V +   ++ A   T + V   I+ +   ++ +   +S      F F+++     +KLWWP   G    + +   V + G ++  +   V FR+V L Q  +    G  F F IN KP F+KG+NW+P  +  QD      ++ L+ S V ANMN +R+WGGG  E + FY + D +G+M+W D MFACA+YP   +F+  VR+E  + V  L+ HPSI++WSGNNE E  +A  W+N +    P  +K Y  L+ + I+ IV   DP   F++SSP+NGVESE+   V+ +P    +GDVHFY YL D W+ + +P TR  +E+GFQS P   T + +   E D+  D     H QHHQ GN+Q+++     F    PN+T  LG ++    Y+TQ+ Q   +    +   SS+  +   G G T GA++WQLND W AP+WS++++ G WK+ HYF +  F+P           +TI  + D ++  L L+       +  +    + T +L+      ++++Y + +   TL   C                 +C+ +  CL    L+ +  I   S +   L  P + +    A    ++VK++QD   F++ L   QS  ++ FV L   +  G F+ NGF + S++ ++ F PW+
Sbjct:   51 SALRREGLIQDPYFRFNDVSYRWIALENWTYSTTFAASAQLRSRREVELIFDGVDTVASITLNGNLVGKTDNMFRRYDFSVRE-LLKEADNLLQVQFLSPVVYASERSKAHQSYRVPPQCPPDVQKGECHVNFIRKEQSSFSWDWGPSFPTMGLWRGVRLEGYDAL--QLQQLSYLPLYNGSGSQWGLQVEL---LIDAVRTTGVQVTFSISELGLEQVFQTQFLSGRTKKTFTFNIE-KSSRVKLWWPSGHGDQPFHLLSVRVFVDGSLMLDREVKVYFRTVELIQEPVPGSPGLSFYFQINGKPIFLKGSNWIP-AHAFQDQVTPAVLKNLLQSAVDANMNALRVWGGGVYEQDLFYDMCDDMGIMVWQDFMFACAMYPTEADFIQTVREEAVQQVGRLKSHPSIIIWSGNNENEAALATNWFNISASQRPVYVKDYVTLYVDNIRKIVQKEDPSRPFLVSSPTNGVESEQEGWVAADPYDPHYGDVHFYSYLSDCWDWTTFPRTRFASEYGFQSWPSFSTLQPVSVRE-DWSFDSRFTSHRQHHQSGNQQMLEQAALHFH--LPNSTDLLG-KFTQTLYITQVMQAQCVKAQTEFYRSSRSQVVG-GKGHTMGALYWQLNDIWPAPSWSSLEFGGKWKMLHYFARSFFAPLLPVSVEDDGALTIYAVSD-LSADLKLRAVVTVHSWAYLDPVCSRTSDLRVVPGGSAAVLYRQPVA--TLLAGCG----------------RCTRL-TCLLTFHLEDSAGIQQGSNNYHFLSSPREAEGLQRA---NITVKVQQDGGGFTVTL---QSSSIAAFVWLDVGNIPGRFTANGFLMLSRNKTVGFEPWR 860          
BLAST of Mannosidase beta vs. Ensembl Cavefish
Match: manba (mannosidase beta [Source:NCBI gene;Acc:103036309])

HSP 1 Score: 392.889 bits (1008), Expect = 1.531e-120
Identity = 240/657 (36.53%), Postives = 360/657 (54.79%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXX---XGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLA-NQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLT--KTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWY-NTKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLY---PNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP 2154
            +AL Q+  I  P+  FND+ YRWI+  N+++ +         S   S     G+D   TI LN   IG T + F   +F +  + +LK  NI+ +  +S +  A ++    ++Y VPP+C P    G+CH+NFIRK Q+SF WDWGPS   +GI   V   S +     ++ + V+T  K  A  S W+ EV +   ++ A     +  V ++ + ++K Q  L   ++ L  +   +  +V S+ LWWP   G   L++M   + +         + + FR+V L Q  + +  G  F F IN +P F+KG+NW+P  +  QD   A  +  L+ S   ANMN +R+WGGG  E ++FY L D LG+M+W D MFACALYP  ++FL  V++EV + V  L+ HPS+++WSGNNE E  IA  WY       P  +K Y HL+ E I+ IV   D    F++SSP+NGVESEK   V+ +P    +GDVHFY YL D W+   +P TR  +E+GFQS P   T    V   +D++ +     H QHH+ GN +++     L  KL+   PN T ++ ++YK   Y+TQ+ Q   +    +    SQ  +  +  G T GA++WQLND W AP+WS+I++ G WK+ HY+    FSP
