Tripeptidyl peptidase 2

Overview
NameTripeptidyl peptidase 2
Smed IDSMED30005274
Length (bp)4453
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tripeptidyl peptidase 2 (SMED30005274) t-SNE clustered cells

Violin plots show distribution of expression levels for Tripeptidyl peptidase 2 (SMED30005274) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tripeptidyl peptidase 2 (SMED30005274) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tripeptidyl peptidase 2 (SMED30005274) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005274

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005274SMESG000074726.1 Contig6326newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30005274SMESG000074726.1 Contig6326newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30005274SMESG000074726.1 Contig6326uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30005274SMESG000074726.1 Contig6326uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30005274SMESG000074726.1 dd_Smed_v4_8122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30005274SMESG000074726.1 dd_Smed_v4_8122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Human
Match: TPP2 (tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12016])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 420/1308 (32.11%), Postives = 647/1308 (49.46%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTE 3983
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ LERL+D    V  +   +L+ +  ++       KK ++   N ++        ++T+ P  K+ K    G YL+G+L L K E  +K           A QSA ++    +   +P+H+      YL             +P       + +  KEK  E   +    K EF E L    I W+     K D   I   +K    +       L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSS---NLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKK-----------AGQSAAKRQGKFKKDVIPVHY------YL-------------IP-PPTKTKNGSKDKEKDSEKEKDL---KEEFTEALRDLKIQWM----TKLDSSDIYNELKETYPNY----LPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATI--KNDMDKQKSTLVDALCRKGCALADHLLHTQ 1152          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Human
Match: TPP2 (tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12016])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 417/1308 (31.88%), Postives = 640/1308 (48.93%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTE 3983
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ LERL+D    V  +   +L+ +  ++       KK ++   N ++        ++T+ P  K+ K    G YL+G+L L K E  +K    P  Y      + T+ G                     ++D  ++S                  KEK L         K EF E L    I W+     K D   I   +K    +       L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSS---NLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNG---------------------SKDKEKDS-----------------EKEKDL---------KEEFTEALRDLKIQWM----TKLDSSDIYNELKETYPNY----LPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATI--KNDMDKQKSTLVDALCRKGCALADHLLHTQ 1139          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Human
Match: TPP2 (tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12016])

HSP 1 Score: 489.96 bits (1260), Expect = 5.313e-150
Identity = 303/850 (35.65%), Postives = 446/850 (52.47%), Query Frame = 3
Query:  120 DDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGL 2633
            ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+
Sbjct:    3 EEPFPF-HGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGI 751          

HSP 2 Score: 91.2781 bits (225), Expect = 1.184e-17
Identity = 99/381 (25.98%), Postives = 156/381 (40.94%), Query Frame = 3
Query: 2844 FNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTE 3983
             N PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ LERL+D    V  +   +L+ +  ++       KK ++   N ++        ++T+ P  K+ K    G YL+G+L L K E  +K    P  Y      + T+ G                     ++D  ++S                  KEK L         K EF E L    I W+     K D   I   +K    +       L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+
Sbjct:  758 LNIPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSS---NLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNG---------------------SKDKEKDS-----------------EKEKDL---------KEEFTEALRDLKIQWM----TKLDSSDIYNELKETYPNY----LPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAAT--IKNDMDKQKSTLVDALCRKGCALADHLLHTQ 1069          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Human
Match: TPP2 (tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12016])

HSP 1 Score: 465.307 bits (1196), Expect = 5.374e-141
Identity = 339/1137 (29.82%), Postives = 529/1137 (46.53%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKG------ENSQHFKLPLHFTECLMN 3452
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN                      SG DG    ++ +PGG                                  V  W  RG                              LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ LERL+D    V  +   +L+ +  ++       KK ++   N ++        ++T+ P  K+ K    G YL+G+L L K E  +K    P  Y      + T+ G      ++ +   L   FTE L +
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPN----------------------SGADGALGVSISAPGGAI------------------------------ASVPNWTLRG----------------------------TQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSS---NLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEEFTEALRD 951          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Human
Match: TPP2 (tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12016])

HSP 1 Score: 120.553 bits (301), Expect = 3.147e-30
Identity = 66/168 (39.29%), Postives = 95/168 (56.55%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLEN 608
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW        AE   K+++       FD+ N
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEE-------FDVAN 160          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Celegans
Match: tpp-2 (Tripeptidyl-peptidase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q09541])

HSP 1 Score: 387.497 bits (994), Expect = 3.099e-112
Identity = 371/1447 (25.64%), Postives = 653/1447 (45.13%), Query Frame = 3
Query:  147 LIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDV--HMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTI----------------FDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSL--PVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLT----NVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEIS-DQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKK-TVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWS-ATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYIKKS---VSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTF--AVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRW--------SKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKD---QKSKYD--QNKQHLTEVLCIYGLCLCEIILDTEKDY------SEDDKDNCSEIRDKL------NGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASL-----IKEVLLKLEWNVLAQYYEQLIPLKHPISCQL 4298
            L+ K  T+   F+ + PNYDGR++ IAI DTGVDP+  G+Q+TT G+ K+  + D SG+GDV   + + VK      I  +S R++ IPE W        +G+K   +++   V SR+  + KE++     +   +E L   K+  +H  +                F  +  FLK    V +       PV D + +   + W   +DT+     + L +V  L +F +   +     K ++ + V +  +G + EIV  SG+HG+HVA IAA  +P  P+ NG+APGA+I+S+ I D+RL +METG A+  A  +  EL  DI+N+SFGE +  P+ GR+ +  + L+++ G+++  S+GN GPALSTVG+PGGTT  + GI   +  +  ++ Y +  PV++       +Y W+SRGP  DG LG+ + AP +A   V  +  +++ +MNG+SMSSPNA G ++ ++S   Q     TP+ + ++  NTA ++ +I   SQG G+++I +++E + +  +N             VF                               P LT    NV NH                  C  S G   + +REP   +  + FTI + P F   + + +   ++ +  + L  +A WV+ P+   +  QER++ + +D +   +                G  +TEI         LG + R+P+TV   E ++  ++  T++   K   T R F+  P  A S  +T++  +  D   RF L  + ++ +  + N+E  K           I    +  +T     T+E  V + WS   N  +++ ++DF G++  T    +  + N       +  +  ++SP+ISL  LV+ L+P   ++  +      ++   ++  L L Y     KP  V +    L   LYE+   C ++ IF +N   VG+    P+       ++   ++KGD+ +Q  +R+     L+ +++  + V+ K    ++ + + S  D    K+   A     +   E +V  +     K+ KT     GS+L+GT    K+  L         Y  + + +   KG +    K   +  + + + +R+ ++   S VQ L  E  +        +K   DH+  L  +   ++ +   L+    E  +K     IE   + +   K N   + + ++    +   DL   D+W         +  D+V KLI+ ++ +  S  +  +   A  SL +D   +KSK+D   + +       I+G    E+I    + Y      SE      SE   KL      N  Y ++  ++S  D+  T L     H+     +GR  K+L K+ ++     T S      + EV   LEWN LA +++    +K+  S +L
Sbjct:   64 LLNKTDTEQEIFLTKYPNYDGRDILIAILDTGVDPSLPGMQVTTTGERKMFDVIDCSGAGDVDTSITRTVK---DGVIEGISGRKLAIPEKWKCPTGQYHVGLKPIFELYTKGVKSRVISERKEDVVGPSHNIAASEAL---KQLTEHEKVVGGTSEKTSDKWAREDFACKVDFLKSMASVADVG-----PVADVVTWHDGEMWRVCIDTS-FRGRLGLGNV--LGTFRETGDYAYLTNKDSVVYTVRVSPDGNLTEIVVPSGAHGSHVAGIAAANYPDNPQKNGLAPGAKILSLNIGDHRLGAMETGQAMTRAFNMCAELNVDIINMSFGEGTHLPDVGRVIEEARRLINRRGVIYVCSAGNQGPALSTVGAPGGTTTGVIGIGAYLTSESADTLYGVYKPVES------SIYPWSSRGPCQDGKLGVSLVAPAAAFAGVPQYCRQSMQMMNGTSMSSPNAAGNVACMLSGLKQNNLKWTPYTVRMALENTAYMLPHIESFSQGQGMIKIATAYEKLSEILVN------------KVFP------------------------------PRLTHFEINVSNH------------------CKKSKG---VYVREP-NWNGPQEFTIGVEPIFQNHLSDNNLPAISFEKQIILQSTAPWVSHPQTMFVVAQERTMVVTVDASKAPK----------------GANYTEIVGIDTADPSLGPIFRIPVTVINPEKVAVDQY--TSRLVGKSGVTERRFVEVPSWATSAKITLRSTN-KDEMDRFTLHTVYIEDDKCSRNTETQKIQG-------PIGNEWSKSITVQGGKTLEACVVRAWSRGKNPVDVDMTIDFFGVKKPTSISLIHGATNTPIRFQAAPTKSIDVSPSISLKSLVVSLKPQSAKVEPLGPRDMFLTSGLQINRLLLTYQLKVQKPSEVQLQLAGLTPYLYESPVDCVLFQIFGANKSFVGASSSYPD-------RWTQKLEKGDYTIQAQIRYPDDQVLQGMKELPLLVHVKLGNKISVDLAASASDATLGKECKFAG-KALLPNQEMTVYAMNIADDKLPKTIVPTSGSFLAGTFSALKDSDLSDVDKSEVIYFLSEYSTRPTKGLSMVTTKKDTNQNQEMTDAIRDLEV---SWVQKLTDEKAAKEFFEACLQK-YPDHLPLLQNR--VKQLMQAKLVDQTPENVQK----IIELCGQILQITKPNETLQFSSVKQEHDD---DLLTVDKWLALTGGSEDQRKDVV-KLISQFEERKKSIILALQ---ALSSLEQDIEVRKSKFDVPASLRFGGITPLIFGGKQGEVINKKSEGYEALKSKSEQIDATVSEELKKLDSNWTGNQFYVKLLVWLSA-DDTKTAL-ISAKHAAALGQFGRCAKLLNKAGDELKSSATDSQAVDTSLAEVCESLEWNHLATHFKNSALIKNRTSYRL 1373          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Fly
Match: TppII (gene:FBgn0020370 transcript:FBtr0087774)

HSP 1 Score: 311.227 bits (796), Expect = 2.934e-86
Identity = 194/536 (36.19%), Postives = 298/536 (55.60%), Query Frame = 3
Query:  144 SLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKP-KLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREI-IIPESWNIG---DQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNK-----KKKPNQHSTIFDLENQFLKECLEV-------IEKSYEYPIPVLDCIVF-QKDDWVAFVDTT---CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVEL-----KCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTD-LLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQI 1670
            +L+PK  T  ++F+++ P YDGR+V IAI+D+GVDP + GL+   +GK  K+I   D SG GDV M K+V PD    I  LS   + + PE   +    ++++R+G+KS +D+ P+ V + +    K   W K      A    K      + P + S +   + + LKE L+         EK Y       DCI+F   D W+  VDTT    L+  +++ +    +   + R    F     L+  VN+HD G +LE+V  S  HGTHV+SIA+G    R + +G+AP A+IVS+ I D RL SMETG AL  A    +EL     + D++N+S+GE +   N GRI ++M E+V+K+G+V+ +S+GN GPAL TVG+P   +   L G+   V P M+E+ Y++       L   VYTW SR P  DG  G+ V APG AI SV  +      LMNG+SM++P+  G ++LLIS   Q     +P+ +  +   TA+ + Y+   +QG+GLL ++ +FE++ ++  + DN +
Sbjct:  101 ALVPKAETGVLNFLQKYPEYDGRDVTIAIFDSGVDPRATGLETLCDGKTVKVIERYDCSGCGDVDMKKKVTPDENGNIKGLSGNSLKLSPELMALNTDPEKAVRVGLKSFSDLLPSKVRNNIVAQAKLKHWDKPHKTATANASRKIVEFESQNPGEASKL-PWDKKILKENLDFELEMLNSYEKVYGDIKTSYDCILFPTADGWLTIVDTTEQGDLDQALRIGEYSRTH---ETRNVDDF-----LSISVNVHDEGNVLEVVGMSSPHGTHVSSIASGNHSSR-DVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCRDGRRIDVINMSYGEHANWSNSGRIGELMNEVVNKYGVVWVASAGNHGPALCTVGTPPDISQPSLIGVGAYVSPQMMEAEYAMR----EKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMSKSQLMNGTSMAAPHVAGAVALLISGLKQQNIEYSPYSIKRAISVTATKLGYVDPFAQGHGLLNVEKAFEHLTEHRQSKDNML 622          

HSP 2 Score: 140.584 bits (353), Expect = 4.796e-33
Identity = 134/537 (24.95%), Postives = 241/537 (44.88%), Query Frame = 3
Query: 1824 LTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDF-NEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISS---------LEWHHTNKFTAKKKTV-RHFIATPHGAD--SLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNH-YRLLIESQLRLEEISPAISLNYLVLPLRPYKDE---LTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVD-VNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTF----AVGSYLSGTLYLYKNETLRKTVSYPFQYIF 3368
            LT  +  +  +  F ++   +N ++GI LR+  + +   Y  + I P F N++  +  D+ N  + L+L+ S  WV C  F  L    RSI++++DPT L+                 G++   I  +  +    G+L  +P+TV +   + S               N    +  T+ R FI  P  A    L M I   +  +  G+F +   Q+ P  S    E  K  S   +     NES+       +   +E+ +A+YWS   ++ L+YSL F G+     +  ++ +    ++L IE+ L  E++ P + L    + L+P + +   L+  +  +   +++    L +  N  K   V I+ P   +LLYE +F  QM+ +FD+N  +V +GD     ++ +       +DKG++ ++L VRH     LE++ +  +   FK    LT +F ++    +   +K  ++ L  S       VLYI  P+T+   T     A  ++LSG L   ++E  R+   +PF YI 
Sbjct:  611 LTEHRQSKDNMLRFSVRVG-NNADKGIHLRQGVQRNSIDY-NVYIEPIFYNDKEADPKDKFNFNVRLNLIASQPWVQCGAFLDLSYGTRSIAVRVDPTGLQP----------------GVHSAVIRAYDTDCVQKGSLFEIPVTVVQPHVLESDQNTPVFEPASSKGDNSVEFQPNTIQRDFILVPERATWAELRMRITDPNRGEDIGKFFVHTNQLLPKQSCRKLETMKIVSVGSE-----NESI-MAFKVKSGRILELCIAKYWSNYGQSHLKYSLRFRGVEAHNPNAYVMHAGRGIHKLEIEA-LVAEDVQPQLQLKNAEVVLKPTEAKISPLSATRDVIPDGRQVYQNLLAFNLNVAKAADVSIYAPIFNDLLYEAEFESQMWMLFDANKALVATGDAHSHTSFTK-------LDKGEYTIRLQVRHEKRDLLEKISEANLVASFKLTSPLTLDFYENYNQCIVGGRKYVSSPLRLST-----RVLYI-APITQERLTKANLPAQCAWLSGNLVFPQDEVGRRVAQHPFTYIL 1109          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Fly
Match: TppII (gene:FBgn0020370 transcript:FBtr0344199)

HSP 1 Score: 310.457 bits (794), Expect = 3.469e-86
Identity = 194/536 (36.19%), Postives = 298/536 (55.60%), Query Frame = 3
Query:  144 SLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKP-KLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREI-IIPESWNIG---DQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNK-----KKKPNQHSTIFDLENQFLKECLEV-------IEKSYEYPIPVLDCIVF-QKDDWVAFVDTT---CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVEL-----KCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTD-LLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQI 1670
            +L+PK  T  ++F+++ P YDGR+V IAI+D+GVDP + GL+   +GK  K+I   D SG GDV M K+V PD    I  LS   + + PE   +    ++++R+G+KS +D+ P+ V + +    K   W K      A    K      + P + S +   + + LKE L+         EK Y       DCI+F   D W+  VDTT    L+  +++ +    +   + R    F     L+  VN+HD G +LE+V  S  HGTHV+SIA+G    R + +G+AP A+IVS+ I D RL SMETG AL  A    +EL     + D++N+S+GE +   N GRI ++M E+V+K+G+V+ +S+GN GPAL TVG+P   +   L G+   V P M+E+ Y++       L   VYTW SR P  DG  G+ V APG AI SV  +      LMNG+SM++P+  G ++LLIS   Q     +P+ +  +   TA+ + Y+   +QG+GLL ++ +FE++ ++  + DN +
Sbjct:   14 ALVPKAETGVLNFLQKYPEYDGRDVTIAIFDSGVDPRATGLETLCDGKTVKVIERYDCSGCGDVDMKKKVTPDENGNIKGLSGNSLKLSPELMALNTDPEKAVRVGLKSFSDLLPSKVRNNIVAQAKLKHWDKPHKTATANASRKIVEFESQNPGEASKL-PWDKKILKENLDFELEMLNSYEKVYGDIKTSYDCILFPTADGWLTIVDTTEQGDLDQALRIGEYSRTH---ETRNVDDF-----LSISVNVHDEGNVLEVVGMSSPHGTHVSSIASGNHSSR-DVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCRDGRRIDVINMSYGEHANWSNSGRIGELMNEVVNKYGVVWVASAGNHGPALCTVGTPPDISQPSLIGVGAYVSPQMMEAEYAMR----EKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMSKSQLMNGTSMAAPHVAGAVALLISGLKQQNIEYSPYSIKRAISVTATKLGYVDPFAQGHGLLNVEKAFEHLTEHRQSKDNML 535          

