EF-hand domain-containing family member C2

Overview
NameEF-hand domain-containing family member C2
Smed IDSMED30005253
Length (bp)2358
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain-containing family member C2 (SMED30005253) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain-containing family member C2 (SMED30005253) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain-containing family member C2 (SMED30005253) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain-containing family member C2 (SMED30005253) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005253

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005253SMESG000076759.1 SmedASXL_012092SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005253SMESG000076759.1 dd_Smed_v4_6035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005253SMESG000076759.1 dd_Smed_v4_6035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005253SMESG000076759.1 dd_Smed_v4_6035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005253SMESG000076759.1 dd_Smed_v4_6035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30005253SMESG000076759.1 dd_Smed_v4_6035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005253SMESG000076759.1 dd_Smed_v6_6035_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005253SMESG000076759.1 OX_Smed_1.0.16442ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005253SMESG000076759.1 dd_Smed_v4_6035_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30005253SMESG000076759.1 dd_Smed_v4_6035_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30005253SMESG000076759.1 dd_Smed_v4_6035_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Human
Match: EFHC2 (EF-hand domain containing 2 [Source:HGNC Symbol;Acc:HGNC:26233])

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 329/710 (46.34%), Postives = 452/710 (63.66%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEP-LPSIGTQTERTLLNVLGH--PQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPII-RHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYP 2179
            MALPLLPGN FNRN+GKEK+HKS H+   N V  +  D+K GIGG PL GQ+I    S YP GDGS +P+W+AFDKQVL FDAY +E V ++ +  YRIR  K+ FY EDDTIQV EP  +NS L QGT IRRHRI  P P++  FYTV+ FNVG E+ FYG+ F+I  CD FT NFLRK+GV+V  P + P+D Y   R+ + E ++PLRPYE  D LKQFL +   +L FFC WDDS +++GD+RE+++HYFL DDT+EI+E++P ++GRDA   FL+R KLPK   P +   G  T+R +LN  G     +   YL D  K G    EFY D DL +G  INV+GRK ++ D D FTK YY  KYG+ NFT++  +     P I R  PP+NG+GSEEDSL NC  L P P +R+F KFMEKD  G +S++LRF A+LVTDK +D DR F+IS++L DD+  VFE + +NSG  GG FL+RS++KKPGQE + +EL +Y +A +++IG  + +N + F + +ADEY   YME+N  ++P SN+   + KL+Q+   K RE+   FK  D+++   V ++  + +L +  +   L + E  TIARHY        ++  LI +  ++ +K  FE F       +  D+     L   ++ ++ K   +P+S DLL+ L  +   +     IDY      +NWR NP P
Sbjct:    1 MALPLLPGNSFNRNVGKEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPEVKNSGLLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPVQCPEDPYMKIRREVVEHVEPLRPYESLDTLKQFLQYHGKILCFFCLWDDSVSMFGDRRELILHYFLCDDTIEIKELLPHSSGRDALKMFLRRSKLPKNCPPRVYQPGQITDRAVLNSYGDFIKNQADGYLFDRYKLGKVDQEFYKDSDLSLGVTINVWGRKVLLYDCDEFTKSYYKSKYGIENFTSVSCKPPSPPPKIERKFPPYNGFGSEEDSLRNCIDLKPTPHRRNFKKFMEKDSYGSKSNILRFFAKLVTDKCVDLDRMFVISYYLGDDTISVFEPIERNSGIAGGMFLKRSRVKKPGQEVFKSELSEYIKAEELYIGVTVNVNGYLFRLLNADEYTLNYMEQNTDKYPFSNLKLALQKLKQE-EGKSRELKQVFKAADSKHTNMVDYNTFRDIL-MSLTVGNLAEQEFVTIARHYRVPEGTCSDMDFLIALAHEKFKKNMFENFDTFIYSCVYEDREKKNVLPTKDIKRLCKSSRLPLSDDLLESLLSR--FEDSEKQIDYKSFFSALNWRKNPVP 706          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 379.407 bits (973), Expect = 4.764e-121