Sbjct:   60 TALQQHKLIQDPYYRFNDLAYRWISLDNWTYSTSFSVSDSVRSSKRSFLVFEGVDTVATISLNGVIIGKTDNMFRRYDFEV--AVLLKDVNILEVWLMSPVTYALDRRQAHTAYSVPPECPPAVQKGECHVNFIRKAQSSFSWDWGPSFPTLGIWKGVRLESFD----TLRLLNVITSPKYDAGLSCWTVEVDVYFDVVTASKGIVLLSVPQLKS-QAKFQLSLVPGQSNL-SYVLQINQNV-SVDLWWPFGHGKQPLFDMIINITMDNGEKFITEKLIAFRTVELVQEPIPDSPGLSFYFRINGQPVFLKGSNWIP-AHAFQDQVTADRLTQLLVSAQKANMNVLRVWGGGIYEQDNFYVLCDQLGIMVWQDFMFACALYPTEKDFLQSVQEEVIQQVRRLKSHPSVVIWSGNNENEAAIAANWYFIPPAKKPLYVKDYVHLYVENIREIVLQEDTTRPFLVSSPTNGVESEKEGWVAHDPYDPHYGDVHFYNYLADCWDWRTFPRTRFASEYGFQSWPSFSTLS-KVSEPTDWDFNSSFSSHRQHHEFGNMEML-----LQAKLHYILPNKTDTV-QRYKDSIYITQVMQAQCVKTQTEFYRRSQSDIV-DSKGHTMGALYWQLNDIWQAPSWSSIEFGGKWKMLHYWAVNFFSP 698          
BLAST of Mannosidase beta vs. Ensembl Cavefish
Match: manba (mannosidase beta [Source:NCBI gene;Acc:103036309])

HSP 1 Score: 303.523 bits (776), Expect = 2.774e-88
Identity = 211/656 (32.16%), Postives = 326/656 (49.70%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXX---XGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLA-NQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLT--KTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLY---PNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSP 2154
            +AL Q+  I  P+  FND+ YRWI+  N+++ +         S   S     G+D   TI LN   IG T + F   +F +  + +LK  NI+ +  +S +  A ++    ++Y VPP+C P    G+CH+NFIRK Q+SF WDWGPS   +GI   V   S +     ++ + V+T  K  A  S W+ EV +   ++ A     +  V ++ + ++K Q  L   ++ L  +   +  +V S+ LWWP   G   L++M   + +         + + FR+V L Q  + +  G  F F IN +P F+KG+NW+P  +  QD   A  +  L+ S   ANMN +R+WGGG  E ++FY L D LG+M+W D MFACALYP  ++FL  V++EV +  +  +     L+ S  N +E    +GW                           + DPY                      +P    +GDVHFY YL D W+   +P TR  +E+GFQS P   T    V   +D++ +     H QHH+ GN +++     L  KL+   PN T ++ ++YK   Y+TQ+ Q   +    +    SQ  +  +  G T GA++WQLND W AP+WS+I++ G WK+ HY+    FSP
Sbjct:   60 TALQQHKLIQDPYYRFNDLAYRWISLDNWTYSTSFSVSDSVRSSKRSFLVFEGVDTVATISLNGVIIGKTDNMFRRYDFEV--AVLLKDVNILEVWLMSPVTYALDRRQAHTAYSVPPECPPAVQKGECHVNFIRKAQSSFSWDWGPSFPTLGIWKGVRLESFD----TLRLLNVITSPKYDAGLSCWTVEVDVYFDVVTASKGIVLLSVPQLKS-QAKFQLSLVPGQSNL-SYVLQINQNV-SVDLWWPFGHGKQPLFDMIINITMDNGEKFITEKLIAFRTVELVQEPIPDSPGLSFYFRINGQPVFLKGSNWIP-AHAFQDQVTADRLTQLLVSAQKANMNVLRVWGGGIYEQDNFYVLCDQLGIMVWQDFMFACALYPTEKDFLQSVQEEVIQQEDTTR---PFLVSSPTNGVESE-KEGW--------------------------VAHDPY----------------------DPH---YGDVHFYNYLADCWDWRTFPRTRFASEYGFQSWPSFSTLS-KVSEPTDWDFNSSFSSHRQHHEFGNMEML-----LQAKLHYILPNKTDTV-QRYKDSIYITQVMQAQCVKTQTEFYRRSQSDIV-DSKGHTMGALYWQLNDIWQAPSWSSIEFGGKWKMLHYWAVNFFSP 642          
BLAST of Mannosidase beta vs. Ensembl Sea Lamprey
Match: manba (mannosidase, beta A, lysosomal [Source:ZFIN;Acc:ZDB-GENE-040426-721])

HSP 1 Score: 345.51 bits (885), Expect = 3.803e-104
Identity = 255/837 (30.47%), Postives = 413/837 (49.34%), Query Frame = 1