HSP 2 Score: 140.969 bits (354), Expect = 3.415e-33
Identity = 134/537 (24.95%), Postives = 241/537 (44.88%), Query Frame = 3
Query: 1824 LTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDF-NEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISS---------LEWHHTNKFTAKKKTV-RHFIATPHGAD--SLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNH-YRLLIESQLRLEEISPAISLNYLVLPLRPYKDE---LTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVD-VNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTF----AVGSYLSGTLYLYKNETLRKTVSYPFQYIF 3368
            LT  +  +  +  F ++   +N ++GI LR+  + +   Y  + I P F N++  +  D+ N  + L+L+ S  WV C  F  L    RSI++++DPT L+                 G++   I  +  +    G+L  +P+TV +   + S               N    +  T+ R FI  P  A    L M I   +  +  G+F +   Q+ P  S    E  K  S   +     NES+       +   +E+ +A+YWS   ++ L+YSL F G+     +  ++ +    ++L IE+ L  E++ P + L    + L+P + +   L+  +  +   +++    L +  N  K   V I+ P   +LLYE +F  QM+ +FD+N  +V +GD     ++ +       +DKG++ ++L VRH     LE++ +  +   FK    LT +F ++    +   +K  ++ L  S       VLYI  P+T+   T     A  ++LSG L   ++E  R+   +PF YI 
Sbjct:  524 LTEHRQSKDNMLRFSVRVG-NNADKGIHLRQGVQRNSIDY-NVYIEPIFYNDKEADPKDKFNFNVRLNLIASQPWVQCGAFLDLSYGTRSIAVRVDPTGLQP----------------GVHSAVIRAYDTDCVQKGSLFEIPVTVVQPHVLESDQNTPVFEPASSKGDNSVEFQPNTIQRDFILVPERATWAELRMRITDPNRGEDIGKFFVHTNQLLPKQSCRKLETMKIVSVGSE-----NESI-MAFKVKSGRILELCIAKYWSNYGQSHLKYSLRFRGVEAHNPNAYVMHAGRGIHKLEIEA-LVAEDVQPQLQLKNAEVVLKPTEAKISPLSATRDVIPDGRQVYQNLLAFNLNVAKAADVSIYAPIFNDLLYEAEFESQMWMLFDANKALVATGDAHSHTSFTK-------LDKGEYTIRLQVRHEKRDLLEKISEANLVASFKLTSPLTLDFYENYNQCIVGGRKYVSSPLRLST-----RVLYI-APITQERLTKANLPAQCAWLSGNLVFPQDEVGRRVAQHPFTYIL 1022          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Fly
Match: TppII (gene:FBgn0020370 transcript:FBtr0087775)

HSP 1 Score: 310.457 bits (794), Expect = 3.469e-86
Identity = 194/536 (36.19%), Postives = 298/536 (55.60%), Query Frame = 3
Query:  144 SLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKP-KLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREI-IIPESWNIG---DQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNK-----KKKPNQHSTIFDLENQFLKECLEV-------IEKSYEYPIPVLDCIVF-QKDDWVAFVDTT---CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVEL-----KCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTD-LLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQI 1670
            +L+PK  T  ++F+++ P YDGR+V IAI+D+GVDP + GL+   +GK  K+I   D SG GDV M K+V PD    I  LS   + + PE   +    ++++R+G+KS +D+ P+ V + +    K   W K      A    K      + P + S +   + + LKE L+         EK Y       DCI+F   D W+  VDTT    L+  +++ +    +   + R    F     L+  VN+HD G +LE+V  S  HGTHV+SIA+G    R + +G+AP A+IVS+ I D RL SMETG AL  A    +EL     + D++N+S+GE +   N GRI ++M E+V+K+G+V+ +S+GN GPAL TVG+P   +   L G+   V P M+E+ Y++       L   VYTW SR P  DG  G+ V APG AI SV  +      LMNG+SM++P+  G ++LLIS   Q     +P+ +  +   TA+ + Y+   +QG+GLL ++ +FE++ ++  + DN +
Sbjct:   14 ALVPKAETGVLNFLQKYPEYDGRDVTIAIFDSGVDPRATGLETLCDGKTVKVIERYDCSGCGDVDMKKKVTPDENGNIKGLSGNSLKLSPELMALNTDPEKAVRVGLKSFSDLLPSKVRNNIVAQAKLKHWDKPHKTATANASRKIVEFESQNPGEASKL-PWDKKILKENLDFELEMLNSYEKVYGDIKTSYDCILFPTADGWLTIVDTTEQGDLDQALRIGEYSRTH---ETRNVDDF-----LSISVNVHDEGNVLEVVGMSSPHGTHVSSIASGNHSSR-DVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCRDGRRIDVINMSYGEHANWSNSGRIGELMNEVVNKYGVVWVASAGNHGPALCTVGTPPDISQPSLIGVGAYVSPQMMEAEYAMR----EKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMSKSQLMNGTSMAAPHVAGAVALLISGLKQQNIEYSPYSIKRAISVTATKLGYVDPFAQGHGLLNVEKAFEHLTEHRQSKDNML 535          

HSP 2 Score: 140.969 bits (354), Expect = 3.415e-33
Identity = 134/537 (24.95%), Postives = 241/537 (44.88%), Query Frame = 3
Query: 1824 LTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDF-NEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISS---------LEWHHTNKFTAKKKTV-RHFIATPHGAD--SLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNH-YRLLIESQLRLEEISPAISLNYLVLPLRPYKDE---LTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVD-VNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTF----AVGSYLSGTLYLYKNETLRKTVSYPFQYIF 3368
            LT  +  +  +  F ++   +N ++GI LR+  + +   Y  + I P F N++  +  D+ N  + L+L+ S  WV C  F  L    RSI++++DPT L+                 G++   I  +  +    G+L  +P+TV +   + S               N    +  T+ R FI  P  A    L M I   +  +  G+F +   Q+ P  S    E  K  S   +     NES+       +   +E+ +A+YWS   ++ L+YSL F G+     +  ++ +    ++L IE+ L  E++ P + L    + L+P + +   L+  +  +   +++    L +  N  K   V I+ P   +LLYE +F  QM+ +FD+N  +V +GD     ++ +       +DKG++ ++L VRH     LE++ +  +   FK    LT +F ++    +   +K  ++ L  S       VLYI  P+T+   T     A  ++LSG L   ++E  R+   +PF YI 
Sbjct:  524 LTEHRQSKDNMLRFSVRVG-NNADKGIHLRQGVQRNSIDY-NVYIEPIFYNDKEADPKDKFNFNVRLNLIASQPWVQCGAFLDLSYGTRSIAVRVDPTGLQP----------------GVHSAVIRAYDTDCVQKGSLFEIPVTVVQPHVLESDQNTPVFEPASSKGDNSVEFQPNTIQRDFILVPERATWAELRMRITDPNRGEDIGKFFVHTNQLLPKQSCRKLETMKIVSVGSE-----NESI-MAFKVKSGRILELCIAKYWSNYGQSHLKYSLRFRGVEAHNPNAYVMHAGRGIHKLEIEA-LVAEDVQPQLQLKNAEVVLKPTEAKISPLSATRDVIPDGRQVYQNLLAFNLNVAKAADVSIYAPIFNDLLYEAEFESQMWMLFDANKALVATGDAHSHTSFTK-------LDKGEYTIRLQVRHEKRDLLEKISEANLVASFKLTSPLTLDFYENYNQCIVGGRKYVSSPLRLST-----RVLYI-APITQERLTKANLPAQCAWLSGNLVFPQDEVGRRVAQHPFTYIL 1022          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Fly
Match: TppII (gene:FBgn0020370 transcript:FBtr0339755)

HSP 1 Score: 294.664 bits (753), Expect = 4.643e-81
Identity = 193/557 (34.65%), Postives = 298/557 (53.50%), Query Frame = 3
Query:  144 SLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKP-KLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREI-IIPESWNIG---DQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNK-----KKKPNQHSTIFDLENQFLKECLEV-------IEKSYEYPIPVLDCIVF-QKDDWVAFVDTT---CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVEL-----KCDIVNLSFGESS-------------------MQPNCG--RICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTD-LLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQI 1670
            +L+PK  T  ++F+++ P YDGR+V IAI+D+GVDP + GL+   +GK  K+I   D SG GDV M K+V PD    I  LS   + + PE   +    ++++R+G+KS +D+ P+ V + +    K   W K      A    K      + P + S +   + + LKE L+         EK Y       DCI+F   D W+  VDTT    L+  +++ +    +   + R    F     L+  VN+HD G +LE+V  S  HGTHV+SIA+G    R + +G+AP A+IVS+ I D RL SMETG AL  A    +EL     + D++N+S+GE +                    +  C   RI ++M E+V+K+G+V+ +S+GN GPAL TVG+P   +   L G+   V P M+E+ Y++       L   VYTW SR P  DG  G+ V APG AI SV  +      LMNG+SM++P+  G ++LLIS   Q     +P+ +  +   TA+ + Y+   +QG+GLL ++ +FE++ ++  + DN +
Sbjct:   14 ALVPKAETGVLNFLQKYPEYDGRDVTIAIFDSGVDPRATGLETLCDGKTVKVIERYDCSGCGDVDMKKKVTPDENGNIKGLSGNSLKLSPELMALNTDPEKAVRVGLKSFSDLLPSKVRNNIVAQAKLKHWDKPHKTATANASRKIVEFESQNPGEASKL-PWDKKILKENLDFELEMLNSYEKVYGDIKTSYDCILFPTADGWLTIVDTTEQGDLDQALRIGEYSRTH---ETRNVDDF-----LSISVNVHDEGNVLEVVGMSSPHGTHVSSIASGNHSSR-DVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCRDGRRIDVINMSYGEHANWSNSGVSGSGSGSDEMRRRRKMCASSRIGELMNEVVNKYGVVWVASAGNHGPALCTVGTPPDISQPSLIGVGAYVSPQMMEAEYAMR----EKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMSKSQLMNGTSMAAPHVAGAVALLISGLKQQNIEYSPYSIKRAISVTATKLGYVDPFAQGHGLLNVEKAFEHLTEHRQSKDNML 556          

HSP 2 Score: 140.969 bits (354), Expect = 3.641e-33
Identity = 134/537 (24.95%), Postives = 241/537 (44.88%), Query Frame = 3
Query: 1824 LTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDF-NEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISS---------LEWHHTNKFTAKKKTV-RHFIATPHGAD--SLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNH-YRLLIESQLRLEEISPAISLNYLVLPLRPYKDE---LTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVD-VNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTF----AVGSYLSGTLYLYKNETLRKTVSYPFQYIF 3368
            LT  +  +  +  F ++   +N ++GI LR+  + +   Y  + I P F N++  +  D+ N  + L+L+ S  WV C  F  L    RSI++++DPT L+                 G++   I  +  +    G+L  +P+TV +   + S               N    +  T+ R FI  P  A    L M I   +  +  G+F +   Q+ P  S    E  K  S   +     NES+       +   +E+ +A+YWS   ++ L+YSL F G+     +  ++ +    ++L IE+ L  E++ P + L    + L+P + +   L+  +  +   +++    L +  N  K   V I+ P   +LLYE +F  QM+ +FD+N  +V +GD     ++ +       +DKG++ ++L VRH     LE++ +  +   FK    LT +F ++    +   +K  ++ L  S       VLYI  P+T+   T     A  ++LSG L   ++E  R+   +PF YI 
Sbjct:  545 LTEHRQSKDNMLRFSVRVG-NNADKGIHLRQGVQRNSIDY-NVYIEPIFYNDKEADPKDKFNFNVRLNLIASQPWVQCGAFLDLSYGTRSIAVRVDPTGLQP----------------GVHSAVIRAYDTDCVQKGSLFEIPVTVVQPHVLESDQNTPVFEPASSKGDNSVEFQPNTIQRDFILVPERATWAELRMRITDPNRGEDIGKFFVHTNQLLPKQSCRKLETMKIVSVGSE-----NESI-MAFKVKSGRILELCIAKYWSNYGQSHLKYSLRFRGVEAHNPNAYVMHAGRGIHKLEIEA-LVAEDVQPQLQLKNAEVVLKPTEAKISPLSATRDVIPDGRQVYQNLLAFNLNVAKAADVSIYAPIFNDLLYEAEFESQMWMLFDANKALVATGDAHSHTSFTK-------LDKGEYTIRLQVRHEKRDLLEKISEANLVASFKLTSPLTLDFYENYNQCIVGGRKYVSSPLRLST-----RVLYI-APITQERLTKANLPAQCAWLSGNLVFPQDEVGRRVAQHPFTYIL 1043          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Fly
Match: S1P (gene:FBgn0037105 transcript:FBtr0078466)

HSP 1 Score: 76.6406 bits (187), Expect = 1.364e-13
Identity = 70/264 (26.52%), Postives = 114/264 (43.18%), Query Frame = 3
Query:  879 SHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQ--PNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTT------DGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            SHGT VA + A       EC G AP A++   K+  N  VS  +    A+     +  K +I+NLS G       P   ++ ++     S + ++  S++GNDGP   T+ +PG  +D++ G+  + F D                  ++  ++SRG TT       G +G+ +   GS +        +    ++G+S+SSP   G  +LLIS A Q    I P  L       A  + +     QG G L +  S + +  Y
Sbjct:  199 SHGTFVAGVIAS----SRECLGFAPDADLYIFKVFTNSQVSYTSWFLDAF--NYAIYRKINILNLSIGGPDFMDSPFVEKVLEL-----SANNVIMISAAGNDGPLYGTLNNPGDQSDVV-GVGGIQFDD------------------KIAKFSSRGMTTWELPLGYGRMGLDIVTYGSQVEGSD--VRKGCRRLSGTSVSSPVVAGAAALLISGAFQKIDYINPASLKQVLIEGAEKLPHYNMFEQGAGKLNLLKSMQLLLSY 430          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Zebrafish
Match: tpp2 (tripeptidyl peptidase 2 [Source:ZFIN;Acc:ZDB-GENE-121214-290])

HSP 1 Score: 429.098 bits (1102), Expect = 2.142e-127
Identity = 231/522 (44.25%), Postives = 322/522 (61.69%), Query Frame = 3
Query:  117 ADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHM--LKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKD-DWVAFVDTT-CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLK-KPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            A++ F F   L+PK  T A  F+ + P YDGR V IAI DTGVDP + G+QITT+GKPK++ + DT+GSGDV+M  + EVK   +  ++ L+ R + IP +W        IGVK+  D FP A+  R+ K+ KE +W         E SR   E       P+Q   +   E Q   E L ++EK Y  P PV DCI +     W A VDT+ C +    L    +L S+ + ++F + G    LNF VNI+D G  L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+++KI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V K+ ++F SS+GN+GP L+TVG PGGTT  + G+   V PDM+ + YSL       L P  YTW+SRGP TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S   Q   +P  P  +  +  NTA  ++ I   +QG+G++Q++ +F+Y+ ++
Sbjct:    6 AEEPFPF-HGLLPKKETGAASFLTKYPEYDGRGVLIAILDTGVDPGAPGMQITTDGKPKIVDIIDTTGSGDVNMSTVVEVK---EGSVSGLTGRTLKIPAAWVNPSGKYHIGVKNGYDFFPKALKERIQKERKEKLWDPTHRAALAEASRRTEEFDQTHTNPSQMEKLQKEELQCHVELLGMLEKKYSDPGPVYDCISWHDGVTWRAVVDTSECGD----LSSCTVLSSYRERQEFCTLGFAEMLNFSVNIYDEGNTLCIVTSGGAHGTHVASIAAGHFPDEPERNGVAPGAQILALKIGDTRLSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVITEAVQKYNVMFVSSAGNNGPCLTTVGCPGGTTSSVIGVGAYVTPDMMVAEYSL----REKLPPNQYTWSSRGPCTDGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKQNGLRPTVP-AVRRALENTAQKVEEIEVFAQGHGIIQVERAFDYLMQH 514          

HSP 2 Score: 205.297 bits (521), Expect = 7.227e-53
Identity = 146/493 (29.61%), Postives = 241/493 (48.88%), Query Frame = 3
Query: 1884 SNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESIS---SLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLN-YSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKT 3341
            +   RGI LR+   ++      + I P F E   E + ++++QL+L LVC+ASWV CP    L NQ R ++++IDP  LR                 G+++TE+  +       G L R+PITV     +S   S E   T+      +  RHFI  P GA    +++      D S +F L  + +      V     ++  F K S++    S+          T+E+ +A++W++  +  ++Y + FHGL  S   + + +S+      + S LR E++SP I+L   V PLRP   ++  +  +  +  +++L  L L Y F+ PK G V   CP L  LLYE++F  Q++ +FD N R++GSGD  P       ++Y   ++KGD+ V+L VRH   ++LERL+D    + F     L+   S  + + +    L   + N  ++  G     YIT+ P  K+ K    G ++SG+L L K+E  +K 
Sbjct:  528 AGSQRGIYLRDATHVTAPSDHGVGIEPIFPENT-ENAARISLQLHLALVCNASWVQCPSHLELMNQCRHVNVRIDPQGLRE----------------GLHYTEVCGYDTTALSAGPLFRVPITVIIPTKVSDSRSQELSFTDVHFRPGQIRRHFITVPQGASWAEISLT-SHTGDVSSKFVLHAVHL------VKQRAYRANEFYKFSSLLEKGSLTEAFPVLPGRTLELCIARWWASLGDVTIDYVISFHGLVTSPSPIHIHASEGISSFEVCSPLRYEDVSPTITLKNWVQPLRPVSSKIKPLGMRDVLPNNRQLYELVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWLLFDQNKRLMGSGDAYP-------HQYSLKLEKGDYTVRLQVRHEQQSELERLKD----LPFVVSHRLSNTLSLDVYETHRAALLAKKKANSITLSPGASQPFYITSLPDDKIPKGSGPGGFISGSLVLPKSEFGKKA 985          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Zebrafish
Match: mbtps1 (membrane-bound transcription factor peptidase, site 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4909])