Identity = 259/697 (37.16%), Postives = 356/697 (51.08%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFM------FGDDK---NGIGGAPLPGQRIGAPTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERK---DKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKV-EFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYST-ELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQC 2101
             LP LPG  F ++  K  +H+S     +N    +       G D+   N +  A L      AP   Y     A     +PA +AFDK+VL FDAYFQE V    EEQYRIR   + +YLEDD++ VIEP   NS + QG +I+R R+AK    DH  Y   D N GI +  YGK FR++ CD+FT  FL   G+++  PEK+  D Y   RK      QPLR Y      D+LKQFL  D+ VLRF+  WDD+D++YG+ R  +IHY+L DDTVEIREV   N GRD  P  + RQ++PK +             + N    PQ         L+  D +V E+YT +D  +G  + + GR F I D D FT+ YY  K+G+T+   ID       P+ +  PP+NG+G  EDS  NC  L+P+ PK+D IK +  D K     VLR+ A L +    DKDRRF+ S+FLA D   +FE  ++NSG +GGK+L R+K+ KP    YST + P YY  SD  IGA+IE+   +F I D DEY  +YME N  ++    +  I   +R++ A    E +S   E D                      QEL                       ALI  IQ+QL+  + ++   I+  F   DK  +  ++R    KI + L+VP+   L++ L   C
Sbjct:    8 GLPFLPGTSF-KDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDH--YHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRK------QPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVL-------------VENAKNFPQCV-------LEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNK-----VLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKP----YSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAP-EAESKQTEKDP-------------------GVQEL----------------------EALIDTIQKQLKDHSCKD--NIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMC 622          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 379.022 bits (972), Expect = 6.954e-121
Identity = 238/592 (40.20%), Postives = 324/592 (54.73%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFM------FGDDK---NGIGGAPLPGQRIGAPTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERK---DKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKV-EFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYST-ELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFA------SKEREIDSHFKEVDA 1768
             LP LPG  F ++  K  +H+S     +N    +       G D+   N +  A L      AP   Y     A     +PA +AFDK+VL FDAYFQE V    EEQYRIR   + +YLEDD++ VIEP   NS + QG +I+R R+AK    DH  Y   D N GI +  YGK FR++ CD+FT  FL   G+++  PEK+  D Y   RK      QPLR Y      D+LKQFL  D+ VLRF+  WDD+D++YG+ R  +IHY+L DDTVEIREV   N GRD  P  + RQ++PK +             + N    PQ         L+  D +V E+YT +D  +G  + + GR F I D D FT+ YY  K+G+T+   ID       P+ +  PP+NG+G  EDS  NC  L+P+ PK+D IK +  D K     VLR+ A L +    DKDRRF+ S+FLA D   +FE  ++NSG +GGK+L R+K+ KP    YST + P YY  SD  IGA+IE+   +F I D DEY  +YME N  ++    +  I   +R++ A      SK+ E D   +E++A
Sbjct:    8 GLPFLPGTSF-KDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDH--YHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRK------QPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVL-------------VENAKNFPQCV-------LEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNK-----VLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKP----YSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEA 561          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 378.637 bits (971), Expect = 8.723e-121
Identity = 238/592 (40.20%), Postives = 324/592 (54.73%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFM------FGDDK---NGIGGAPLPGQRIGAPTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERK---DKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKV-EFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYST-ELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFA------SKEREIDSHFKEVDA 1768