Query:  247 PWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXX---XGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLK----SNNIIVIKFISSLMLANQTARQ-SSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANC--SHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKN-GLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVP----RTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEV--TEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNI-KRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFS---YLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITR-ELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPS-WGTFSNNGFHITSKSTSINFYPWQ 2688
            P+  FND  YRWI+ Q++++Q       P  ++  +V    G+D   T+ LN   +G T + FI+  F++  S +LK    + N++ + F S+   A+  A +  ++ VPP C P E +G+CH+N+IRK Q SFGWDWGP+ A  GI   V   +      ++  + ++    A+     W+ E+  +V  LL   K +  V   +  +K+     + +S     V   F +     +LK+WWP   G  + Y     +LL G V+      V FR+V L Q  +A+  G  F F IN +P F+KG+NW+P     T +T     A  +E    S   ANMN +R+WGGG  ET+ FY   D LG+M+W D MFACALYP + +FLS V  EV   E    L+  PS+++WS NNE E  +A  W++    D     K Y  L+   ++  V   D    F+ SSP+NG ESE    V+++P    +GD H+Y Y  D W+ S YP  R  +E+GFQS P   T    V  +SD+  +   M+H QHH  GN+Q++  +     + +P    + G+  + F    YL+Q+ Q   + +  +    S+  + S G G T GA++WQLND W   +WS++++ G WK+ H+F ++ FSP  + I  +     VI  + ++       +   ++  +      S++   + +     ++ + + I  +      +   C+  R  +   +   N + V     + +  L+     +A   K  V      P  S  ++ +++  V+ FV L   +  G FS+NG  +T  + +I FYPWQ
Sbjct:   13 PYYRFNDDVYRWISRQDWTYQRNFTVPIPLQNHQKAVLVFEGVDTVATVSLNGVVLGRTDNMFITYEFVV--SGLLKEGEGATNLLTVAFESAPRYASGRADEHPAWPVPPACPPPEQHGECHVNYIRKEQCSFGWDWGPAFATQGIWRSVRLEA--YYLARLLDLAIIPSPLADGPWGRWTLELEAHV-DLLGNQKVEAAVSVSVLELKTSFSYNVSLSPGTSPVHVSFPLA-QGTNLKMWWPRGDGNQSGYHTTAQILLDGGVILAADTMVYFRTVELVQEPVADSPGLSFYFRINGRPVFLKGSNWIPADSFHTRVTPG-RAARSVE----SAADANMNALRVWGGGVYETDAFYETCDELGIMVWQDFMFACALYPTDADFLSSVNTEVLQQEQTRRLKRFPSVVVWSANNENEAALATNWFHIPAGDYARFHKEYVQLYVGTVRAAVMQEDATRPFLASSPTNGAESESEGWVARDPYDTHYGDTHYYEYGADCWDWSHYPRARFASEYGFQSWPSFSTLA-QVSEKSDWSFNSSFMQHRQHHGQGNEQILQQI----ARHFP--LPATGDPLRAFQLTLYLSQVMQAQCVKSETEFYRRSRSEVIS-GEGHTMGALYWQLNDIWQGASWSSLEYGGKWKMLHHFARDFFSPV-LPIGFLDGGELVIYAVNDQLFGLHLAVRVEAYAWSSLRPVCSLVGASSWVAAGSAVRKHREPIKML----LARCTGCTRQRCVVTFQLQAENGTQVGPRNHVFLASLKDAQGLHARPVKAQVAGVSGMPG-SPVVVTLEAVAVAPFVWLDVGAIAGRFSDNGLLLTEGTRNITFYPWQ 824          
BLAST of Mannosidase beta vs. Ensembl Medaka
Match: manba (mannosidase beta [Source:NCBI gene;Acc:101166673])

HSP 1 Score: 410.994 bits (1055), Expect = 1.745e-127
Identity = 265/843 (31.44%), Postives = 433/843 (51.36%), Query Frame = 1