HSP 1 Score: 59.3066 bits (142), Expect = 4.027e-8
Identity = 65/263 (24.71%), Postives = 116/263 (44.11%), Query Frame = 3
Query:  882 HGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSM--QPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGL------MNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            HGT VA + A    +R EC G AP +E+   ++  N  VS  +    A+     +  K D++NLS G       P   ++ ++     + + ++  S+ GNDGP   T+ +P    D++ G+  + F            DNI+  S       SRG TT    G +       +T  +G   R  GL      ++G+S++SP   G ++LL S     ++ + P  +  +   +A  +  +    QG+G L +  +++ +  Y
Sbjct:  264 HGTFVAGVIAS---MR-ECQGFAPDSELHIFRVFTNNQVSYTSWFLDAF--NYAILKKIDVLNLSIGGPDFMDHPFVDKVWEL-----TANKVIMVSAIGNDGPLYGTLNNPADQMDVI-GVGGIDFE-----------DNIARFS-------SRGMTTWELPGGYGRVKPDIVTYGSG--VRGSGLKEGCRSLSGTSVASPVVAGAVTLLASTVLN-RELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSY 493          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Zebrafish
Match: mbtps1 (membrane-bound transcription factor peptidase, site 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4909])

HSP 1 Score: 59.3066 bits (142), Expect = 4.027e-8
Identity = 65/263 (24.71%), Postives = 116/263 (44.11%), Query Frame = 3
Query:  882 HGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSM--QPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGL------MNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            HGT VA + A    +R EC G AP +E+   ++  N  VS  +    A+     +  K D++NLS G       P   ++ ++     + + ++  S+ GNDGP   T+ +P    D++ G+  + F            DNI+  S       SRG TT    G +       +T  +G   R  GL      ++G+S++SP   G ++LL S     ++ + P  +  +   +A  +  +    QG+G L +  +++ +  Y
Sbjct:  264 HGTFVAGVIAS---MR-ECQGFAPDSELHIFRVFTNNQVSYTSWFLDAF--NYAILKKIDVLNLSIGGPDFMDHPFVDKVWEL-----TANKVIMVSAIGNDGPLYGTLNNPADQMDVI-GVGGIDFE-----------DNIARFS-------SRGMTTWELPGGYGRVKPDIVTYGSG--VRGSGLKEGCRSLSGTSVASPVVAGAVTLLASTVLN-RELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSY 493          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Zebrafish
Match: mbtps1 (membrane-bound transcription factor peptidase, site 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4909])

HSP 1 Score: 54.299 bits (129), Expect = 1.396e-6
Identity = 58/216 (26.85%), Postives = 97/216 (44.91%), Query Frame = 3
Query:  882 HGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSM--QPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGL------MNGSSMSSPNACGGISLLISAAH 1505
            HGT VA + A    +R EC G AP +E+   ++  N  VS  +    A+     +  K D++NLS G       P   ++ ++     + + ++  S+ GNDGP   T+ +P    D++ G+  + F            DNI+  S       SRG TT    G +       +T  +G   R  GL      ++G+S++SP   G ++LL S ++
Sbjct:  264 HGTFVAGVIAS---MR-ECQGFAPDSELHIFRVFTNNQVSYTSWFLDAF--NYAILKKIDVLNLSIGGPDFMDHPFVDKVWEL-----TANKVIMVSAIGNDGPLYGTLNNPADQMDVI-GVGGIDFE-----------DNIARFS-------SRGMTTWELPGGYGRVKPDIVTYGSG--VRGSGLKEGCRSLSGTSVASPVVAGAVTLLASVSN 447          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Xenopus
Match: xab2 (XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-1009276])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 446/1414 (31.54%), Postives = 688/1414 (48.66%), Query Frame = 3
Query:  117 ADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEV-------IEKSYEYPIPVLDCIVFQKDD-WVAFVDTT-CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISS---LEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT--PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIV---NKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCE--IILDTEKDYSEDD----KDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHP 4283
            A++ F +   L+PK  T A  F+   P YDGR V IAI DTGVDP + G+Q TT+GKPK+I + DT+GSGDV+    ++P     +  LS R + IP  W        IG+K+  D +P A+  RL K+ KE +W      + +E   K+++ + +S       + +KE L+         EK Y  P PV DC+V+   + W A +DT+ C N    LE   +L ++ + ++F SFG    LN+ VNI++ G +L +V+  G+HGTHVASIAAGYFP  PE NG+APGA+I++IKI D RL +METG  L  A    ++ KCD++N S+GE++  PN GRIC+ + E V KH I++ SS+GN+GP L+TVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACG I+L++S         T   +  +  NTA   + I   +QG+G++Q+  +++Y                            L +N  L +KI    F V+V N                                    +RGI LR+P +++      + I P F E   E S+++++QL+L L  +ASWV  P    L NQ R I++++DP  LR                 G ++TEI  + +   + G L R+PITV     +S+    +    +      +  RHFI  P GA    +T+   S+ D S +F L  +Q+      V  +  +S  F K S++    SV       +  TIE  +A++W++ ++  ++YS+ FHGL      + + +S+   R  + S LR E++SP+ISL   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ ++D N R +GSGD  P       ++Y   ++KGD+ +++ VRH  I++LERL+D    V  +   +L+ +    I + ++   L   + N      + S  +  T  P  K+ K    G YL+GTL L K E  +K           A QSA ++    +   + +H+                 P  S P            KEK +++         E+ E L    I W+    K    D    L ++           L QL   ++ G T L   DR  ++ +I+   N +I   D   L+ ++  K      + T   K+  D+ K  L + LC  G  L +  I L +E+  +  D    +D+   I D LN  Y +V ++    D+    LPF   H+   K YGR +K   K  E++          +++  L W   A + E  +P+ +P
Sbjct:    8 AEEPFPY-HGLLPKKETGAAGFLTRYPQYDGRGVLIAILDTGVDPGAPGMQQTTDGKPKIIDIIDTTGSGDVNTSTVLEPK-DGVLVGLSGRTLKIPTRWINPSGKYHIGMKNGFDFYPKALKERLQKERKEKLWDPIHRAVLSEACKKQEEFDTNSNAQAQAGKLIKEDLQSQVEMLNSFEKKYCDPGPVYDCLVWHDGETWRACMDTSECGN----LEACIVLGNYRETQEFGSFGTAEMLNYSVNIYEEGNLLSVVTSGGAHGTHVASIAAGYFPDEPERNGVAPGAQILAIKIGDTRLSTMETGTGLIRAMIEAIKYKCDLINYSYGEATHWPNSGRICEAINEAVWKHNIIYVSSAGNNGPCLTTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSTDGALGVCISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGAIALVLSGLKDNGIQYTVHSVRRALENTAMKAENIEVFAQGHGIIQVDKAYDY----------------------------LMQNASLISKI---GFTVTVGN------------------------------------SRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSERISLQLHLALTSNASWVQYPSHLELMNQCRHINVRVDPRGLRE----------------GAHYTEICGYDVSALNSGPLFRVPITVIIPTQLSAAAECDVECKDVHFKPGQIKRHFIDVPQGATWAEVTVSSRSL-DVSSKFVLHAVQL------VKQKAYRSHEFYKFSSLPEKGSVTEAFPVLSGKTIEFCIARWWASLSDVSIDYSISFHGLSCGMPQLNIHASEGISRFDVHSALRYEDLSPSISLKNWVQTLRPVSAKTRPLGSRDILPNNRQLYEIILIYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWMMYDQNKRQMGSGDAYP-------HQYSVKLEKGDYTIRMQVRHEQISELERLKDLPFVVSHRMSNTLSLD----IYETHSMALLGKKKANSQTLPPKYSQPFFVTMLPDDKIPKGAGPGCYLAGTLTLSKTELGKK-----------AGQSAAKRQGKFKKDVISVHYHLI--------------PPSSKPKNGTKEKEKEAEKEKDVKE---------EYAEALRDLKIQWMS---KLESSDIFTDLKEAYPNHLPLYVARLHQLDSEKRKGSTKL--GDRLKRIHEILEASNDVILRIDQTALAVFLAMKTDPRPDAATI--KNDMDKQKSTLIDALCRKGCALADKLIHLQSEEGAASGDAEKKEDDQEAISDALNETYWEVVKWADLSDSKV--LPFVYKHALANKLYGRGIKFATKLVEEKPTKENWKNCIQIMKFLGWTHSASFTENWMPVMYP 1266          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Xenopus
Match: xab2 (XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-1009276])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 375/1091 (34.37%), Postives = 569/1091 (52.15%), Query Frame = 3
Query:  117 ADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEV-------IEKSYEYPIPVLDCIVFQKDD-WVAFVDTT-CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISS---LEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT--PMTKVLKTFAVGSYLSGTLYLYKNETLRKT 3341
            A++ F +   L+PK  T A  F+   P YDGR V IAI DTGVDP + G+Q TT+GKPK+I + DT+GSGDV+    ++P     +  LS R + IP  W        IG+K+  D +P A+  RL K+ KE +W      + +E   K+++ + +S       + +KE L+         EK Y  P PV DC+V+   + W A +DT+ C N    LE   +L ++ + ++F SFG    LN+ VNI++ G +L +V+  G+HGTHVASIAAGYFP  PE NG+APGA+I++IKI D RL +METG  L  A    ++ KCD++N S+GE++  PN GRIC+ + E V KH I++ SS+GN+GP L+TVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACG I+L++S         T   +  +  NTA   + I   +QG+G++Q+  +++Y                            L +N  L +KI    F V+V N                                    +RGI LR+P +++      + I P F E   E S+++++QL+L L  +ASWV  P    L NQ R I++++DP  LR                 G ++TEI  + +   + G L R+PITV     +S+    +    +      +  RHFI  P GA    +T+   S+ D S +F L  +Q+      V  +  +S  F K S++    SV       +  TIE  +A++W++ ++  ++YS+ FHGL      + + +S+   R  + S LR E++SP+ISL   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ ++D N R +GSGD  P       ++Y   ++KGD+ +++ VRH  I++LERL+D    V  +   +L+ +    I + ++   L   + N      + S  +  T  P  K+ K    G YL+GTL L K E  +K 
Sbjct:    8 AEEPFPY-HGLLPKKETGAAGFLTRYPQYDGRGVLIAILDTGVDPGAPGMQQTTDGKPKIIDIIDTTGSGDVNTSTVLEPK-DGVLVGLSGRTLKIPTRWINPSGKYHIGMKNGFDFYPKALKERLQKERKEKLWDPIHRAVLSEACKKQEEFDTNSNAQAQAGKLIKEDLQSQVEMLNSFEKKYCDPGPVYDCLVWHDGETWRACMDTSECGN----LEACIVLGNYRETQEFGSFGTAEMLNYSVNIYEEGNLLSVVTSGGAHGTHVASIAAGYFPDEPERNGVAPGAQILAIKIGDTRLSTMETGTGLIRAMIEAIKYKCDLINYSYGEATHWPNSGRICEAINEAVWKHNIIYVSSAGNNGPCLTTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSTDGALGVCISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGAIALVLSGLKDNGIQYTVHSVRRALENTAMKAENIEVFAQGHGIIQVDKAYDY----------------------------LMQNASLISKI---GFTVTVGN------------------------------------SRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSERISLQLHLALTSNASWVQYPSHLELMNQCRHINVRVDPRGLRE----------------GAHYTEICGYDVSALNSGPLFRVPITVIIPTQLSAAAECDVECKDVHFKPGQIKRHFIDVPQGATWAEVTVSSRSL-DVSSKFVLHAVQL------VKQKAYRSHEFYKFSSLPEKGSVTEAFPVLSGKTIEFCIARWWASLSDVSIDYSISFHGLSCGMPQLNIHASEGISRFDVHSALRYEDLSPSISLKNWVQTLRPVSAKTRPLGSRDILPNNRQLYEIILIYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWMMYDQNKRQMGSGDAYP-------HQYSVKLEKGDYTIRMQVRHEQISELERLKDLPFVVSHRMSNTLSLD----IYETHSMALLGKKKANSQTLPPKYSQPFFVTMLPDDKIPKGAGPGCYLAGTLTLSKTELGKKA 986          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Xenopus
Match: xab2 (XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-1009276])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 379/1108 (34.21%), Postives = 574/1108 (51.81%), Query Frame = 3
Query:  117 ADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIF-------DLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTT-CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITV-FKSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT--PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKG 3398
            A++ F +   L+PK  T A  F+   P YDGR V IAI DTGVDP + G+Q TT+GKPK+I + DT+GSGDV+    ++P     +  LS R + IP  W        IG+K+  D +P A+  RL K+ KE +W      + +E   K+++ + +S          DL++Q   E L   EK Y  P PV DC+V+   + W A +DT+ C N    LE   +L ++ + ++F SFG    LN+ VNI++ G +L +V+  G+HGTHVASIAAGYFP  PE NG+APGA+I++IKI D RL +METG  L  A    ++ KCD++N S+GE++  PN GRIC+ + E V KH I++ SS+GN+GP L+TVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACG I+L++S         T   +  +  NTA   + I   +QG+G++Q+  +++Y                            L +N  L +KI    F V+V N                                    +RGI LR+P +++      + I P F E   E S+++++QL+L L  +ASWV  P    L NQ R I++++DP  LR                 G ++TEI  + +   + G L R+PITV   + + +  +    +      +  RHFI  P GA    +T+   S+ D S +F L  +Q+      V  +  +S  F K S++    SV       +  TIE  +A++W++ ++  ++YS+ FHGL      + + +S+   R  + S LR E++SP+ISL   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ ++D N R +GSGD  P       ++Y   ++KGD+ +++ VRH  I++LERL+D    V  +   +L+ +    I + ++   L   + N      + S  +  T  P  K+ K    G YL+GTL L K E  +K       Y      S  + G
Sbjct:    5 AEEPFPY-HGLLPKKETGAAGFLTRYPQYDGRGVLIAILDTGVDPGAPGMQQTTDGKPKIIDIIDTTGSGDVNTSTVLEPK-DGVLVGLSGRTLKIPTRWINPSGKYHIGMKNGFDFYPKALKERLQKERKEKLWDPIHRAVLSEACKKQEEFDTNSNAQAGKLIKEDLQSQV--EMLNSFEKKYCDPGPVYDCLVWHDGETWRACMDTSECGN----LEACIVLGNYRETQEFGSFGTAEMLNYSVNIYEEGNLLSVVTSGGAHGTHVASIAAGYFPDEPERNGVAPGAQILAIKIGDTRLSTMETGTGLIRAMIEAIKYKCDLINYSYGEATHWPNSGRICEAINEAVWKHNIIYVSSAGNNGPCLTTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSTDGALGVCISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGAIALVLSGLKDNGIQYTVHSVRRALENTAMKAENIEVFAQGHGIIQVDKAYDY----------------------------LMQNASLISKI---GFTVTVGN------------------------------------SRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSERISLQLHLALTSNASWVQYPSHLELMNQCRHINVRVDPRGLRE----------------GAHYTEICGYDVSALNSGPLFRVPITVIIPTHAAAECDVECKDVHFKPGQIKRHFIDVPQGATWAEVTVSSRSL-DVSSKFVLHAVQL------VKQKAYRSHEFYKFSSLPEKGSVTEAFPVLSGKTIEFCIARWWASLSDVSIDYSISFHGLSCGMPQLNIHASEGISRFDVHSALRYEDLSPSISLKNWVQTLRPVSAKTRPLGSRDILPNNRQLYEIILIYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWMMYDQNKRQMGSGDAYP-------HQYSVKLEKGDYTIRMQVRHEQISELERLKDLPFVVSHRMSNTLSLD----IYETHSMALLGKKKANSQTLPPKYSQPFFVTMLPDDKIPKGAGPGCYLAGTLTLSKTELGKKADVISVHYHLIPPSSKPKNG 998          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Xenopus
Match: xab2 (XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-1009276])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 378/1110 (34.05%), Postives = 573/1110 (51.62%), Query Frame = 3
Query:  117 ADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEV-------IEKSYEYPIPVLDCIVFQKDD-WVAFVDTT-CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISS---LEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT--PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKG 3398
            A++ F +   L+PK  T A  F+   P YDGR V IAI DTGVDP + G+Q TT+GKPK+I + DT+GSGDV+    ++P     +  LS R + IP  W        IG+K+  D +P A+  RL K+ KE +W      + +E   K+++ + +S       + +KE L+         EK Y  P PV DC+V+   + W A +DT+ C N    LE   +L ++ + ++F SFG    LN+ VNI++ G +L +V+  G+HGTHVASIAAGYFP  PE NG+APGA+I++IKI D RL +METG  L  A    ++ KCD++N S+GE++  PN GRIC+ + E V KH I++ SS+GN+GP L+TVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACG I+L++S         T   +  +  NTA   + I   +QG+G++Q+  +++Y                            L +N  L +KI    F V+V N                                    +RGI LR+P +++      + I P F E   E S+++++QL+L L  +ASWV  P    L NQ R I++++DP  LR                 G ++TEI  + +   + G L R+PITV     +S+    +    +      +  RHFI  P GA    +T+   S+ D S +F L  +Q+      V  +  +S  F K S++    SV       +  TIE  +A++W++ ++  ++YS+ FHGL      + + +S+   R  + S LR E++SP+ISL   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ ++D N R +GSGD  P       ++Y   ++KGD+ +++ VRH  I++LERL+D    V  +   +L+ +    I + ++   L   + N      + S  +  T  P  K+ K    G YL+GTL L K E  +K       Y      S  + G
Sbjct:    8 AEEPFPY-HGLLPKKETGAAGFLTRYPQYDGRGVLIAILDTGVDPGAPGMQQTTDGKPKIIDIIDTTGSGDVNTSTVLEPK-DGVLVGLSGRTLKIPTRWINPSGKYHIGMKNGFDFYPKALKERLQKERKEKLWDPIHRAVLSEACKKQEEFDTNSNAQAQAGKLIKEDLQSQVEMLNSFEKKYCDPGPVYDCLVWHDGETWRACMDTSECGN----LEACIVLGNYRETQEFGSFGTAEMLNYSVNIYEEGNLLSVVTSGGAHGTHVASIAAGYFPDEPERNGVAPGAQILAIKIGDTRLSTMETGTGLIRAMIEAIKYKCDLINYSYGEATHWPNSGRICEAINEAVWKHNIIYVSSAGNNGPCLTTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSTDGALGVCISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGAIALVLSGLKDNGIQYTVHSVRRALENTAMKAENIEVFAQGHGIIQVDKAYDY----------------------------LMQNASLISKI---GFTVTVGN------------------------------------SRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSERISLQLHLALTSNASWVQYPSHLELMNQCRHINVRVDPRGLRE----------------GAHYTEICGYDVSALNSGPLFRVPITVIIPTQLSAAAECDVECKDVHFKPGQIKRHFIDVPQGATWAEVTVSSRSL-DVSSKFVLHAVQL------VKQKAYRSHEFYKFSSLPEKGSVTEAFPVLSGKTIEFCIARWWASLSDVSIDYSISFHGLSCGMPQLNIHASEGISRFDVHSALRYEDLSPSISLKNWVQTLRPVSAKTRPLGSRDILPNNRQLYEIILIYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWMMYDQNKRQMGSGDAYP-------HQYSVKLEKGDYTIRMQVRHEQISELERLKDLPFVVSHRMSNTLSLD----IYETHSMALLGKKKANSQTLPPKYSQPFFVTMLPDDKIPKGAGPGCYLAGTLTLSKTELGKKADVISVHYHLIPPSSKPKNG 1005          