             LP LPG  F ++  K  +H+S     +N    +       G D+   N +  A L      AP   Y     A     +PA +AFDK+VL FDAYFQE V    EEQYRIR   + +YLEDD++ VIEP   NS + QG +I+R R+AK    DH  Y   D N GI +  YGK FR++ CD+FT  FL   G+++  PEK+  D Y   RK      QPLR Y      D+LKQFL  D+ VLRF+  WDD+D++YG+ R  +IHY+L DDTVEIREV   N GRD  P  + RQ++PK +             + N    PQ         L+  D +V E+YT +D  +G  + + GR F I D D FT+ YY  K+G+T+   ID       P+ +  PP+NG+G  EDS  NC  L+P+ PK+D IK +  D K     VLR+ A L +    DKDRRF+ S+FLA D   +FE  ++NSG +GGK+L R+K+ KP    YST + P YY  SD  IGA+IE+   +F I D DEY  +YME N  ++    +  I   +R++ A      SK+ E D   +E++A
Sbjct:    8 GLPFLPGTSF-KDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDH--YHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRK------QPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVL-------------VENAKNFPQCV-------LEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNK-----VLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKP----YSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEA 561          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 378.637 bits (971), Expect = 1.303e-120
Identity = 238/592 (40.20%), Postives = 324/592 (54.73%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFM------FGDDK---NGIGGAPLPGQRIGAPTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERK---DKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKV-EFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYST-ELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFA------SKEREIDSHFKEVDA 1768
             LP LPG  F ++  K  +H+S     +N    +       G D+   N +  A L      AP   Y     A     +PA +AFDK+VL FDAYFQE V    EEQYRIR   + +YLEDD++ VIEP   NS + QG +I+R R+AK    DH  Y   D N GI +  YGK FR++ CD+FT  FL   G+++  PEK+  D Y   RK      QPLR Y      D+LKQFL  D+ VLRF+  WDD+D++YG+ R  +IHY+L DDTVEIREV   N GRD  P  + RQ++PK +             + N    PQ         L+  D +V E+YT +D  +G  + + GR F I D D FT+ YY  K+G+T+   ID       P+ +  PP+NG+G  EDS  NC  L+P+ PK+D IK +  D K     VLR+ A L +    DKDRRF+ S+FLA D   +FE  ++NSG +GGK+L R+K+ KP    YST + P YY  SD  IGA+IE+   +F I D DEY  +YME N  ++    +  I   +R++ A      SK+ E D   +E++A
Sbjct:    8 GLPFLPGTSF-KDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDH--YHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRK------QPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVL-------------VENAKNFPQCV-------LEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNK-----VLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKP----YSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEA 561          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Celegans
Match: efhc-1 (EF-Hand domain-Containing protein 1 homolog [Source:UniProtKB/TrEMBL;Acc:Q9XWW8])

HSP 1 Score: 92.4337 bits (228), Expect = 1.785e-19
Identity = 73/222 (32.88%), Postives = 115/222 (51.80%), Query Frame = 2
Query:  278 AFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVH--DFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGD--KREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEP 931
            A +  VL FDAY +E   +  EE +RIR  K+ ++L DDTI V EP   N+    G I RR ++  PA N      VH  D NVG ++  +  ++RI SCD FT +FL + G +V + E++P+D + L R+       P  P +R     +F++    ++   C+ D  ++ +G   KR   ++ + +D TV + E      G+     FLKR  LP  ++P