Query:  214 SALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXXX---GLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTAR-QSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVS-KNGLVEFRFHVKLHVQS-LKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYN-TKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSI---IYEENILFDTLDMKCNVQTIFTVNLSKFVQKF-----KCSNIRQCLFEVILKRNESIV--SVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSW-GTFSNNGFHITSKSTSINFYPWQ 2688
            SAL +   I  P+  FND+ YRWIA +N+++ +   +     S         G+D   +I LN   +G T + F   +F +    + +++N++ ++F+S ++ A++ ++   SY+VPP C P    G+CH+NFIRK Q+SF WDWGPS   +G+   V     +    +++ +  L     + S W  +V +   ++ A   T + V   I+ +   L++        G  +  F   +   S +KLWWP   G    + +   V + G ++  +   V FR+V L Q  +    G  F F IN KP F+KG+NW+P  +  QD      ++ L+ S V ANMN +R+WGGG  E + FY + D +G+M+W D MFACA+YP   +F+  VR+E  + V  L+ HPSI++WSGNNE E  +A  W+N +    P  +K Y  L+ + I+ IV   DP   F++SSP+NGVESE+   V+ +P +  +GDVHFY YL D W+ + +P TR  +E+GFQS P   T + +   E D+  D     H QHHQ GN+Q+++     F    PN T  L  ++    Y+TQ+ Q   +    +   SS+  +   G G T GA++WQLND W AP+WS++++ G WK+ HYF +  F+P  +   ++ D   +I+          Y +   S ++      ++    Y + +   T D++        V   + V        +C+ +  CL    L+ +  I   S +   L  P + +    A    ++VK++QD    ++ L   QS  ++ FV L   +  G F+ NGF + S++ ++ F PW+
Sbjct:   51 SALRREGLIQDPYFRFNDVSYRWIALENWTYSTTFAASAHLRSRQEVELIFDGVDTVASITLNGNLVGKTDNMFRRYDFSVRE-LLKEADNLLQVQFLSPVVYASERSKAHQSYRVPPQCPPDVQKGECHVNFIRKEQSSFSWDWGPSFPTMGLWRDVRLEGFDAL--QLQQLSYLPLYNGSGSQWGLQVEL---LIDAVRTTGVQVTFSISELG--LEQVFQTQFLPGRTKRTFTFNIEKSSRVKLWWPSGHGDQPFHLLSVRVFVDGSLMLDREVKVYFRTVELIQEPIPGSPGLSFYFQINGKPIFLKGSNWIP-AHAFQDQVTPAVLKNLLRSAVDANMNALRVWGGGVYEQDLFYDMCDDMGIMVWQDFMFACAMYPTEADFIQTVREEAVQQVGRLKSHPSIIIWSGNNENEAALATNWFNISASQRPVYVKDYVTLYVDNIRKIVQKEDPSRPFLVSSPTNGVESEQEGWVAADPYNPHYGDVHFYSYLSDCWDWTTFPRTRFASEYGFQSWPSFSTLQPVSVGE-DWSFDSRFTSHRQHHQSGNQQMLEQAALHFH--LPNAT-DLLRRFTQTLYITQVMQAQCVKAQTEFYRSSRSQVVG-GKGHTMGALYWQLNDIWPAPSWSSLEFGGKWKMLHYFARSFFAP--LLPVSVEDDGALII----------YAVSDLSADLKLRAVVTVHSWAYLDPVCSRTSDLRVVPGGSAAVLYRQPVATLLAGCGRCTRL-TCLLTFHLEDSAGIQQGSNNYHFLSSPREAEGLQRA---NITVKVQQDGGGLTVTL---QSSSIAAFVWLDVGNIPGRFTANGFLMLSRNKTVGFEPWR 860          
BLAST of Mannosidase beta vs. Planmine SMEST
Match: SMESG000055910.1 (SMESG000055910.1)

HSP 1 Score: 1775.76 bits (4598), Expect = 0.000e+0
Identity = 894/895 (99.89%), Postives = 895/895 (100.00%), Query Frame = 1
Query:   76 MKFLALIFILFYCGHVLETFEITKWTLXXXXXXXXXXXXXXPVDSFSALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQXXXXXXXXXXXXXXXXXGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSWGTFSNNGFHITSKSTSINFYPWQTGAETFFNCSQLNIDVFSLNELHL 2760
            MKFLALIFILFYCGHVLETFEITKWTLISSDRRIIIRNISSPVDSFSALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQSEPFSIGPSSSYSLSVSGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAV+FLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSWGTFSNNGFHITSKSTSINFYPWQTGAETFFNCSQLNIDVFSLNELHL