HSP 2 Score: 53.9138 bits (128), Expect = 2.676e-6
Identity = 52/198 (26.26%), Postives = 87/198 (43.94%), Query Frame = 3
Query: 3717 LAQLRLLQKNGLTDLRPEDRWSKVDDIV---NKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCE--IILDTEKDYSEDD----KDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHP 4283
            L QL   ++ G T L   DR  ++ +I+   N +I   D   L+ ++  K      + T   K+  D+ K  L + LC  G  L +  I L +E+  +  D    +D+   I D LN  Y +V ++    D+    LPF   H+   K YGR +K   K  E++          +++  L W   A + E  +P+ +P
Sbjct: 1062 LHQLDSEKRKGSTKLG--DRLKRIHEILEASNDVILRIDQTALAVFLAMKTDPRPDAATI--KNDMDKQKSTLIDALCRKGCALADKLIHLQSEEGAASGDAEKKEDDQEAISDALNETYWEVVKWADLSDSKV--LPFVYKHALANKLYGRGIKFATKLVEEKPTKENWKNCIQIMKFLGWTHSASFTENWMPVMYP 1253          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Xenopus
Match: xab2 (XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-1009276])

HSP 1 Score: 566.614 bits (1459), Expect = 1.593e-178
Identity = 374/1094 (34.19%), Postives = 567/1094 (51.83%), Query Frame = 3
Query:  117 ADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHS---TIF----------DLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTT-CLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT--PMTKVLKTFAVGSYLSGTLYLYKNETLRKT 3341
            A++ F +   L+PK  T A  F+   P YDGR V IAI DTGVDP + G+Q TT+GKPK+I + DT+GSGDV+    ++P     +  LS R + IP  W        IG+K+  D +P A+  RL K+ KE +W      + +E   K+++ + +S   TI+          DL++Q   E L   EK Y  P PV DC+V+   + W A +DT+ C N    LE   +L ++ + ++F SFG    LN+ VNI++ G +L +V+  G+HGTHVASIAAGYFP  PE NG+APGA+I++IKI D RL +METG  L  A    ++ KCD++N S+GE++  PN GRIC+ + E V KH I++ SS+GN+GP L+TVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACG I+L++S         T   +  +  NTA   + I   +QG+G++Q+  +++Y                            L +N  L +KI    F V+V N                                    +RGI LR+P +++      + I P F E   E S+++++QL+L L  +ASWV  P    L NQ R I++++DP  LR                 G ++TEI  +      + AL   P  +    + +  +    +      +  RHFI  P GA    +T+   S+ D S +F L  +Q+      V  +  +S  F K S++    SV       +  TIE  +A++W++ ++  ++YS+ FHGL      + + +S+   R  + S LR E++SP+ISL   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ ++D N R +GSGD  P       ++Y   ++KGD+ +++ VRH  I++LERL+D    V  +   +L+ +    I + ++   L   + N      + S  +  T  P  K+ K    G YL+GTL L K E  +K 
Sbjct:    6 AEEPFPY-HGLLPKKETGAAGFLTRYPQYDGRGVLIAILDTGVDPGAPGMQQTTDGKPKIIDIIDTTGSGDVNTSTVLEPK-DGVLVGLSGRTLKIPTRWINPSGKYHIGMKNGFDFYPKALKERLQKERKEKLWDPIHRAVLSEACKKQEEFDTNSNAQTIYLLKAGKLIKEDLQSQV--EMLNSFEKKYCDPGPVYDCLVWHDGETWRACMDTSECGN----LEACIVLGNYRETQEFGSFGTAEMLNYSVNIYEEGNLLSVVTSGGAHGTHVASIAAGYFPDEPERNGVAPGAQILAIKIGDTRLSTMETGTGLIRAMIEAIKYKCDLINYSYGEATHWPNSGRICEAINEAVWKHNIIYVSSAGNNGPCLTTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLR----EKLPANQYTWSSRGPSTDGALGVCISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGAIALVLSGLKDNGIQYTVHSVRRALENTAMKAENIEVFAQGHGIIQVDKAYDY----------------------------LMQNASLISKI---GFTVTVGN------------------------------------SRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSERISLQLHLALTSNASWVQYPSHLELMNQCRHINVRVDPRGLRE----------------GAHYTEICGY-----DVSALNSGPFILKLHFAAAECDVECKDVHFKPGQIKRHFIDVPQGATWAEVTVSSRSL-DVSSKFVLHAVQL------VKQKAYRSHEFYKFSSLPEKGSVTEAFPVLSGKTIEFCIARWWASLSDVSIDYSISFHGLSCGMPQLNIHASEGISRFDVHSALRYEDLSPSISLKNWVQTLRPVSAKTRPLGSRDILPNNRQLYEIILIYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWMMYDQNKRQMGSGDAYP-------HQYSVKLEKGDYTIRMQVRHEQISELERLKDLPFVVSHRMSNTLSLD----IYETHSMALLGKKKANSQTLPPKYSQPFFVTMLPDDKIPKGAGPGCYLAGTLTLSKTELGKKA 980          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Mouse
Match: Tpp2 (tripeptidyl peptidase II [Source:MGI Symbol;Acc:MGI:102724])

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 437/1416 (30.86%), Postives = 682/1416 (48.16%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIG---KGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNC------SEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHP 4283
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK+I + DT+GSGDV+   EV+P    +I  LS R + IP +W        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A VD+   N N  L    +L ++ + ++++SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH  ++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +N++    F V+V N                                    NRGI LR+P +++      + I P F E   E S++++ QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHF+  P GA    +T+   S  + S +F L  +Q+      V     +S  F K  ++    ++           IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y+F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ L+RL+D    V  +   +L+ +  +     N++  L   + + S+    K  +     + P  K+ K    G YL+G+L L K E  +K           A QSA ++    +   +P+H+      YL             +P     + + +  KEK  E   +    K EF E L    I W+     K D   I   +K    +   +   L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+        D            + L+  Y +  ++   +D     L F   H+ V K YGR LK   K  E++          +++  L W   A + E  +P+ +P
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPK-DGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDS---NENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNTIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVRRALENTAIKADNIEVFAQGHGIIQVDKAYDY----------------------------LIQNTSFANRL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISFQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFVEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQL------VKQRAYRSHEFYKFCSLPEKGTLIEAFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLDRLKDLPFIVSHRLSNTLSLDIHE-----NHSLALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKK-----------AGQSAAKRQGKFKKDVIPVHY------YL-------------IP-PPTKIKNGSKDKEKDSEKEKDL---KEEFTEALRDLKIQWM----TKLDSTDIYNELK----ETYPAYLPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAAT--IKNDMDKQKSTLIDALCRKGCALADHLLHTQPHDGAAAGDAEAKEEEGESTMESLSETYWETTKWTDLFDTKV--LIFAYKHALVNKMYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYP 1256          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Mouse
Match: Tpp2 (tripeptidyl peptidase II [Source:MGI Symbol;Acc:MGI:102724])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 411/1310 (31.37%), Postives = 635/1310 (48.47%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIG---KGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTE 3983
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK+I + DT+GSGDV+   EV+P    +I  LS R + IP +W        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A VD+   N N  L    +L ++ + ++++SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH  ++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +N++    F V+V N                                    NRGI LR+P +++      + I P F E   E S++++ QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHF+  P GA    +T+   S  + S +F L  +Q+      V     +S  F K  ++    ++           IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y+F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ L+RL+D    V  +   +L+ +  +     N++  L   + + S+    K  +     + P  K+ K    G YL+G+L L K E  +K    P  Y      +  + G                     ++D  ++S                  KEK L         K EF E L    I W+     K D   I   +K    +   +   L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPK-DGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDS---NENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNTIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLR----EKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVRRALENTAIKADNIEVFAQGHGIIQVDKAYDY----------------------------LIQNTSFANRL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISFQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFVEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQL------VKQRAYRSHEFYKFCSLPEKGTLIEAFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLDRLKDLPFIVSHRLSNTLSLDIHE-----NHSLALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKIKNG---------------------SKDKEKDS-----------------EKEKDL---------KEEFTEALRDLKIQWM----TKLDSTDIYNELK----ETYPAYLPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATI--KNDMDKQKSTLIDALCRKGCALADHLLHTQ 1139          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Mouse
Match: Tpp2 (tripeptidyl peptidase II [Source:MGI Symbol;Acc:MGI:102724])

HSP 1 Score: 552.362 bits (1422), Expect = 7.372e-177
Identity = 339/981 (34.56%), Postives = 511/981 (52.09%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRK 3005
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK+I + DT+GSGDV+   EV+P    +I  LS R + IP +W        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A VD+   N N  L    +L ++ + ++++SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH  ++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +N++    F V+V N                                    NRGI LR+P +++      + I P F E   E S++++ QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHF+  P GA    +T+   S  + S +F L  +Q+      V     +S  F K  ++    ++           IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y+F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P    R +
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPK-DGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDS---NENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNTIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLR----EKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVRRALENTAIKADNIEVFAQGHGIIQVDKAYDY----------------------------LIQNTSFANRL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISFQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFVEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQL------VKQRAYRSHEFYKFCSLPEKGTLIEAFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQERRNQ 881          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Mouse
Match: Tpp2 (tripeptidyl peptidase II [Source:MGI Symbol;Acc:MGI:102724])

HSP 1 Score: 416.772 bits (1070), Expect = 1.145e-129
Identity = 224/519 (43.16%), Postives = 312/519 (60.12%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYI 1637
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK+I + DT+GSGDV+   EV+P    +I  LS R + IP +W        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A VD+   N N  L    +L ++ + ++++SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH  ++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y+
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPK-DGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDS---NENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNTIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLR----EKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVRRALENTAIKADNIEVFAQGHGIIQVDKAYDYL 511          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Mouse
Match: Tpp2 (tripeptidyl peptidase II [Source:MGI Symbol;Acc:MGI:102724])