Sbjct:   74 AANSAVLSFDAYAEEDGLD--EEIHRIRIFKINYHLNDDTITVNEPFVDNTGYLHGRIFRRQKV--PAHNRIGKPYVHWSDLNVGTDINLFQTIYRITSCDTFTRSFLEEHGTKVNEDEELPEDPW-LVRRRGAPRTAPKLPDQR-----EFINRPPMLVYRCCWLDHMNDFHGCRMKRIFKMYVYCSDHTVALIEETKEFEGQ----LFLKRIALPFPVQP 281          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Fly
Match: Efhc1.2 (gene:FBgn0034487 transcript:FBtr0086316)

HSP 1 Score: 437.958 bits (1125), Expect = 2.843e-142
Identity = 266/756 (35.19%), Postives = 412/756 (54.50%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGD-------DKNGIGG----APLPGQ--RIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRK---AMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTA------IDTQNY-RGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFK-EVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSV--KDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYP--APVSDVETLVSSGELL-KGKCVE 2245
             +P+LPG  F  + GK ++ +         +  M  D       + NGI       P+P Q   + AP +       +K+P W+A+DKQVL F+AYF+E++ E     Y++R  K+ FYLED T+QV EP+  NS +PQG ++ R RI K  P D  F ++ D NV  +++ + +++ I  CD FT  FL + G+ V + ++ P D     RK                +K    QFL+ DR VL+F  +W+D    +GD R++ + Y+LADDT++I+E  P N+GR+   TFLKR KLPK    LP  G QT  TLLNVLG+  R  RY+ D L TG  +V+ YTD+DLQIGA +NVFGR  V+T  D FT+ YY  KYG+  F+        D + Y +G    R  PP+NGWGS EDS GNC  + P+PP+ DF K  + D       +LRF A+L++    + +R F+IS+FLADD+  ++ET  +NSGFLGG+FL+R+++  PGQ+ YS+  P+YY+A+D +IG  + + +  F I  ADE+   YME++  EFP ++I +IM K+R+      ++     K + D  +   V+F  L+S L  + S+  L +HEI T+ R ++A        + + +    Q +L++  +    Q+ +     +      +   ++    +   +P S +L++ +    L +   + I+    L F N R +  P  AP++    L      L KG+ V+
Sbjct:    6 GMPMLPGAQFY-DRGKRRHPRQQTLMHYQGIQ-MLSDRREPELVEPNGIVADPKCPPVPAQLNSLWAPKAT------TKLPPWLAYDKQVLCFNAYFKENLTEIYHAPYQVRKVKIFFYLEDGTMQVTEPKVENSGIPQGCLVHRQRIPKAPPTDREFISIFDLNVDTDVQIFDRVYHISGCDVFTRQFLNRAGIFVPEAQQEPCDPTTEIRKRSGLKQTGNTATSALPKKHAFAQFLEFDRRVLKFQGYWNDRSE-FGDVRKLEVCYYLADDTIDIKEKFPRNSGREGPTTFLKRGKLPKEFSGLPLPGQQTAMTLLNVLGNSMRDVRYVADPLNTGQKEVQHYTDQDLQIGAVLNVFGRSVVLTSCDQFTQSYYREKYGIQEFSPQPIPERSDIRPYTQGGMGSRRLPPYNGWGSHEDSEGNCITVEPKPPQADFKKLFKYD-----GCILRFGAKLISAIRDNGERDFVISYFLADDTLQIYETSRRNSGFLGGEFLKRARVPLPGQDMYSSSRPEYYRANDFYIGRTMTLKDHIFHIVSADEFTLMYMEQHPSEFPVADIQKIMQKIREAVRPDYKQFVLRCKPDGDLGDYTAVSFETLRSTLLSYLSKDCLLNHEIVTVCRFFSAEQAMPPSCDRNRVRAAAQLELKRALWNGMDQLNDHLSHINPACKPYISEGQVRSTLRGCRLPFSLELVEDIL-MVLQRNGQNEIEVRDFLAFFNMRNDQVPDIAPLNIAFELCPKLPFLHKGRLVD 746          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Fly
Match: Efhc1.1 (gene:FBgn0030691 transcript:FBtr0074192)

HSP 1 Score: 414.461 bits (1064), Expect = 7.013e-133
Identity = 232/624 (37.18%), Postives = 364/624 (58.33%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDK------NGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQP-LRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAI-------DTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSH----FKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAA 1882
             +PLLPG +F R++ K  Y K     +   ++ M  D +      +G     +    +GA +S YP   G +MP W+A+DK+VL F AYF++++ E     Y +R  K+ +YLED T+++ EPR  NS + QG ++ R R+ K  P D+ F ++ D NV   ++ + + + I  CD FT  FL K G+ V  P K P D     RK  ++     L P  +     QFL +DR +L+F  +WDD    +GD R++ + Y+L+DDT+EI+E    N+GRD    FLKR +L +  E L   G  T  TLLNVLG   R  RY +D L TG+ ++ +Y ++DLQIG+ INV+GR  VIT++D FT+ YY  +YG+ +FT +       D  ++R E   R  PP+NGWGS EDS+GNC  + P+PPK DF KF++ DR     +VLRF A++++    + +R F+IS++L DD+  + E  ++NSGFLGG+F++R++++ PGQER+S + P+YY   +  +G+ + + +F F I  ADEY   YME +   FP +N+  IM K++    ++  E          +++ +  + V+F   +  L I     +++DHEI ++ RH++A