Sbjct:    1 MKFLALIFILFYCGHVLETFEITKWTLISSDRRIIIRNISSPVDSFSALFQNSFIDWPWKGFNDIKYRWIAHQNFSFQSEPFSIGPSSSYSLSVSGLDVGPTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQTARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKVEFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVVNKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYEMKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFIKGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFYHLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILLWSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVFIMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMTTEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVHFLFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEGLGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIENIRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDMKCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYPLQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSWGTFSNNGFHITSKSTSINFYPWQTGAETFFNCSQLNIDVFSLNELHL 895          
The following BLAST results are available for this feature:
BLAST of Mannosidase beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MANBA8.995e-12432.62mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831... [more]
MANBA4.068e-11836.24mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831... [more]
MANBA1.319e-11631.19mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831... [more]
MANBA1.930e-9932.07mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831... [more]
MANBA3.497e-7334.73mannosidase beta [Source:HGNC Symbol;Acc:HGNC:6831... [more]
back to top
BLAST of Mannosidase beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C33G3.45.976e-10633.92Probable beta-mannosidase [Source:UniProtKB/Swiss... [more]
Y105E8B.99.189e-721.81pep chromosome:WBcel235:I:14675600:14682566:-1 gen... [more]
back to top
BLAST of Mannosidase beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
beta-Man1.219e-10029.32gene:FBgn0037215 transcript:FBtr0336704[more]
beta-Man2.212e-10029.65gene:FBgn0037215 transcript:FBtr0078964[more]
beta-Man2.212e-10029.65gene:FBgn0037215 transcript:FBtr0306022[more]
beta-Man6.105e-9331.86gene:FBgn0037215 transcript:FBtr0336703[more]
beta-Man6.105e-9331.86gene:FBgn0037215 transcript:FBtr0336702[more]
back to top
BLAST of Mannosidase beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
manba4.371e-12432.16mannosidase, beta A, lysosomal [Source:ZFIN;Acc:ZD... [more]
manba1.773e-12030.91mannosidase, beta A, lysosomal [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Mannosidase beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rassf76.381e-12131.83Ras association (RalGDS/AF-6) domain family (N-ter... [more]
rassf76.486e-12131.63Ras association (RalGDS/AF-6) domain family (N-ter... [more]