HSP 1 Score: 80.4925 bits (197), Expect = 3.607e-16
Identity = 55/184 (29.89%), Postives = 90/184 (48.91%), Query Frame = 3
Query: 1893 NRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESI---SSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQV 2435
            NRGI LR+P +++      + I P F E   E S++++ QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  +   S  +   T+      +  RHF+  P GA    +T+   S  + S +F L  +Q+
Sbjct:   39 NRGIYLRDPVQVAAPSDHGVGIEPVFPENT-ENSEKISFQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIRRHFVEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQL 204          
BLAST of Tripeptidyl peptidase 2 vs. UniProt/SwissProt
Match: sp|Q64514|TPP2_MOUSE (Tripeptidyl-peptidase 2 OS=Mus musculus OX=10090 GN=Tpp2 PE=1 SV=3)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 437/1416 (30.86%), Postives = 682/1416 (48.16%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIG---KGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNC------SEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHP 4283
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK+I + DT+GSGDV+   EV+P    +I  LS R + IP +W        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A VD+   N N  L    +L ++ + ++++SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH  ++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +N++    F V+V N                                    NRGI LR+P +++      + I P F E   E S++++ QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHF+  P GA    +T+   S  + S +F L  +Q+      V     +S  F K  ++    ++           IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y+F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ L+RL+D    V  +   +L+ +  +     N++  L   + + S+    K  +     + P  K+ K    G YL+G+L L K E  +K           A QSA ++    +   +P+H+      YL             +P     + + +  KEK  E   +    K EF E L    I W+     K D   I   +K    +   +   L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+        D            + L+  Y +  ++   +D     L F   H+ V K YGR LK   K  E++          +++  L W   A + E  +P+ +P
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPK-DGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDS---NENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNTIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVRRALENTAIKADNIEVFAQGHGIIQVDKAYDY----------------------------LIQNTSFANRL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISFQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFVEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQL------VKQRAYRSHEFYKFCSLPEKGTLIEAFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLDRLKDLPFIVSHRLSNTLSLDIHE-----NHSLALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKK-----------AGQSAAKRQGKFKKDVIPVHY------YL-------------IP-PPTKIKNGSKDKEKDSEKEKDL---KEEFTEALRDLKIQWM----TKLDSTDIYNELK----ETYPAYLPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAAT--IKNDMDKQKSTLIDALCRKGCALADHLLHTQPHDGAAAGDAEAKEEEGESTMESLSETYWETTKWTDLFDTKV--LIFAYKHALVNKMYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYP 1256          
BLAST of Tripeptidyl peptidase 2 vs. UniProt/SwissProt
Match: sp|P29144|TPP2_HUMAN (Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 417/1308 (31.88%), Postives = 640/1308 (48.93%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTE 3983
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ LERL+D    V  +   +L+ +  ++       KK ++   N ++        ++T+ P  K+ K    G YL+G+L L K E  +K    P  Y      + T+ G                     ++D  ++S                  KEK L         K EF E L    I W+     K D   I   +K    +       L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSS---NLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNG---------------------SKDKEKDS-----------------EKEKDL---------KEEFTEALRDLKIQWM----TKLDSSDIYNELKETYPNY----LPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATI--KNDMDKQKSTLVDALCRKGCALADHLLHTQ 1139          
BLAST of Tripeptidyl peptidase 2 vs. UniProt/SwissProt
Match: sp|Q64560|TPP2_RAT (Tripeptidyl-peptidase 2 OS=Rattus norvegicus OX=10116 GN=Tpp2 PE=2 SV=3)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 378/1139 (33.19%), Postives = 581/1139 (51.01%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIG---KGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKG------ENSQHFKLPLHFTECLMN 3452
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK+I + DT+GSGDV+   EV+P    +IT LS R + IP +W        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q + +   E Q   E L   EK Y  P PV DC+V+   + W A VD+   N N  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH  ++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +N++    F V+V N                                    NRGI LR+P +++      + I P F E   E S++++ QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHF+  P GA    +T+   S  + S +F L  +Q+      V     +S  F K  ++    ++           IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y+F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ L+RL+D    V  +   +L+ +  +     N++  L   + + S+    K  +     + P  K+ K    G YL+G+L L K E  +K    P  Y      + T+ G      ++ +   L   FTE L +
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPK-DGEITGLSGRVLKIPANWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDS---NENGDLGKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNTIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANNVDYTVHSVRRALENTAIKADNIEVFAQGHGIIQVDKAYDY----------------------------LIQNTSFANRL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISFQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFVEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQL------VKQRAYRSHEFYKFCSLPEKGTLIEAFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLDRLKDLPFIVSHRLSNTLSLDIHE-----NHSLALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEEFTEALRD 1027          
BLAST of Tripeptidyl peptidase 2 vs. UniProt/SwissProt
Match: sp|A5PK39|TPP2_BOVIN (Tripeptidyl-peptidase 2 OS=Bos taurus OX=9913 GN=TPP2 PE=2 SV=1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 379/1136 (33.36%), Postives = 587/1136 (51.67%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKK-------PNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIV-FQKDDWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESI---SSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKG------ENSQHFKLPLHFTECLMN 3452
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK+I + DT+GSGDV+    V+P    +I  LS R + IP +W        IG+K+  D +P A+  R+ K+ KE IW        AE   K+++       P+Q + +   E     E L   EK Y  P PV DC+V F  + W A +D++    +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ V+APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V        TN G                             I LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R ++I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  +   +  +   T+      +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + SS+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ ++L +RH  I+ LERL+D    V  +   +L+ +  ++       KK ++   N ++        ++T+ P  K+ K    G YL+G+L L K E  +K    P  Y   +  + T+ G      ++ +   L   FTE L +
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGAAAFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATVVEPK-DGEIVGLSGRVLKIPVTWTNPSGRYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRAALAEACRKQEEFDVANNCPSQANKLIKEELHSQVELLNSFEKKYSDPGPVYDCLVWFDGETWRACIDSS---EDGDLSKSTVLRNYKEAQEYGSFGAAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLR----EKLPANQYTWSSRGPSADGALGVSVSAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANDVNYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVG-------TNRG-----------------------------IYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHVNIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESTHYDLALTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTVSFHGIVCTAPQLNIHSSEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPLSAKTKPLGSRDVLPNNRQLYEMILTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTIRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHENHSLALLGKKKSS---NLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLTGSLTLSKTELGKKADVIPVHYYLISPPTKTKNGSKDKEKDSEKEKDLKEEFTEALRD 1027          
BLAST of Tripeptidyl peptidase 2 vs. UniProt/SwissProt
Match: sp|F4JVN6|TPPII_ARATH (Tripeptidyl-peptidase 2 OS=Arabidopsis thaliana OX=3702 GN=TPP2 PE=1 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 6.818e-122
Identity = 313/1123 (27.87%), Postives = 535/1123 (47.64%), Query Frame = 3
Query:  135 FVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLE----VIEKS---YEYPIPVLDCIVFQKDD-WVAFVDTTCL--NPNM-KLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSL---PVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYI--GRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISS----LEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSA---TNEAEL-EYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI---KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITTPMT-KVLKTFAVGSYLSGTLYLYK---NETLRKT-----VSYPFQYIFTAHQSATEK 3395
            F+ SL+PK   +A  FI+ +P YDGR V IAI+D+G DP++ GL +T++GKPK++ + D +GSGD+     VK +    I   S   +++  SW       R+G K    +F   + SR+ K+ +++   K    +   + N      +HS + D + +  +E L+     ++K    YE   PV+D +V+   + W   +DT  L  +P+  KL D   L ++   R++  F      +F  N++D GK+L IV+ S  HGTHVA IA  + P     NG+APGA+I+S KI D+RL SMETG  L  A    +E  CD+VN+S+GE ++ P+ GR   ++ E V+K  ++F SS+GN GPAL+TVG+PGGTT  + G+   V P M    +S+   P + +       YTW+SRGPT+DG LG+ ++APG A+  V  W  +   LMNG+SM+SP+ACG I+LL+SA      P++P+ +  +  NT++ +  +   +L+ G GL+Q+  ++EY++++           Q    VF                     + + V      + T+ G +L       Q+     ++      G   +    PFE   + + T       +E ++ + D      YL L                N  R  ++ +DPT L               GD G+++ E+     +    G L R+P+T+   +++++    + +   +  +   +  R +I  PHGA     T++  S  D + RF +  +QV P    +         +E         + +++    +  T+E+A+AQ+WS+   + E  + ++ ++FHG+ +  E + +  S+   ++  E+ L  E++ P   LN + +P +P   +L  +   +  +   K+++ L L Y F       V  + P L N +Y+  F  Q + I D+N R+   GD  PE +          + KG++K+QL +RH ++  LE+L+   + +     +      S+       N    ++ L      G K   Y+  P   K+ K    GS L G +   K   +E   K      VSYP  Y+   ++   +K
Sbjct:  112 FIASLMPKKEIRADCFIEAHPEYDGRGVVIAIFDSGFDPSAAGLHVTSDGKPKVLDVIDCTGSGDIDTSTVVKANEDGHIRGASGATLVVNSSWKNPTGEWRVGSKLVYQLFTDDLTSRVKKERRKSWDEKNQEEIAKAVNNLYDFDQKHSKVEDAKLKKTREDLQSKVDFLKKQADKYEDKGPVIDAVVWHDGEVWRVALDTQSLEEDPDSGKLADFSPLTNYRIERKYGVFSRLDACSFVANVYDEGKVLSIVTDSSPHGTHVAGIATAHHPEEHLLNGVAPGAQIISCKIGDSRLGSMETGTGLTRALIAALEHNCDLVNMSYGEPALLPDYGRFVDLVTEAVNKRRLIFVSSAGNSGPALTTVGAPGGTTSSIIGVGAYVSPAMAAGAHSVVEPPSEGLE------YTWSSRGPTSDGDLGVCISAPGGAVAPVPTWTLQRRMLMNGTSMASPSACGAIALLLSAMKAEGIPVSPYSVRRALENTSTPVGDLPEDKLTTGQGLMQVDKAYEYLKQF-----------QDYPCVF---------------------YQIKVNLSGKTIPTSRGIYLREGTACRQSTEWTIQVDPKFHEGASNLKELVPFEECLELHST-------DEGVVRVPD------YLLLT---------------NNGRGFNVVVDPTNL---------------GD-GVHYFEVYGIDCKAPERGPLFRIPVTIIIPKTVANQPPVISFQQMSFISGHIE--RRYIEVPHGATWAEATMR-TSGFDTTRRFYIDTLQVCPLRRPIK--------WESAPTFASPSAKSFVFPVVSGQTMELAIAQFWSSGLGSREPTIVDFEIEFHGVGVDKEELLLDGSEAPIKVEAEALLASEKLVPIAVLNKIRVPYQPIDAQLKTLSTGRDRLLSGKQILALTLTYKFKLEDSAEVKPYIPLLNNRIYDTKFESQFFMISDTNKRVYAMGDVYPESSK---------LPKGEYKLQLYLRHENVELLEKLKQLTVFIERNMGEIRLNLHSEPDGPFTGNGAFKSSVLM----PGVKEAFYLGPPTKDKLPKNTPQGSMLVGEISYGKLSFDEKEGKNPKDNPVSYPISYVVPPNKPEEDK 1128          
BLAST of Tripeptidyl peptidase 2 vs. TrEMBL
Match: A0A2K6SC96 (Tripeptidyl peptidase 2 OS=Saimiri boliviensis boliviensis OX=39432 GN=TPP2 PE=4 SV=1)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 446/1416 (31.50%), Postives = 687/1416 (48.52%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIG---KGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKD------YSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHP 4283
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q S +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ V+L +RH  I+ LERL+D    V  +   +L+ +  +     N++  L   + + S+    K  +     + P  K+ K    G YL+G+L L K E  +K           A QSA ++    +   +P+H+      YL             +P       +    KEK LE   +    K EF E L    I W+     K D   I   +K    +       L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+         +E  ++      D L   + +  ++   +DN    L F   H+ V K YGR LK   K  E++          +++  L W   A + E  +P+ +P
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQASKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVSSKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTVRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHE-----NHSFALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKK-----------AGQSAAKRQGKFKKDVIPVHY------YL-------------IP-PPTKTKNGNKDKEKDLEKEKDL---KEEFTEALRDLKIQWM----TKLDSSDIYNELKETYPNY----LPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATI--KNDMDKQKSTLVDALCRKGCALADHLLHTQAQDGAVSTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKV--LTFAYKHALVNKMYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYP 1256          
BLAST of Tripeptidyl peptidase 2 vs. TrEMBL
Match: F7BYW8 (Tripeptidyl peptidase 2 OS=Callithrix jacchus OX=9483 GN=TPP2 PE=4 SV=2)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 446/1416 (31.50%), Postives = 689/1416 (48.66%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIG---KGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKD------YSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHP 4283
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q S +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ V+L +RH  I+ LERL+D    V  +   +L+ +  +     N++  L   + + S+    K  +     + P  K+ K    G YL+G+L L K E  +K           A QSA ++    +   +P+H+      YL       + P ++         +    KEK LE   +    K EF E L    I W+     K D   I   +K    +       L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+         +E  ++      D L   + +  ++   +DN    L F   H+ V K YGR LK   K  E++          +++  L W   A + E  +P+ +P
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVALSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQASKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNVDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFTNKL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTVRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHE-----NHSFALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKK-----------AGQSAAKRQGKFKKDVIPVHY------YL------ISPPTKT--------KNGNKDKEKDLEKEKDL---KEEFTEALRDLKIQWM----TKLDSSDIYNELKETYPNY----LPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATI--KNDMDKQKSTLVDALCRKGCALADHLLHTQAQDGAVSTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKV--LTFAYKHALVNKMYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYP 1256          
BLAST of Tripeptidyl peptidase 2 vs. TrEMBL
Match: A0A2K5Q6E2 (Tripeptidyl peptidase 2 OS=Cebus capucinus imitator OX=1737458 GN=TPP2 PE=4 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 446/1416 (31.50%), Postives = 687/1416 (48.52%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIG---KGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKD------YSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHP 4283
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+GKPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q S +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   +   +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ V+L +RH  I+ LERL+D    V  +   +L+ +  +     N++  L   + + S+    K  +     + P  K+ K    G YL+G+L L K E  +K           A QSA ++    +   +P+H+      YL             +P       +    KEK LE   +    K EF E L    I W+     K D   I   +K    +       L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+         +E  ++      D L   + +  ++   +DN    L F   H+ V K YGR LK   K  E++          +++  L W   A + E  +P+ +P
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQASKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVGN------------------------------------NRGIYLRDPVQVAAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTVRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHE-----NHSFALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKK-----------AGQSAAKRQGKFKKDVIPVHY------YL-------------IP-PPTKTKNGNKDKEKDLEKEKDL---KEEFTEALRDLKIQWM----TKLDSSDIYNELKETYPNY----LPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATI--KNDMDKQKSTLVDALCRKGCALADHLLHTQAQDGAISTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKV--LTFAYKHALVNKMYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYP 1256          
BLAST of Tripeptidyl peptidase 2 vs. TrEMBL
Match: R7TP14 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228048 PE=4 SV=1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 445/1422 (31.29%), Postives = 697/1422 (49.02%), Query Frame = 3
Query:  132 YFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHM--LKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNK-------KKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEIS-----DQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLE---WHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPN--FSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSS--TIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDE---LTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARL--NYSIGKGEKSVLYITTPMT--KVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIF--TAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSI-EKLIKSINGDKSNSDFELAQLRLL--QKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHPISCQ 4295
            + V  L+PK  T A  F+ + P++DG+ V IA+ DTGVDP + GL++T++G+PK+I + D +GSGDV    + EVK     +IT L+ R + IP  W+       IGVK+A D++P  +  R+ K+ +E +W +      A ++ +         +PNQ   +   +     E L  +EK Y    PV DC+VF     W A +DT+       L + P +  F + RQ+ +      LN+  NI++ GK LE+VS +GSHGTHVA IAAG FP  PE NG+APGA++V+IKI D+RL SMETG AL  A    +  KCD+VN S+GE S  PN GR+C ++ E V KHG++F SS+GN+GPALSTVG+PGGTT  + G+   V P+M+ + YSL       L   +YTW+SRGPT DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACG ++L++SA      P TP+ +  +  NTA  +  +   + G+GL+Q++ +F+Y+                                              V N   P L         NF+        F + C  +NG RGI LRE  ++ Q +   +++ P F +  +E S     +++   +   L C A +V+ P    L N  R+ S+++DP  L               GD+  Y     F   + +  G L RLPIT+   E I  +E     ++N      +  RHFI  P  A   ++ +K  ++ D +  F ++ +Q+ P   F T   E            +T++E    + +   +   T+E+ +A++W+   +  ++Y + FHGL+    SV M ++D   RL ++S L+ E+ISP ISL   V P+RP + +   L  ++ ++  ++    +EL Y F+ PKPG + + C  L NLLYE++F  Q+  +FDSN + + + D  P       N+Y   +++GDF  +L VRH     LE+L+D  + V  K   S++ +     +  N+   L A R    +++ KG+   L++  P+   K+ K  A G YLSGT+   K+E  +K   Y F+YI   +A++S T+        K P  +T                      L D +  S +    K  +          EF E +    ISWI    K  D  S+ ++L +  +    +    +A L  L   KN L  L+      +V      +I+  D++ L  Y+G K    S + T   K + ++ K  L +     G    + + + +K    D+ D      ++L+   +++ ++V   D  A  L   + H+ V K YGR LK L K  ED+          E+   L W    Q+ E  +PLK+P + Q
Sbjct:    9 FPVFGLLPKKETGAWSFVGKYPDHDGKGVTIAVLDTGVDPGAPGLKVTSDGRPKIIDIIDATGSGDVDTSSVVEVK---DGQITGLTGRTLKIPTDWSNPSGQYHIGVKAAQDLYPKGLKDRMVKERREKLWDRAHRATAANVMQQCSEFDAAHPEPNQEEKLIKEDLMAQAEILLSLEKKYADCCPVYDCVVFHDGQTWRACLDTS---ERGDLAECPCMAPFREERQYATLSQDDMLNYSFNIYNEGKTLEVVSNAGSHGTHVACIAAGCFPDEPEKNGVAPGAQVVAIKIGDSRLGSMETGAALTRAMIYVMNNKCDLVNYSYGEGSHIPNVGRVCDVLSEAVVKHGVIFVSSAGNNGPALSTVGAPGGTTSSIIGVGAYVSPEMMAAEYSL----RERLPGNLYTWSSRGPTQDGALGVCISAPGGAIASVPNWTLRGSQLMNGTSMSSPNACGCVALILSAMKAKALPYTPFSVRQALENTALKVNSLDHFALGHGLVQVEKAFDYL----------------------------------------------VANADAPEL---------NFR--------FDVTC--ANGARGIYLREAHQVQQPKVVNVSVEPVFKDSNLEHSLEGQQEKIEFSMQFSLTCDAPYVSLPSHLQLMNMSRTFSVKVDPRGL-------------SPGDH--YAEVCGFDSNDVTR-GPLFRLPITILIPEKIMDVEACRMSYSNVSFKPGQIQRHFIEVPQEASWAVLRLKSKTL-DSASHFIIQTIQLVPKSVFKTAQYEKF----------LTLSELATSLHSFPVNGGITLEVVIARWWANLGDVSVDYDITFHGLQPDNRSVNMHAADGVLRLNVKSGLKSEDISPVISLKNHVQPVRPSESKVRCLNQVRDTLPHNRPTYAIELTYNFSRPKPGEIVLDCSLLSNLLYESEFESQLCLLFDSNKQYLAASDAFP-------NQYNIKVERGDFTAKLQVRHEKKEYLEKLKDLPLSVIHKLPSSISLD-----IHSNHTHALVAGRKYPAHTVIKGQTCPLFV-APLADEKIPKGVAAGHYLSGTISFAKDEDGKKAGCYVFKYILGPSANRSKTKD-------KYPFKYT----------------------LTDTAKKSKSGNGGKEEKKEKNKEE---EFAEAMRDLKISWIS---KLDDGSSLYDELCQDFD---QHLPLHVAYLHSLDTDKNRLQKLK------EVIAAAKTVISKIDSQALLLYLGMKTDTRSDAATI--KIEMEKQKTSLIDAYVRLGCAQADGLQEYQKG---DNVDWPGTNLEELDVTVAEMQKWVDLNDTKA--LQLSLRHALVHKQYGRALKFLYKQIEDKPSKDLDKRAIELFQCLRWTHCQQHLENWLPLKYPAAFQ 1264          
BLAST of Tripeptidyl peptidase 2 vs. TrEMBL
Match: A0A2K5BX19 (Tripeptidyl peptidase 2 OS=Aotus nancymaae OX=37293 GN=TPP2 PE=4 SV=1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 446/1416 (31.50%), Postives = 686/1416 (48.45%), Query Frame = 3
Query:  105 SSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFT----AKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPY--KDELTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIG---KGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKD------YSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHP 4283
            ++   ++ F F   L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q+TT+ KPK++ + DT+GSGDV+   EV+P    +I  LS R + IP SW        IG+K+  D +P A+  R+ K+ KE IW         E  R   E        +Q S +   E Q   E L   EK Y  P PV DC+V+   + W A +D+   N +  L    +L ++ + +++ SFG    LN+ VNI+D+G +L IV+  G+HGTHVASIAAG+FP  PE NG+APGA+I+SIKI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH I++ SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L    YTW+SRGP+ DG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S         T   +  +  NTA     I   +QG+G++Q+  +++Y                            L +N   +NK+    F V+V N                                    NRGI LR+P +++      + I P F E   E S+++++QL+L L  ++SWV CP    L NQ R I+I++DP  LR                 G+++TE+  + +   + G L R+PIT   +  ++    H+   FT       +  RHFI  P GA    +T+   S  + S +F L  +Q+    +  + E  K  S  +K  +T     A+ + G     IE  +A++W++ ++  ++Y++ FHG+  +   + + +S+   R  ++S L+ E+++P I+L   V  LRP   K +    +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ IFD N R +GSGD  P       ++Y   ++KGD+ V+L +RH  I+ LERL+D    V  +   +L+ +  +     N++  L   + + S+    K  +     + P  K+ K    G YL+G+L L K E  +K           A QSA ++    +   +P+H+      YL             +P       +    KEK LE   +    K EF E L    I W+     K D   I   +K    +       L   RL Q +   +     R +++ D  N +I+  D   L+ Y+  K      + T   K+  D+ K  L + LC  G  L + +L T+         +E  ++      D L   + +  ++   +DN    L F   H+ V K YGR LK   K  E++          +++  L W   A + E  +P+ +P
Sbjct:    2 ATAATEEPFPF-HGLLPKKETGASSFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDEKPKIVDIIDTTGSGDVNTATEVEPK-DGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQASKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDS---NEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSL----REKLPANQYTWSSRGPSADGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKADNIEVFAQGHGIIQVDKAYDY----------------------------LVQNTSFANKL---GFTVTVGN------------------------------------NRGIYLRDPVQVTAPSDHGVGIEPVFPEN-TENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLRE----------------GLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESS-HYDLAFTDVHFKPGQIRRHFIEVPEGATWAEVTVCSCS-SEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLT----EAFPVLG--GKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLKYEDLAPCITLKSWVQTLRPVSAKTKPLGARDVLPNNRQLYEMILTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYP-------HQYSLKLEKGDYTVRLQIRHEQISDLERLKDLPFIVSHRLSNTLSLDIHE-----NHSFALLGKKKSSSLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKK-----------AGQSAAKRQGKFKKDVIPVHY------YL-------------IP-PPTKTKNGNKDKEKDLEKEKDL---KEEFTEALRDLKIQWM----TKLDSSDIYNELKETYPNY----LPLYVARLHQLDAEKERM--KRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATI--KNDMDKQKSTLVDALCRKGCALADHLLHTQAQDGAISTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKV--LTFAYKHALVNKMYGRGLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYP 1256          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Cavefish
Match: tpp2 (tripeptidyl peptidase 2 [Source:NCBI gene;Acc:103046829])