rassf79.750e-12131.63Ras association (RalGDS/AF-6) domain family (N-ter... [more]
rassf75.607e-12031.40Ras association (RalGDS/AF-6) domain family (N-ter... [more]
rassf73.488e-11831.03Ras association (RalGDS/AF-6) domain family (N-ter... [more]
back to top
BLAST of Mannosidase beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Manba3.848e-12632.82mannosidase, beta A, lysosomal [Source:MGI Symbol;... [more]
Manba1.244e-1536.03mannosidase, beta A, lysosomal [Source:MGI Symbol;... [more]
Gusb5.931e-725.00glucuronidase, beta [Source:MGI Symbol;Acc:MGI:958... [more]
back to top
BLAST of Mannosidase beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K2I4|MANBA_MOUSE3.995e-12532.94Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba... [more]
sp|Q95327|MANBA_CAPHI1.784e-12432.70Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA ... [more]
sp|Q29444|MANBA_BOVIN1.733e-12333.45Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE... [more]
sp|O00462|MANBA_HUMAN4.320e-12332.62Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA ... [more]
sp|Q4FZV0|MANBA_RAT1.534e-11631.70Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=... [more]
back to top
BLAST of Mannosidase beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6E8G12.745e-13031.61Uncharacterized protein (Fragment) OS=Clastoptera ... [more]
A0A3B3BQC31.414e-12832.47Mannosidase, beta A, lysosomal OS=Oryzias melastig... [more]
A0A3B3T8H35.831e-12832.08Mannosidase, beta A, lysosomal OS=Paramormyrops ki... [more]
A0A1S3HNS42.160e-12732.04beta-mannosidase isoform X1 OS=Lingula unguis OX=7... [more]
A0A3P9HDD65.498e-12731.57Mannosidase, beta A, lysosomal OS=Oryzias latipes ... [more]
back to top
BLAST of Mannosidase beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
manba1.531e-12036.53mannosidase beta [Source:NCBI gene;Acc:103036309][more]
manba2.774e-8832.16mannosidase beta [Source:NCBI gene;Acc:103036309][more]
back to top
BLAST of Mannosidase beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
manba3.803e-10430.47mannosidase, beta A, lysosomal [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Mannosidase beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mannosidase beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mannosidase beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
manba1.745e-12731.44mannosidase beta [Source:NCBI gene;Acc:101166673][more]
back to top
BLAST of Mannosidase beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000055910.10.000e+099.89SMESG000055910.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005278 ID=SMED30005278|Name=Mannosidase beta|organism=Schmidtea mediterranea sexual|type=transcript|length=3229bp
AATAAATGTTGATTGTGCCTAAGATTAAATCGAATTAATGAATCAATAGT
GCAAAGTTCAACATTGACGAATATTATGAAATTTTTAGCACTAATATTTA
TCTTGTTTTATTGTGGACATGTTTTAGAAACGTTTGAGATAACCAAATGG