HSP 1 Score: 434.491 bits (1116), Expect = 4.874e-130
Identity = 230/517 (44.49%), Postives = 314/517 (60.74%), Query Frame = 3
Query:  120 DDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKD-DWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            D+SF     L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q TTEGKPK++ + DT+GSGDV+M   V+P     +  LS R + IPE+W        IGVK+A + FP A+  R+ K+ KE +W         E SR   E       P+Q   +   E Q   E L  +EK Y  P PV DC+ +     W A VDT+      +LE   +L S+ + +++ + G    LN+ VNI+D G  L IV+  G+HGTHVASIAAGYFP  PE NG+APGA+I+++KI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH ++F SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L P  YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S   Q     T   +  +  NTA  +  I   +QG+G++Q+  +F+Y+ ++
Sbjct:    7 DESFPL-HGLLPKKETGAASFLTRFPEYDGRGVLIAVLDTGVDPGAPGMQTTTEGKPKIVDIIDTTGSGDVNMSTVVEPK-DGVVAGLSGRTLKIPEAWVNPSGKYHIGVKNAYEFFPKALKERIQKERKEKLWDPAHRAALAEASRRTEEFDLAHPNPSQMEKLQKEELQCHTELLGAMEKKYSDPGPVYDCLAWHDGITWRAVVDTS---EKGELESCTVLSSYRERQEYATLGDAEMLNYSVNIYDEGNTLCIVTSGGAHGTHVASIAAGYFPEEPERNGVAPGAQILALKIGDTRLSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVISEAVQKHNVLFVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVTPDMMVAEYSL----REKLPPNQYTWSSRGPSTDGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKQNGVRPTVAAVRRALENTAQKVDDIEVFAQGHGIIQVDRAFDYLMQH 514          

HSP 2 Score: 213.386 bits (542), Expect = 1.248e-55
Identity = 147/492 (29.88%), Postives = 244/492 (49.59%), Query Frame = 3
Query: 1893 NRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESIS---SLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLN-YSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVS 3347
             RGI LR+P ++S      + + P F E   E S ++++QL+L L C+A WV CP    L NQ R ++I+IDP  LR                 G+++TE+  +       G L R+P+TV     ++   + E   T+      +  RHFI  P GA    +T+   S  D S +F L  + +      V     ++  F K S++    S+          T+E+ VA++W++  +  ++Y++ FHGL+ S   + + +++      + S +R EE+SP I+L   V PLRP   ++  +  +  +   ++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ +FD N R++GSGD  P       ++Y   ++KGD+ ++L VRH   ++LERL+D    + F     L+   S  I + +    L   + N  ++  G     YIT+ P  KV K    G Y++G+L + K+E  +K VS
Sbjct:  531 QRGIYLRDPIQVSSPSDHGVGVEPVFPENT-ENSLRISLQLHLALTCTAPWVQCPSHLELMNQCRHVNIRIDPQGLRE----------------GLHYTEVCAYDTLAPSAGPLFRVPVTVIIPTKVTESRNQEISFTDVHFRPGQIRRHFITVPQGASWAEITLTSHS-SDVSSKFVLHAVHL------VKQRAYRANEFYKFSSLMEKGSLTEAFPVLAGRTVEVCVARWWASLGDVTVDYTVSFHGLQTSPCPLHVHAAEGITSFEVSSPVRYEEVSPTITLKNWVQPLRPVSSKVKALGLRDVLPNSRQLYEVVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWLLFDQNKRLMGSGDAYP-------HQYSLKLEKGDYTIRLQVRHEQQSELERLKD----LPFVVSHRLSNTLSLDIYETHRAAMLAKKKANSLTLAPGTSQPFYITSLPDDKVPKGTGPGCYMTGSLVVPKSEYGKKAVS 987          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Cavefish
Match: tpp2 (tripeptidyl peptidase 2 [Source:NCBI gene;Acc:103046829])

HSP 1 Score: 436.032 bits (1120), Expect = 6.147e-130
Identity = 230/517 (44.49%), Postives = 314/517 (60.74%), Query Frame = 3
Query:  120 DDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKD-DWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            D+SF     L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q TTEGKPK++ + DT+GSGDV+M   V+P     +  LS R + IPE+W        IGVK+A + FP A+  R+ K+ KE +W         E SR   E       P+Q   +   E Q   E L  +EK Y  P PV DC+ +     W A VDT+      +LE   +L S+ + +++ + G    LN+ VNI+D G  L IV+  G+HGTHVASIAAGYFP  PE NG+APGA+I+++KI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH ++F SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L P  YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S   Q     T   +  +  NTA  +  I   +QG+G++Q+  +F+Y+ ++
Sbjct:    7 DESFPL-HGLLPKKETGAASFLTRFPEYDGRGVLIAVLDTGVDPGAPGMQTTTEGKPKIVDIIDTTGSGDVNMSTVVEPK-DGVVAGLSGRTLKIPEAWVNPSGKYHIGVKNAYEFFPKALKERIQKERKEKLWDPAHRAALAEASRRTEEFDLAHPNPSQMEKLQKEELQCHTELLGAMEKKYSDPGPVYDCLAWHDGITWRAVVDTS---EKGELESCTVLSSYRERQEYATLGDAEMLNYSVNIYDEGNTLCIVTSGGAHGTHVASIAAGYFPEEPERNGVAPGAQILALKIGDTRLSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVISEAVQKHNVLFVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVTPDMMVAEYSL----REKLPPNQYTWSSRGPSTDGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKQNGVRPTVAAVRRALENTAQKVDDIEVFAQGHGIIQVDRAFDYLMQH 514          

HSP 2 Score: 210.69 bits (535), Expect = 1.280e-54
Identity = 145/490 (29.59%), Postives = 242/490 (49.39%), Query Frame = 3
Query: 1893 NRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESIS---SLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLN-YSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKT 3341
             RGI LR+P ++S      + + P F E   E S ++++QL+L L C+A WV CP    L NQ R ++I+IDP  LR                 G+++TE+  +       G L R+P+TV     ++   + E   T+      +  RHFI  P GA    +T+   S  D S +F L  + +      V     ++  F K S++    S+          T+E+ VA++W++  +  ++Y++ FHGL+ S   + + +++      + S +R EE+SP I+L   V PLRP   ++  +  +  +   ++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ +FD N R++GSGD  P       ++Y   ++KGD+ ++L VRH   ++LERL+D    + F     L+   S  I + +    L   + N  ++  G     YIT+ P  KV K    G Y++G+L + K+E  +K 
Sbjct:  531 QRGIYLRDPIQVSSPSDHGVGVEPVFPENT-ENSLRISLQLHLALTCTAPWVQCPSHLELMNQCRHVNIRIDPQGLRE----------------GLHYTEVCAYDTLAPSAGPLFRVPVTVIIPTKVTESRNQEISFTDVHFRPGQIRRHFITVPQGASWAEITLTSHS-SDVSSKFVLHAVHL------VKQRAYRANEFYKFSSLMEKGSLTEAFPVLAGRTVEVCVARWWASLGDVTVDYTVSFHGLQTSPCPLHVHAAEGITSFEVSSPVRYEEVSPTITLKNWVQPLRPVSSKVKALGLRDVLPNSRQLYEVVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWLLFDQNKRLMGSGDAYP-------HQYSLKLEKGDYTIRLQVRHEQQSELERLKD----LPFVVSHRLSNTLSLDIYETHRAAMLAKKKANSLTLAPGTSQPFYITSLPDDKVPKGTGPGCYMTGSLVVPKSEYGKKA 985          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Cavefish
Match: tpp2 (tripeptidyl peptidase 2 [Source:NCBI gene;Acc:103046829])

HSP 1 Score: 435.261 bits (1118), Expect = 9.725e-130
Identity = 230/517 (44.49%), Postives = 314/517 (60.74%), Query Frame = 3
Query:  120 DDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKD-DWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            D+SF     L+PK  T A  F+   P YDGR V IA+ DTGVDP + G+Q TTEGKPK++ + DT+GSGDV+M   V+P     +  LS R + IPE+W        IGVK+A + FP A+  R+ K+ KE +W         E SR   E       P+Q   +   E Q   E L  +EK Y  P PV DC+ +     W A VDT+      +LE   +L S+ + +++ + G    LN+ VNI+D G  L IV+  G+HGTHVASIAAGYFP  PE NG+APGA+I+++KI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH ++F SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L P  YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACGGI+L++S   Q     T   +  +  NTA  +  I   +QG+G++Q+  +F+Y+ ++
Sbjct:    7 DESFPL-HGLLPKKETGAASFLTRFPEYDGRGVLIAVLDTGVDPGAPGMQTTTEGKPKIVDIIDTTGSGDVNMSTVVEPK-DGVVAGLSGRTLKIPEAWVNPSGKYHIGVKNAYEFFPKALKERIQKERKEKLWDPAHRAALAEASRRTEEFDLAHPNPSQMEKLQKEELQCHTELLGAMEKKYSDPGPVYDCLAWHDGITWRAVVDTS---EKGELESCTVLSSYRERQEYATLGDAEMLNYSVNIYDEGNTLCIVTSGGAHGTHVASIAAGYFPEEPERNGVAPGAQILALKIGDTRLSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVISEAVQKHNVLFVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVTPDMMVAEYSL----REKLPPNQYTWSSRGPSTDGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKQNGVRPTVAAVRRALENTAQKVDDIEVFAQGHGIIQVDRAFDYLMQH 514          

HSP 2 Score: 212.231 bits (539), Expect = 3.836e-55
Identity = 149/506 (29.45%), Postives = 249/506 (49.21%), Query Frame = 3
Query: 1893 NRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESIS---SLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLN-YSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYP-FQYIFTAHQSA 3386
             RGI LR+P ++S      + + P F E   E S ++++QL+L L C+A WV CP    L NQ R ++I+IDP  LR                 G+++TE+  +       G L R+P+TV     ++   + E   T+      +  RHFI  P GA    +T+   S  D S +F L  + +      V     ++  F K S++    S+          T+E+ VA++W++  +  ++Y++ FHGL+ S   + + +++      + S +R EE+SP I+L   V PLRP   ++  +  +  +   ++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ +FD N R++GSGD  P       ++Y   ++KGD+ ++L VRH   ++LERL+D    + F     L+   S  I + +    L   + N  ++  G     YIT+ P  KV K    G Y++G+L + K+E  +K    P F ++ +A   A
Sbjct:  531 QRGIYLRDPIQVSSPSDHGVGVEPVFPENT-ENSLRISLQLHLALTCTAPWVQCPSHLELMNQCRHVNIRIDPQGLRE----------------GLHYTEVCAYDTLAPSAGPLFRVPVTVIIPTKVTESRNQEISFTDVHFRPGQIRRHFITVPQGASWAEITLTSHS-SDVSSKFVLHAVHL------VKQRAYRANEFYKFSSLMEKGSLTEAFPVLAGRTVEVCVARWWASLGDVTVDYTVSFHGLQTSPCPLHVHAAEGITSFEVSSPVRYEEVSPTITLKNWVQPLRPVSSKVKALGLRDVLPNSRQLYEVVLTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWLLFDQNKRLMGSGDAYP-------HQYSLKLEKGDYTIRLQVRHEQQSELERLKD----LPFVVSHRLSNTLSLDIYETHRAAMLAKKKANSLTLAPGTSQPFYITSLPDDKVPKGTGPGCYMTGSLVVPKSEYGKKADVVPVFYHLISAPNKA 1001          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Cavefish
Match: mbtps1 (membrane bound transcription factor peptidase, site 1 [Source:NCBI gene;Acc:103032608])

HSP 1 Score: 58.5362 bits (140), Expect = 5.633e-8
Identity = 60/258 (23.26%), Postives = 113/258 (43.80%), Query Frame = 3
Query:  882 HGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSM--QPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQ-VYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            HGT VA + A    +R EC G AP +E+   ++  N  VS  +    A+     +  K D++NLS G       P   ++ ++     + + ++  S+ GNDGP   T+ +P    D++ G+  + F            DNI+  S + + TW    P   G +   +   GS +             ++G+S++SP   G ++LL S     ++ + P  +  +   +A  +  +    QG+G L +  +++ +  Y
Sbjct:  209 HGTFVAGVIAS---MR-ECQGFAPDSELHIFRVFTNNQVSYTSWFLDAF--NYAILKKIDVLNLSIGGPDFMDHPFVDKVWEL-----TANRVIMVSAIGNDGPLYGTLNNPADQMDVI-GVGGIDFE-----------DNIARFSSRGMTTWEL--PGGYGRVKPDIVTYGSGVRGSG--MKEGCRSLSGTSVASPVVAGAVTLLASTVLN-RELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSY 438          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Cavefish
Match: mbtps1 (membrane bound transcription factor peptidase, site 1 [Source:NCBI gene;Acc:103032608])

HSP 1 Score: 58.5362 bits (140), Expect = 6.457e-8
Identity = 60/258 (23.26%), Postives = 113/258 (43.80%), Query Frame = 3
Query:  882 HGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSM--QPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQ-VYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            HGT VA + A    +R EC G AP +E+   ++  N  VS  +    A+     +  K D++NLS G       P   ++ ++     + + ++  S+ GNDGP   T+ +P    D++ G+  + F            DNI+  S + + TW    P   G +   +   GS +             ++G+S++SP   G ++LL S     ++ + P  +  +   +A  +  +    QG+G L +  +++ +  Y
Sbjct:  275 HGTFVAGVIAS---MR-ECQGFAPDSELHIFRVFTNNQVSYTSWFLDAF--NYAILKKIDVLNLSIGGPDFMDHPFVDKVWEL-----TANRVIMVSAIGNDGPLYGTLNNPADQMDVI-GVGGIDFE-----------DNIARFSSRGMTTWEL--PGGYGRVKPDIVTYGSGVRGSG--MKEGCRSLSGTSVASPVVAGAVTLLASTVLN-RELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSY 504          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Sea Lamprey
Match: mbtps1 (membrane-bound transcription factor peptidase, site 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4909])

HSP 1 Score: 63.1586 bits (152), Expect = 4.028e-10
Identity = 63/258 (24.42%), Postives = 116/258 (44.96%), Query Frame = 3
Query:  882 HGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSM--QPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQ-VYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            HGT VA + A    +R EC G AP AE+   ++  N  VS  +    A+     ++ K +++NLS G       P   ++ ++     + + ++  S+ GNDGP   T+ +P    D++ G+  + F            DNI+  S + + TW    P   G +   +   GS +       N     ++G+S++SP   G ++LL S+  Q +  I P  +  +   +A  +  +    QG+G L +  +++ +  Y
Sbjct:  106 HGTFVAGVIAS---MR-ECQGFAPDAELHIFRVFTNNQVSYTSWFLDAF--NYAIQKKINVLNLSIGGPDFMDHPFVDKVWEL-----TANKVIMVSAIGNDGPLYGTLNNPADQMDVI-GVGGIDFE-----------DNIARFSSRGMTTWEL--PGGYGRMKPDIVTYGSGVRGSG--INGGCRSLSGTSVASPVVTGAVTLLASSV-QNRDIINPASMKQALMASARRLPGVNMFEQGHGKLDLLRAYQVLNSY 335          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Nematostella
Match: EDO30245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1C0])

HSP 1 Score: 377.096 bits (967), Expect = 3.491e-111
Identity = 216/528 (40.91%), Postives = 306/528 (57.95%), Query Frame = 3
Query:  132 YFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNK-----KKKPNQHSTIFDLENQFLKE--CLEVIEKSYEYPIPVLDCIVFQKDD-WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAE----IVSIKISDN-RLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGI-HVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQIT 1673
            + V  L+PK  T A  F+ + P  DGR   IAI DTGVDP + GLQ T+ G+ K++ + DTSGSGDV     V P     I  LS R++ IP  W        +G+KS   +FP  +  R+ K+ KE +W    +   AE + +      K P +++T   +      E   L  + K Y    P LDCIVF   D W A +DT+       L+   L+  + +  +F SF  +  +N+ +NI+D G  L IV+  G+HGTHVASIAAG+    P   G+APGA+    IV++ I  + RL +METG AL  A     + KCD++N+S+GE++  PN GR+  +M ELV++HG++F SS+GN+GPALSTVG PGGT++ + GI   V P+M+ + YSL    +  L    YTW+SRGP+TDGSLG+  V APGSAI+    W  R   LMNG+SMSSPNACGGI+L++S       P +P  +  +  NTA  ++ +   +QG GLLQ+   F+Y+E+Y    D  +T
Sbjct:    8 FPVHGLLPKRETGADRFVAKYPECDGRGTLIAILDTGVDPGALGLQTTSHGRRKIVDLIDTSGSGDVDTSTVVTPKDNGVIIGLSERQLKIPADWVNPSGVYHVGIKSLFSLFPDKLQQRIKKERKEKLWDPFHNSRVAETMRRLEEWDAKHPPKNATPKIIRESLQSEIDALSTMSKKYADCGPALDCIVFHDGDGWRACIDTS---ETGDLQSCKLMSDYRESGEFASFSDQDLMNYSINIYDEGNTLCIVTTGGTHGTHVASIAAGFCAENPTLTGLAPGAQVFLDIVALFILLSIRLDTMETGTALVRALIAAHDYKCDLINMSYGEAANWPNAGRVVDLMNELVNEHGVIFISSAGNNGPALSTVGCPGGTSESIIGIGAYVSPEMMAAEYSL----LEKLPGNQYTWSSRGPSTDGSLGVLCVTAPGSAISCSITWTLRGSQLMNGTSMSSPNACGGIALVLSGLKARGIPYSPPSIRRALENTALRMEGLDFFTQGYGLLQVDKVFDYMEQYADTPDRNVT 528          

HSP 2 Score: 188.348 bits (477), Expect = 2.424e-48
Identity = 135/507 (26.63%), Postives = 250/507 (49.31%), Query Frame = 3
Query: 1863 FRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSL---EWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYI 3365
            F+I C    G RGI +R+ +++ +    T  ++P F  E+ +   ++ + L L L  +  WV+CP  F+L N  RS S+++DP    R LPE            G ++ EI  + +     GA+ R+P++V     ++ +   E    ++     +  R F+  P GA    + I  +S  + S RF +  +Q+ P    + +  +  F           +S+++ + G    T+E+ VA++W++  +  +   L FHG+R S  +V  + ++   R+ +   LR EE+SP+++LN    PLRP + ++T +  +  +    ++  L L Y FN  + G +      L +LLYE+++  Q++ ++D+N R++G GD     A+    +Y   I+KGD+ ++  VRH +  QLE+L+D V+ +  K   +L  +   S +      K TA    + + KG    ++I   P  K+ K    G  L G +  +KN+  +K  ++P +YI
Sbjct:  529 FQINCQ---GPRGIYIRQAYQLLKPYVVTATVTPKF-PEISDHQSKLGLNLRLSLASTEPWVSCPGHFALMNTPRSFSVKVDP----RGLPE------------GAHYAEIRAYDVTCPERGAVFRVPVSVIVPHRVTDMTHYEVSMEDRTFKPGQVQRTFVDVPEGATYAELNISSLS-EENSARFMVHAVQLLP----LTAFRTNEFCQFITLAPRCEKSLSFAVKGGV--TLELCVARWWASLGDCLIRKLLIFHGMRPSLSAV-TVHANQTTRVDVTCTLRPEEVSPSVTLNTHAQPLRPTESKITPLASRDVLFKRGQIYALNLTYNFNQSRAGEINPNAVYLSDLLYESEYESQIWMLYDTNKRLLGCGD-----AFH--TRYTAKIEKGDYILKYQVRHDNRDQLEKLKDMVVLIETKLTPTLPLDVHPSRLSAMTGGKFTA----FIMQKGWCWPVFINPLPDDKLPKGVKPGHILRGKITFFKNDPGKKVDTHPIEYI 996          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Medaka
Match: tpp2 (tripeptidyl peptidase 2 [Source:NCBI gene;Acc:101174009])

HSP 1 Score: 421.394 bits (1082), Expect = 1.336e-124
Identity = 225/519 (43.35%), Postives = 313/519 (60.31%), Query Frame = 3
Query:  117 ADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHM--LKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKD-DWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEK 1643
            +++ F F   L+PK  T A   +   P YDGR V IAI DTGVDP + G+Q+TTEGKPK++ + DT+GSGDV+M  + E K      IT LS R + IP +W       RIGVK+  + FP A+  R+ K+ KE IW         E+ R   E       P+Q   +   E Q   E L  +EK Y  P PV DC+++     W A VDT+      +L    +L S+ + +++ S G    LN+ +NI+D G  L IV+  G+HGTHVASIAAGYFP  PE NG+APGA+I+++KI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH ++F SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L P  YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACG I+L++S   Q+        +  +  N+A  ++ I   +QG+G++Q+  + +Y+ +
Sbjct:    6 SEEPFPF-HGLLPKKETGAASHLSRFPEYDGRGVLIAILDTGVDPGAPGMQVTTEGKPKIVDIIDTTGSGDVNMTTVAEAK---DGTITGLSGRILKIPPAWVNPTGKFRIGVKNGYEFFPKALKERIQKERKEKIWDPAHRAALAEVCRKLDEFELSHPTPSQSEKLQKEELQSQSELLASLEKKYSDPGPVYDCVLWHDGVTWKAVVDTSECG---ELSQCTVLSSYKENQEYASLGTVEMLNYSINIYDEGSTLCIVTSGGAHGTHVASIAAGYFPEEPERNGVAPGAQILALKIGDTRLSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVITEAVQKHNVIFVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVTPDMMVAEYSL----REKLPPNQYTWSSRGPSTDGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGVIALVLSGLKQIGIRTCVPAVRRALENSALKVEDIEVFAQGHGIIQVDRALDYLTQ 513          

HSP 2 Score: 206.068 bits (523), Expect = 3.690e-53
Identity = 144/490 (29.39%), Postives = 243/490 (49.59%), Query Frame = 3
Query: 1893 NRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVF---KSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLN-YSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKT 3341
             RGI LR+P ++      ++ I P F E   E S+++++QL+L L C+A WV CP    L NQ R +++++DP  LR                 G+++ E+  +       G L R+PITV    K  +  + E   T+      +  RHFI  P GA    +T+   S  D S +F L  + +      V  +  ++  F K S++    S+       +   +E+ +A++W++  +  ++YS+ FHGL +S   + + +S+      + S LR EE+SP+I+L   V PLRP   ++  +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ +FD N R++GSGD  P       ++Y   ++KGD+ V+L VRH    +LERL+D    + F     L+   S  I + +    +   + N  ++  G     YIT  P  K+ K  + G Y+ G+L + K+E  +K 
Sbjct:  531 QRGIYLRDPSQVLAPSDHSVGIEPIFPENT-ENSERISLQLHLALTCTAPWVQCPSHLELMNQCRHVNVRVDPLGLRE----------------GVHYAEVCGYDTAAPGCGPLFRVPITVIIPVKVTNSRNQEVSFTDVHFRPGQIRRHFITVPQGASWAEITLTSHS-GDVSSKFVLHAVHL------VKQKAYRANEFYKFSSLLERGSLTEAFPVLSGRVVELCIARWWASLGDVTVDYSISFHGLCVSPLPLHIHASEGVASFDVSSPLRYEEVSPSITLKSWVQPLRPLSSKIKALGMRDVLPNNRQLYEIVLTYNFHQPKSGEVTPSCPMLCELLYESEFDSQLWMLFDQNKRLLGSGDAYP-------HQYALKLEKGDYSVRLQVRHEQSNELERLKD----LPFVVSHRLSTTLSLDIYETHRAALMGKKKANSVTLCPGTTHPFYITGLPDDKIPKGTSPGCYILGSLIVPKSEYGKKA 985          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Medaka
Match: tpp2 (tripeptidyl peptidase 2 [Source:NCBI gene;Acc:101174009])

HSP 1 Score: 420.239 bits (1079), Expect = 2.680e-124
Identity = 225/519 (43.35%), Postives = 313/519 (60.31%), Query Frame = 3
Query:  117 ADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHM--LKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWS-------KEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKD-DWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEK 1643
            +++ F F   L+PK  T A   +   P YDGR V IAI DTGVDP + G+Q+TTEGKPK++ + DT+GSGDV+M  + E K      IT LS R + IP +W       RIGVK+  + FP A+  R+ K+ KE IW         E+ R   E       P+Q   +   E Q   E L  +EK Y  P PV DC+++     W A VDT+      +L    +L S+ + +++ S G    LN+ +NI+D G  L IV+  G+HGTHVASIAAGYFP  PE NG+APGA+I+++KI D RL +METG  L  A    +  KCD+VN S+GE++  PN GRIC+++ E V KH ++F SS+GN+GP LSTVG PGGTT  + G+   V PDM+ + YSL       L P  YTW+SRGP+TDG+LG+ ++APG AI SV  W  R   LMNG+SMSSPNACG I+L++S   Q+        +  +  N+A  ++ I   +QG+G++Q+  + +Y+ +
Sbjct:    6 SEEPFPF-HGLLPKKETGAASHLSRFPEYDGRGVLIAILDTGVDPGAPGMQVTTEGKPKIVDIIDTTGSGDVNMTTVAEAK---DGTITGLSGRILKIPPAWVNPTGKFRIGVKNGYEFFPKALKERIQKERKEKIWDPAHRAALAEVCRKLDEFELSHPTPSQSEKLQKEELQSQSELLASLEKKYSDPGPVYDCVLWHDGVTWKAVVDTSECG---ELSQCTVLSSYKENQEYASLGTVEMLNYSINIYDEGSTLCIVTSGGAHGTHVASIAAGYFPEEPERNGVAPGAQILALKIGDTRLSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVITEAVQKHNVIFVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYVTPDMMVAEYSL----REKLPPNQYTWSSRGPSTDGALGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGVIALVLSGLKQIGIRTCVPAVRRALENSALKVEDIEVFAQGHGIIQVDRALDYLTQ 513          

HSP 2 Score: 207.994 bits (528), Expect = 8.978e-54
Identity = 148/509 (29.08%), Postives = 249/509 (48.92%), Query Frame = 3
Query: 1893 NRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVF---KSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYI--KKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLN-YSIGKGEKSVLYITT-PMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKG 3398
             RGI LR+P ++      ++ I P F E   E S+++++QL+L L C+A WV CP    L NQ R +++++DP  LR                 G+++ E+  +       G L R+PITV    K  +  + E   T+      +  RHFI  P GA    +T+   S  D S +F L  + +      V  +  ++  F K S++    S+       +   +E+ +A++W++  +  ++YS+ FHGL +S   + + +S+      + S LR EE+SP+I+L   V PLRP   ++  +  +  +  +++L  + L Y F+ PK G V   CP L  LLYE++F  Q++ +FD N R++GSGD  P       ++Y   ++KGD+ V+L VRH    +LERL+D    + F     L+   S  I + +    +   + N  ++  G     YIT  P  K+ K  + G Y+ G+L + K+E  +K    P  Y      + T+ G
Sbjct:  531 QRGIYLRDPSQVLAPSDHSVGIEPIFPENT-ENSERISLQLHLALTCTAPWVQCPSHLELMNQCRHVNVRVDPLGLRE----------------GVHYAEVCGYDTAAPGCGPLFRVPITVIIPVKVTNSRNQEVSFTDVHFRPGQIRRHFITVPQGASWAEITLTSHS-GDVSSKFVLHAVHL------VKQKAYRANEFYKFSSLLERGSLTEAFPVLSGRVVELCIARWWASLGDVTVDYSISFHGLCVSPLPLHIHASEGVASFDVSSPLRYEEVSPSITLKSWVQPLRPLSSKIKALGMRDVLPNNRQLYEIVLTYNFHQPKSGEVTPSCPMLCELLYESEFDSQLWMLFDQNKRLLGSGDAYP-------HQYALKLEKGDYSVRLQVRHEQSNELERLKD----LPFVVSHRLSTTLSLDIYETHRAALMGKKKANSVTLCPGTTHPFYITGLPDDKIPKGTSPGCYILGSLIVPKSEYGKKADIIPVIYHLIPAPNKTKNG 1004          
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Medaka
Match: mbtps1 (membrane bound transcription factor peptidase, site 1 [Source:NCBI gene;Acc:101164978])

HSP 1 Score: 58.5362 bits (140), Expect = 6.330e-8
Identity = 65/263 (24.71%), Postives = 116/263 (44.11%), Query Frame = 3
Query:  882 HGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSM--QPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGL------MNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKY 1646
            HGT VA + A    +R EC G AP +E+   ++  N  VS  +    A+     +  K D++NLS G       P   ++ ++     + + ++  S+ GNDGP   T+ +P    D++ G+  + F            DNI+  S       SRG TT    G +       +T  +G   R  GL      ++G+S++SP   G ++LL S     ++ + P  +  +   +A  +  +    QG+G L +  +++ +  Y
Sbjct:  263 HGTFVAGVIAS---MR-ECQGFAPDSELHIFRVFTNNQVSYTSWFLDAF--NYAILKKIDVLNLSIGGPDFMDHPFVDKVWEL-----TANKVIMVSAIGNDGPLYGTLNNPADQMDVI-GVGGIDF-----------EDNIARFS-------SRGMTTWELPGGYGRVKPDIVTYGSG--VRGSGLKEGCRSLSGTSVASPVVAGAVTLLASTVLN-RELVNPASMKQALIASARRLPGVNMFEQGHGKLDLIRAYQILNSY 492          
BLAST of Tripeptidyl peptidase 2 vs. Planmine SMEST
Match: SMESG000074726.1 (SMESG000074726.1)

HSP 1 Score: 2875.89 bits (7454), Expect = 0.000e+0
Identity = 1401/1404 (99.79%), Postives = 1403/1404 (99.93%), Query Frame = 3
Query:   99 MSSSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDDWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHPISCQLQHRR 4310
            MSSSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDDWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEI DQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYF+EIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNSEISKSFSFEKKSNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVG+KFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHPISCQLQHRR
Sbjct:    1 MSSSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDDWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEIFDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFSEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNSEISKSFSFEKKSNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGAKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHPISCQLQHRR 1404          
BLAST of Tripeptidyl peptidase 2 vs. Planmine SMEST
Match: SMESG000074726.1 (SMESG000074726.1)