ACCTTAATTAGCAGTGACAGAAGGATTATAATTCGAAATATATCTTCTCC
GGTGGATTCATTTAGTGCCTTATTTCAAAATTCGTTTATAGATTGGCCAT
GGAAAGGTTTCAATGATATAAAATATAGATGGATAGCTCATCAAAACTTT
TCGTTTCAAAGCGAACCGTTTTCAATAGGACCGAGCTCTTCCTATTCCTT
ATCAGTGTCTGGATTAGATGTCGGTCCAACGATATTCCTCAATGATAAAT
ATATCGGCACAACCCAGAGCGAATTTATTTCCACAAATTTTATTATCAAT
TCTTCATTTGTGTTAAAATCAAATAATATAATAGTAATAAAGTTTATATC
ATCGTTAATGTTGGCAAACCAAACAGCTAGACAAAGCAGTTATCAAGTAC
CCCCTGATTGTTGGCCAAAGGAATTTAATGGAGACTGCCACATAAATTTC
ATTCGAAAAACTCAAGCTTCATTTGGCTGGGATTGGGGGCCATCAATAGC
TGCGGTTGGGATTCGCGGAAAAGTGGAATTCAACTCTGCTAATCAAACCA
CTGGAAAAATAAAATTTGTAAAAGTTCTTACAAAGACCACCGCAAACTGT
TCCCATTGGTCAGCGGAAGTGGTAATAAATGTTTTTATTTTATTAGCAGA
AACCAAGACCCAAATATGTGTAGTTAATAAAATAACGAATATGAAATCGA
AATTGCAAAAATGTTTAGATGTTTCAAAGAATGGATTAGTGGAATTTCGT
TTCCATGTAAAACTCCATGTACAAAGCTTGAAACTATGGTGGCCCCACGA
TTTAGGCACTCCAGCTTTATATGAGATGAAGACATACGTTTTACTCACAG
GCCAGGTTTTGGACTATAAAATTCAATATGTAGGATTCAGGTCGGTTTCA
CTCAATCAAACCACTTTAGCAAACCACCTTGGACGATATTTTGGGTTTTC
TATAAATTGCAAGCCATTCTTTATCAAAGGAACAAATTGGGTTCCACGAA
CATATTTAACACAAGATTGGAACAATGCGACATTCATTGAATTTTTAATG
AATTCAGTTGTCACAGCAAATATGAATACTATTAGACTTTGGGGAGGTGG
CAAACCAGAAACGGAACATTTCTACCATCTCGCTGATAGCTTAGGATTGA
TGATATGGCACGACTTGATGTTTGCATGTGCCCTTTATCCAGACAATGAA
AATTTTTTATCACATGTCAGGAAGGAAGTTACGGAAATCGTAAACCATCT
ACAAATCCATCCTTCCATTTTACTGTGGTCAGGAAACAATGAAATCGAAG
TATTAATTGCTCAAGGATGGTACAATACAAAACAAATGGATCCTCAAAAT
ATAAAGCGATATCAACATCTTTTTGGAGAGGTTATAAAAACTATAGTGAC
TTCTGCCGACCCTTATGGGGTTTTTATTATGTCTTCTCCAAGTAATGGAG
TTGAAAGCGAAAAATCCCAAGGGGTTTCAAAGAACCCTCAAAGCCAGATT
TTTGGTGATGTGCATTTTTATCTTTATCTTGGTGATTTATGGAATAAGAG
TCTTTATCCCATTACGAGAATGACAACCGAATTTGGATTTCAATCTCTTC
CACAACAGGATACTTGGGAATTTATGGTCTTTTCAGAGAGCGATTATGAG
ATAGATGGAGTTCTTATGAAACATTTGCAGCATCACCAAGATGGGAATAA
ACAACTCATTGACGCTGTTTATTTTCTTTTCGGGAAACTTTATCCGAATA
ATACCATTTCACTGGGAGAACAATATAAATGGTTTAGTTATTTAACGCAA
ATCAACCAAGGGGTAATTTTGGGAAACTATATCAAGAGGCTCCTATCAAG
TCAATGTATGCTCACCTCAGAAGGATTAGGCTTGACAAGAGGTGCAATGT
TCTGGCAGCTAAATGACAACTGGATTGCTCCAACTTGGTCAACAATCGAC
TGGTTTGGACATTGGAAACTAGGACATTATTTCGTGAAAGAATCATTTTC
CCCGGAACGAATAACTATCGAAAATATCAGGGACTCCGTCAACGTAATCC
TGATTTTAAAGGAAGAATTTGTTCGAACACAATATACAATTATTACACGT
TCTTTCAACATTACTAGGGAACTTCAATCGTCAATTATTTATGAGGAAAA
CATACTATTTGACACCCTGGACATGAAATGTAATGTACAAACTATTTTTA
CAGTGAATCTGTCCAAATTTGTACAGAAATTCAAATGCTCTAATATTAGG
CAATGCCTGTTTGAGGTTATATTGAAACGCAACGAATCAATTGTATCTGT
TGATACGTTAATGCTTGTTTATCCTCTGCAATTGGATATCCCACCCAATG
CGGCGGCAAACAAGGTTTCTGTAAAAATTCGCCAAGACAATCCGGATTTT
AGTATTTGTTTGTTGGATGTGCAATCTCATTATGTAAGTCTGTTTGTCAC
GCTAACGACACCTTCTTGGGGTACTTTCAGCAACAATGGATTCCATATTA
CTAGCAAATCAACGTCCATCAATTTTTATCCTTGGCAAACTGGCGCAGAA
ACATTTTTCAACTGCTCACAACTCAATATTGACGTTTTCTCTCTGAATGA
GCTGCACTTGTAAATTTCGCAACTCTAAGTTTAGCATTTTTATTTTTGTT
GATTCTAAATGATTTTCAATTCTATTTGTGTAATTTTTACATGATTTTAT