HSP 1 Score: 2854.7 bits (7399), Expect = 0.000e+0
Identity = 1394/1404 (99.29%), Postives = 1396/1404 (99.43%), Query Frame = 3
Query:   99 MSSSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDDWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNXXXXXXXXXXXXXNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHPISCQLQHRR 4310
            MSSSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDDWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEI DQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYF+EIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNSEISKSFSFEKKSNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEM       YFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVG+KFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHPISCQLQHRR
Sbjct:    1 MSSSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVDPASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREIIIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHAELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDDWVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNGKILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLVSMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKHGIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDNISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGSSMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQGNGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNKIQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNRGILLREPFEISQKRYFTINISPDFNEEMMEIFDQVNIQLYLHLVCSASWVTCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFSEIEFHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKKTVRHFIATPHGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNSEISKSFSFEKKSNMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTESVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYIKKSVSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDSNGRIVGSGDYKPEM-------YFFGIDKGDFKVQLNVRHGSIAQLERLRDQVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYITTPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKGENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEKLLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDKSNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYVGAKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSEDDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRMLKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHPISCQLQHRR 1397          
The following BLAST results are available for this feature:
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPP20.000e+032.11tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HG... [more]
TPP20.000e+031.88tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HG... [more]
TPP25.313e-15035.65tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HG... [more]
TPP25.374e-14129.82tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HG... [more]
TPP23.147e-3039.29tripeptidyl peptidase 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpp-23.099e-11225.64Tripeptidyl-peptidase 2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TppII2.934e-8636.19gene:FBgn0020370 transcript:FBtr0087774[more]
TppII3.469e-8636.19gene:FBgn0020370 transcript:FBtr0344199[more]
TppII3.469e-8636.19gene:FBgn0020370 transcript:FBtr0087775[more]
TppII4.643e-8134.65gene:FBgn0020370 transcript:FBtr0339755[more]
S1P1.364e-1326.52gene:FBgn0037105 transcript:FBtr0078466[more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tpp22.142e-12744.25tripeptidyl peptidase 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
mbtps14.027e-824.71membrane-bound transcription factor peptidase, sit... [more]
mbtps14.027e-824.71membrane-bound transcription factor peptidase, sit... [more]
mbtps11.396e-626.85membrane-bound transcription factor peptidase, sit... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xab20.000e+031.54XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-... [more]
xab20.000e+034.37XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-... [more]
xab20.000e+034.21XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-... [more]
xab22.676e-634.05XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-... [more]
xab21.593e-17834.19XPA binding protein 2 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpp20.000e+030.86tripeptidyl peptidase II [Source:MGI Symbol;Acc:MG... [more]
Tpp20.000e+031.37tripeptidyl peptidase II [Source:MGI Symbol;Acc:MG... [more]
Tpp27.372e-17734.56tripeptidyl peptidase II [Source:MGI Symbol;Acc:MG... [more]
Tpp21.145e-12943.16tripeptidyl peptidase II [Source:MGI Symbol;Acc:MG... [more]
Tpp23.607e-1629.89tripeptidyl peptidase II [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64514|TPP2_MOUSE0.000e+030.86Tripeptidyl-peptidase 2 OS=Mus musculus OX=10090 G... [more]
sp|P29144|TPP2_HUMAN0.000e+031.88Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q64560|TPP2_RAT0.000e+033.19Tripeptidyl-peptidase 2 OS=Rattus norvegicus OX=10... [more]
sp|A5PK39|TPP2_BOVIN0.000e+033.36Tripeptidyl-peptidase 2 OS=Bos taurus OX=9913 GN=T... [more]
sp|F4JVN6|TPPII_ARATH6.818e-12227.87Tripeptidyl-peptidase 2 OS=Arabidopsis thaliana OX... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2K6SC960.000e+031.50Tripeptidyl peptidase 2 OS=Saimiri boliviensis bol... [more]
F7BYW80.000e+031.50Tripeptidyl peptidase 2 OS=Callithrix jacchus OX=9... [more]
A0A2K5Q6E20.000e+031.50Tripeptidyl peptidase 2 OS=Cebus capucinus imitato... [more]
R7TP140.000e+031.29Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2K5BX190.000e+031.50Tripeptidyl peptidase 2 OS=Aotus nancymaae OX=3729... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpp24.874e-13044.49tripeptidyl peptidase 2 [Source:NCBI gene;Acc:1030... [more]
tpp26.147e-13044.49tripeptidyl peptidase 2 [Source:NCBI gene;Acc:1030... [more]
tpp29.725e-13044.49tripeptidyl peptidase 2 [Source:NCBI gene;Acc:1030... [more]
mbtps15.633e-823.26membrane bound transcription factor peptidase, sit... [more]
mbtps16.457e-823.26membrane bound transcription factor peptidase, sit... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mbtps14.028e-1024.42membrane-bound transcription factor peptidase, sit... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO302453.491e-11140.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tpp21.336e-12443.35tripeptidyl peptidase 2 [Source:NCBI gene;Acc:1011... [more]
tpp22.680e-12443.35tripeptidyl peptidase 2 [Source:NCBI gene;Acc:1011... [more]
mbtps16.330e-824.71membrane bound transcription factor peptidase, sit... [more]
back to top
BLAST of Tripeptidyl peptidase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000074726.10.000e+099.79SMESG000074726.1[more]
SMESG000074726.10.000e+099.29SMESG000074726.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005274 ID=SMED30005274|Name=Tripeptidyl peptidase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=4453bp
TTTTTTTTGTTTAATTCAACTCATTAACCGAGGTAATTCGAATTATAAAG
CTATTATTGTAAACCTACAAATATACCTAGTTGATTTAGTTTTTTTTAAT
GAGCAGTTCAATATTAGCTGATGATTCTTTTTATTTTGTTCAATCACTCA
TACCTAAAAATCACACTCAAGCAATCGATTTCATCAAGGAGAATCCAAAT
TATGATGGAAGAAATGTAAGAATTGCCATCTGGGATACTGGTGTCGATCC
AGCATCTGAGGGACTTCAAATCACAACCGAAGGTAAACCGAAATTGATTC
ACATGAGTGACACCTCCGGTTCCGGAGATGTTCACATGTTGAAAGAAGTG
AAACCGGACTGTCAAAATAAAATAACATTACTATCCAATCGTGAAATAAT
TATACCAGAATCTTGGAATATTGGAGATCAAAGCCTGAGGATTGGTGTAA
AGTCTGCGGCTGATATTTTTCCAGCTGCAGTTATTTCTCGGCTTTCTAAA
GATTATAAAGAAAATATTTGGAGTAAAGAAATCAGTCGATTGCATGCGGA
ACTGCTGAACAAAAAGAAAAAACCAAATCAACATTCGACGATTTTTGATT
TGGAAAATCAATTTTTAAAGGAATGTTTAGAAGTAATTGAAAAATCGTAT
GAATACCCTATTCCGGTTTTAGATTGCATTGTCTTTCAGAAAGATGATTG
GGTAGCCTTTGTGGATACAACTTGTCTCAATCCAAATATGAAATTAGAAG
ACGTTCCTCTTTTATATTCCTTTCCAAAATACCGACAATTTACGAGTTTC
GGGGGAAAAACCAATTTAAATTTCGGTGTAAATATCCATGATAATGGCAA
GATATTAGAAATAGTCAGTTGTTCTGGATCTCATGGAACTCACGTCGCAT
CAATTGCTGCTGGATATTTCCCATTAAGACCGGAATGTAACGGAATTGCA
CCGGGAGCAGAAATAGTGAGTATCAAAATTTCCGATAATCGCCTTGTTTC
AATGGAAACTGGGATGGCTTTGGCTTATGCGGCAAAACTAACAGTAGAAC
TCAAATGTGACATAGTAAATCTGAGTTTTGGGGAGTCGAGTATGCAACCA
AACTGCGGCCGAATTTGTCAAATAATGCAAGAACTCGTTAGTAAGCACGG
TATTGTTTTCTGTAGCAGTTCAGGAAATGATGGACCGGCTTTGAGTACTG
TTGGCTCTCCAGGGGGCACCACCGATTTGTTATTTGGAATATCACCATTA
GTGTTTCCTGACATGGTAGAATCTAATTACAGTTTACCAGTGGACAATAT
TTCAGATCTGTCCCCACAAGTCTATACGTGGGCTAGTCGTGGTCCAACAA
CCGATGGCAGTTTAGGGATTCATGTTGCTGCCCCTGGATCTGCTATAACA
TCGGTTGCTGGGTGGCAAAATCGTACAATTGGCTTAATGAATGGTAGCTC
AATGAGTTCCCCGAATGCTTGTGGAGGCATAAGCTTACTTATCAGTGCAG
CTCATCAGTTAAAAAAGCCAATAACACCTTGGCTATTAGCATTATCTACT
CGTAACACAGCTTCAGTCATCCAGTATATTGGCCGACTTTCTCAGGGTAA
CGGTTTGTTGCAAATCAAATCATCATTTGAATATATCGAAAAGTACTGGC
TTAATTTGGATAATCAAATTACGGCAAAGCAAGGCGATTCATTAGTCTTT
AAAGAATCTTGTCTTTCATTGAAAGAAAACGATGGGCTTTCAAATAAAAT
TCAATCTAATGATTTTAATGTATCCGTAAAAAATGAATCTACTCCTGTTT
TGACGAATGTTGGAAATCATTTATTGACAAATTTCAAGACTGGTCAAACA
CCGCTTCACTTATTTAGAATTAAATGTAATCTTTCAAATGGCAATCGTGG
AATTCTTCTCAGAGAACCTTTTGAAATTTCTCAAAAACGGTATTTCACTA
TAAATATATCACCAGATTTTAATGAAGAAATGATGGAAATTTCTGATCAA
GTTAATATCCAATTGTATCTCCACTTAGTATGTTCTGCGAGTTGGGTGAC
TTGTCCAAGATTCTTTAGTTTATATAATCAAGAAAGATCTATTTCAATCC
AAATTGATCCCACGATGCTTAGAAGAGATTTACCAGAATTTGAACTTGCT
GACTCTAGTGAGTCAGGAGATTATGGAATATATTTTACTGAAATCGAATT
TCATTGCTTGGAATTTTCACATCTTGGTGCTTTAGCTCGTTTACCGATAA
CAGTCTTTAAATCAGAATCTATTTCATCTTTAGAATGGCATCACACAAAT
AAATTTACTGCAAAGAAAAAAACTGTCAGACATTTTATTGCTACACCTCA
TGGCGCAGATTCTTTAATAATGACAATAAAACCTGTATCAATAGTCGATG
GAAGTGGCAGATTTGAATTGAGAATAATGCAAGTGCAACCGAATTTTTCC
ACGGTTAATTCAGAAATTAGTAAATCCTTTTCATTCGAAAAGAAATCTAA
TATGACAATAAATGAATCTGTGGCATATATGCTAACCGGTCATACAAGCT
CAACTATTGAGATTGCAGTTGCACAATATTGGTCGGCAACAAATGAGGCA
GAGTTAGAATATTCGTTAGATTTTCATGGTTTGAGGATATCGACAGAAAG
TGTGAAAATGCTTTCGTCGGACAATCATTATAGATTGCTCATTGAATCTC
AGTTGCGATTGGAGGAAATTTCACCAGCAATATCGTTGAATTATTTAGTA
TTGCCATTAAGGCCATACAAAGACGAATTAACTTATATTAAGAAGTCAGT
TTCGGGTGATAAAGAATTAATCAATTTGGAATTATTTTACACTTTTAATA
ATCCTAAGCCAGGAAGTGTGGGAATATTTTGTCCTGCTTTGGGCAATCTA
CTCTATGAAAATGATTTCTATTGCCAGATGTATCATATTTTCGATAGTAA
CGGGCGAATTGTGGGGTCAGGCGATTATAAACCAGAAATGGCATATCGTC
GTAAGAACAAGTATTTCTTCGGAATCGATAAAGGAGATTTCAAGGTCCAG
TTAAATGTTCGACATGGATCTATCGCTCAATTGGAACGATTGAGAGATCA
AGTAATTCATGTCTATTTCAAAACATTTCAAAGTTTGACATTCGAATTCT
CAAAATCCATTGTTGATGTGAACAATAATAAAAAATTGACGGCCGCCAGA
TTAAATTACAGCATAGGAAAAGGGGAAAAATCTGTTCTCTACATTACAAC
CCCCATGACTAAAGTTTTGAAAACATTTGCTGTTGGCTCGTATTTATCTG
GAACATTATATTTGTATAAAAATGAAACATTAAGGAAAACTGTTTCGTAT
CCCTTTCAATATATATTTACCGCTCATCAATCTGCAACAGAAAAAGGAGA
AAATTCTCAACATTTTAAGTTACCTCTACATTTTACTGAATGTTTGATGA
ATTATTTGCGAAATGAAGATATTGGGAGAAATTCTCCAGTCCAATCTCTG
CCGTTAGAGGATGTCAGTGTTGTATCGTCGACTATGACTAAAGAAAAATT
ATTAGAAGATCATATCGAATTTCTTACTGAAAAACCAGAATTCCGAGAAG
GTCTACTCAAATATCTTATTTCTTGGATTAAAGAGTTCTATAAAAAGTCT
GACAGAGATAGCATTGAAAAATTAATTAAATCAATAAATGGTGACAAGTC
CAATTCTGATTTTGAATTAGCTCAGCTGCGGTTATTGCAAAAGAACGGCT
TGACTGATTTAAGACCTGAGGACAGATGGTCCAAAGTCGATGATATTGTT
AATAAACTAATCACATTATGGGACACTAAGGATTTATCAGAATATGTGGG
ATCCAAGTTTTCAGATGCAAGTTTGTCTTTGACAAAAGATCAGAAATCAA
AATATGATCAAAACAAACAGCATTTAACTGAAGTTCTGTGCATTTATGGT
CTGTGTTTATGTGAAATAATATTGGATACCGAGAAAGATTATTCTGAAGA
CGACAAAGACAATTGCAGTGAAATTCGCGACAAATTGAATGGCGTATATT
CACAAGTCTGTAGATTTGTGTCTCCATGGGATAACAATGCCACATGTTTA
CCGTTTTTCGTTATGCATTCCTTTGTTTTTAAATGTTACGGTAGAATGCT
TAAAATTCTCCTGAAAAGTTATGAAGATCAATGTCTCTTTCACACGGCTT
CGTTGATTAAAGAAGTACTATTAAAATTAGAATGGAATGTCTTAGCTCAA
TACTATGAACAATTAATCCCATTAAAACACCCGATCAGTTGTCAGCTGCA
ACACAGGAGATAATTTCAGCTCTTTTTTTCATTTCTTTATAGTGCTGATT
TCATTATTTAAATTAGATTTCGATATTACCTATCATTTTAGACAATTGTG
ATTAATCATATCCAGAAATTGGTTATTATTTATTATTATAATTATTATTA
TTA
back to top

protein sequence of SMED30005274-orf-1

>SMED30005274-orf-1 ID=SMED30005274-orf-1|Name=SMED30005274-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1405bp
MSSSILADDSFYFVQSLIPKNHTQAIDFIKENPNYDGRNVRIAIWDTGVD
PASEGLQITTEGKPKLIHMSDTSGSGDVHMLKEVKPDCQNKITLLSNREI
IIPESWNIGDQSLRIGVKSAADIFPAAVISRLSKDYKENIWSKEISRLHA
ELLNKKKKPNQHSTIFDLENQFLKECLEVIEKSYEYPIPVLDCIVFQKDD
WVAFVDTTCLNPNMKLEDVPLLYSFPKYRQFTSFGGKTNLNFGVNIHDNG
KILEIVSCSGSHGTHVASIAAGYFPLRPECNGIAPGAEIVSIKISDNRLV
SMETGMALAYAAKLTVELKCDIVNLSFGESSMQPNCGRICQIMQELVSKH
GIVFCSSSGNDGPALSTVGSPGGTTDLLFGISPLVFPDMVESNYSLPVDN
ISDLSPQVYTWASRGPTTDGSLGIHVAAPGSAITSVAGWQNRTIGLMNGS
SMSSPNACGGISLLISAAHQLKKPITPWLLALSTRNTASVIQYIGRLSQG
NGLLQIKSSFEYIEKYWLNLDNQITAKQGDSLVFKESCLSLKENDGLSNK
IQSNDFNVSVKNESTPVLTNVGNHLLTNFKTGQTPLHLFRIKCNLSNGNR
GILLREPFEISQKRYFTINISPDFNEEMMEISDQVNIQLYLHLVCSASWV
TCPRFFSLYNQERSISIQIDPTMLRRDLPEFELADSSESGDYGIYFTEIE
FHCLEFSHLGALARLPITVFKSESISSLEWHHTNKFTAKKKTVRHFIATP
HGADSLIMTIKPVSIVDGSGRFELRIMQVQPNFSTVNSEISKSFSFEKKS
NMTINESVAYMLTGHTSSTIEIAVAQYWSATNEAELEYSLDFHGLRISTE
SVKMLSSDNHYRLLIESQLRLEEISPAISLNYLVLPLRPYKDELTYIKKS
VSGDKELINLELFYTFNNPKPGSVGIFCPALGNLLYENDFYCQMYHIFDS
NGRIVGSGDYKPEMAYRRKNKYFFGIDKGDFKVQLNVRHGSIAQLERLRD
QVIHVYFKTFQSLTFEFSKSIVDVNNNKKLTAARLNYSIGKGEKSVLYIT
TPMTKVLKTFAVGSYLSGTLYLYKNETLRKTVSYPFQYIFTAHQSATEKG
ENSQHFKLPLHFTECLMNYLRNEDIGRNSPVQSLPLEDVSVVSSTMTKEK
LLEDHIEFLTEKPEFREGLLKYLISWIKEFYKKSDRDSIEKLIKSINGDK
SNSDFELAQLRLLQKNGLTDLRPEDRWSKVDDIVNKLITLWDTKDLSEYV
GSKFSDASLSLTKDQKSKYDQNKQHLTEVLCIYGLCLCEIILDTEKDYSE
DDKDNCSEIRDKLNGVYSQVCRFVSPWDNNATCLPFFVMHSFVFKCYGRM
LKILLKSYEDQCLFHTASLIKEVLLKLEWNVLAQYYEQLIPLKHPISCQL
QHRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036852Peptidase_S8/S53_dom_sf
IPR015500Peptidase_S8_subtilisin-rel
IPR000209Peptidase_S8/S53_dom
IPR022229Peptidase_S8A_TPPII
IPR022398Peptidase_S8_His-AS
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0004177aminopeptidase activity
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0008240tripeptidyl-peptidase activity
GO:0016787hydrolase activity
GO:0042277peptide binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016604nuclear body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015500Peptidase S8, subtilisin-relatedPRINTSPR00723SUBTILISINcoord: 258..271
score: 45.08
coord: 37..56
score: 33.62
coord: 448..464
score: 40.25
IPR036852Peptidase S8/S53 domain superfamilyGENE3DG3DSA:3.40.50.200coord: 20..111
e-value: 1.1E-6
score: 29.9
coord: 202..519
e-value: 3.0E-58
score: 199.5
IPR036852Peptidase S8/S53 domain superfamilySUPERFAMILYSSF52743Subtilisin-likecoord: 27..517
IPR022229Peptidase S8A, tripeptidyl peptidase IIPFAMPF12580TPPIIcoord: 867..1054
e-value: 2.2E-29
score: 102.3
IPR000209Peptidase S8/S53 domainPFAMPF00082Peptidase_S8coord: 37..488
e-value: 5.5E-61
score: 206.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.3170coord: 588..733
e-value: 2.5E-20
score: 74.7
NoneNo IPR availableGENE3DG3DSA:1.25.40.710coord: 1161..1400
e-value: 3.5E-21
score: 78.1
NoneNo IPR availablePANTHERPTHR43806FAMILY NOT NAMEDcoord: 12..517
NoneNo IPR availablePANTHERPTHR43806:SF14TRIPEPTIDYL-PEPTIDASE 2coord: 12..517
coord: 574..1114
NoneNo IPR availablePANTHERPTHR43806FAMILY NOT NAMEDcoord: 574..1114
NoneNo IPR availablePROSITEPS51892SUBTILASEcoord: 20..510
score: 19.219
IPR022398Peptidase S8, subtilisin, His-active sitePROSITEPS00137SUBTILASE_HIScoord: 262..272