TATATATGATTTATTTTGAAACGGTATAAATTTACTTCACTAATCACGTA
GAATGAGTTCAGATTTCCAATACCAAGTGACCATTGAAGCCCAGTATTTG
ATGGGTCATGACATCCCATTAACCTTTGTCGACAAGATGAGGAATTCGTA
AATTTGATATAAAAGATAAAATTGTGATATCCTCTGTGGCCTGGTAGAGG
AATGGTCAGATTCTGAGCTTAAAAGAGTTATTTTGCAGAGTTATTGTGTT
TGACCCGTGTAGGCCAATAATACACTGCCCTTCAGACAGAGCCCATTAAA
CATCTTATCCGGTTATTAGATCTAGTTAAAACATCCATTATTTGAAAATA
TTTATTAATAAGACAAATTTAAATTCCAT
back to top

protein sequence of SMED30005278-orf-1

>SMED30005278-orf-1 ID=SMED30005278-orf-1|Name=SMED30005278-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=896bp
MKFLALIFILFYCGHVLETFEITKWTLISSDRRIIIRNISSPVDSFSALF
QNSFIDWPWKGFNDIKYRWIAHQNFSFQSEPFSIGPSSSYSLSVSGLDVG
PTIFLNDKYIGTTQSEFISTNFIINSSFVLKSNNIIVIKFISSLMLANQT
ARQSSYQVPPDCWPKEFNGDCHINFIRKTQASFGWDWGPSIAAVGIRGKV
EFNSANQTTGKIKFVKVLTKTTANCSHWSAEVVINVFILLAETKTQICVV
NKITNMKSKLQKCLDVSKNGLVEFRFHVKLHVQSLKLWWPHDLGTPALYE
MKTYVLLTGQVLDYKIQYVGFRSVSLNQTTLANHLGRYFGFSINCKPFFI
KGTNWVPRTYLTQDWNNATFIEFLMNSVVTANMNTIRLWGGGKPETEHFY
HLADSLGLMIWHDLMFACALYPDNENFLSHVRKEVTEIVNHLQIHPSILL
WSGNNEIEVLIAQGWYNTKQMDPQNIKRYQHLFGEVIKTIVTSADPYGVF
IMSSPSNGVESEKSQGVSKNPQSQIFGDVHFYLYLGDLWNKSLYPITRMT
TEFGFQSLPQQDTWEFMVFSESDYEIDGVLMKHLQHHQDGNKQLIDAVYF
LFGKLYPNNTISLGEQYKWFSYLTQINQGVILGNYIKRLLSSQCMLTSEG
LGLTRGAMFWQLNDNWIAPTWSTIDWFGHWKLGHYFVKESFSPERITIEN
IRDSVNVILILKEEFVRTQYTIITRSFNITRELQSSIIYEENILFDTLDM
KCNVQTIFTVNLSKFVQKFKCSNIRQCLFEVILKRNESIVSVDTLMLVYP
LQLDIPPNAAANKVSVKIRQDNPDFSICLLDVQSHYVSLFVTLTTPSWGT
FSNNGFHITSKSTSINFYPWQTGAETFFNCSQLNIDVFSLNELHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR036156Beta-gal/glucu_dom_sf
IPR006102Glyco_hydro_2_Ig-like
IPR008979Galactose-bd-like_sf
IPR013812Glyco_hydro_2/20_Ig-like
IPR013781Glyco_hydro_catalytic_dom
IPR017853Glycoside_hydrolase_SF
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004567beta-mannosidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006516glycoprotein catabolic process
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005764lysosome
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 322..691
e-value: 2.4E-98
score: 332.1
NoneNo IPR availablePANTHERPTHR43730FAMILY NOT NAMEDcoord: 23..872
NoneNo IPR availablePANTHERPTHR43730:SF1BETA-MANNOSIDASEcoord: 23..872
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.785
IPR006102Glycoside hydrolase, family 2, immunoglobulin-like beta-sandwichPFAMPF00703Glyco_hydro_2coord: 222..322
e-value: 3.0E-8
score: 34.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 211..321
e-value: 1.3E-11
score: 46.8
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 16..207
e-value: 2.6E-33
score: 117.4
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 25..201
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 319..693
IPR036156Beta-Galactosidase/glucuronidase domain superfamilySUPERFAMILYSSF49303beta-Galactosidase/glucuronidase domaincoord: 217..322