Sbjct:    6 GMPLLPGTLF-RDVSKGHYPKPQSLANVQGLS-MLSDRQQPAPVESGSVTVDISCPPVGA-SSIYPPRSGPRMPPWLAYDKKVLCFHAYFKQTLQEVYHAPYLVRKVKIYYYLEDGTLEIYEPRVDNSGIVQGCVVHRQRVQKAPPCDNEFMSLIDLNVDQTVQIFDRQYHITDCDPFTRTFLNKRGITVPDPVKSPCDPTEEQRKRENQPRSGNLIP--KNHPFAQFLKYDRQILKFQAYWDDRTE-FGDVRKLELCYYLSDDTIEIKEQHIRNSGRDGPTVFLKRGRLAREFEGLQLPGQMTPMTLLNVLGTNMRNVRYCVDPLNTGNKEIHYYREKDLQIGSVINVYGRAVVITELDPFTQNYYRQRYGIQDFTPLPIPARSDDCADHRSE---RQLPPYNGWGSYEDSVGNCISVEPKPPKSDFKKFIKYDR-----YVLRFGAKMLSTIKANCERIFVISYYLCDDTLQIQEIAVRNSGFLGGEFMKRTRLELPGQERFSCKQPQYYMPWNFFVGSTMSLKDFIFHIVSADEYTLMYMEHHPEIFPHANVGVIMEKVKSALQNRMAEFVGSCVPDCTDLEKKRDVFVSFESFKGAL-ISIMGNQISDHEIISLCRHFSA 614          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Zebrafish
Match: efhc2 (EF-hand domain (C-terminal) containing 2 [Source:NCBI gene;Acc:567323])

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 364/748 (48.66%), Postives = 503/748 (67.25%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLP--SIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVSSGELLKGK----CVEDINYNQLLSDLLGA 2287
            MALP+LPGN  NRNLGK+K+HKS HFD  N V  M G +K GIGG  L GQ   A  S +P G+GS  PAW+AFDKQVL FDAYF E V +RREE+YR+R CK+ FYLEDDTIQV+EP  +NS +PQGT+IRRHRI  PAP D  FY VH FN+  E+ FY + F I  CD FT NFL K+GV++  P   P D Y   R+ ++E+M+PLRPYER D LKQFL+HDR VLRF+C+WDDS++++GD RE+++HYFLADDT+E+ EV+P N+GRD  P FL R KLPK+  P+P    G  T+RT+LNV G   +GGRY++D+LKTG  + EFY D DL IGA INV+GR+ +I D D FTKEYY  KYG+ +F +I  +        +  PP+ G+GSEEDSL +C GL+P+PP++DF K MEKDR+GL S+VLRF  +++TD  +DK+R FII F+L DD+  VFE   +NSG +GGKFLER ++KKPGQE + +E+ +Y+ A D+++GA + +N+  F + DAD++ + YME++  EFP++NI  I+ K++     +++++   F   D  +  ++ +   +++L     + EL++HEI T+ R Y+ R   +VNV  ++ V Q  L+K NFE+FS++   F   D+    QL   E   I K   +P+S DLL+ L ++     + + IDY+  L  INWR NP PA +   E  V      +G+     V+ INY+ LL D+ G+
Sbjct:    1 MALPMLPGNSVNRNLGKDKFHKSQHFDYSNGVAMMVGTEKPGIGGDLLLGQSARAKYSRFPKGEGSGAPAWLAFDKQVLCFDAYFNEDVPQRREEKYRVRKCKIYFYLEDDTIQVVEPEFKNSGIPQGTLIRRHRIPLPAPKDDCFYNVHHFNINQEVVFYSRNFMITDCDPFTRNFLIKMGVRLNPPASTPADPYTTLRQELEENMKPLRPYERLDTLKQFLEHDRQVLRFYCYWDDSESMFGDPRELILHYFLADDTMEMYEVVPPNSGRDTVPKFLHRGKLPKHA-PIPKRQPGEITDRTVLNVFGPVGQGGRYILDSLKTGALEEEFYKDSDLTIGAVINVWGRRVLICDCDYFTKEYYRSKYGIEDFPSISYKASPPPKPAKQVPPYTGFGSEEDSLCSCQGLLPKPPQKDFKKLMEKDRQGLVSNVLRFVGKMLTDSPVDKERVFIICFYLTDDTIAVFEPPQRNSGVIGGKFLERGRVKKPGQELFKSEMSEYFTAQDLYVGAHLLLNSQPFQLVDADDFTFSYMEQHADEFPKANIGTIISKVKSISEEQQKKVKQFFTMSDPSSTGSLPYESFRTLLADL--DVELSEHEIMTLGRVYSVRQQPEVNVGLMLAVAQDHLKKKNFEKFSEMIQAFTHEDRDRCGQLSSKEARIICKAFRLPLSDDLLRALLEK--FAGESEKIDYHAFLSGINWRENPVPAVLP--EDTVKFDADWRGEAPEPAVKTINYSLLLEDVFGS 741          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Zebrafish
Match: efhc2 (EF-hand domain (C-terminal) containing 2 [Source:NCBI gene;Acc:567323])

HSP 1 Score: 393.66 bits (1010), Expect = 8.942e-131
Identity = 190/323 (58.82%), Postives = 237/323 (73.37%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLP--SIGTQTERTLLNVLGHPQRGGRYLIDNLK 1024
            MALP+LPGN  NRNLGK+K+HKS HFD  N V  M G +K GIGG  L GQ   A  S +P G+GS  PAW+AFDKQVL FDAYF E V +RREE+YR+R CK+ FYLEDDTIQV+EP  +NS +PQGT+IRRHRI  PAP D  FY VH FN+  E+ FY + F I  CD FT NFL K+GV++  P   P D Y   R+   ++M+PLRPYER D LKQFL+HDR VLRF+C+WDDS++++GD RE+++HYFLADDT+E+ EV+P N+GRD  P FL R KLPK+  P+P    G  T+RT+LNV G   +GGRY++D+LK
Sbjct:    1 MALPMLPGNSVNRNLGKDKFHKSQHFDYSNGVAMMVGTEKPGIGGDLLLGQSARAKYSRFPKGEGSGAPAWLAFDKQVLCFDAYFNEDVPQRREEKYRVRKCKIYFYLEDDTIQVVEPEFKNSGIPQGTLIRRHRIPLPAPKDDCFYNVHHFNINQEVVFYSRNFMITDCDPFTRNFLIKMGVRLNPPASTPADPYTTLRQEA-KNMKPLRPYERLDTLKQFLEHDRQVLRFYCYWDDSESMFGDPRELILHYFLADDTMEMYEVVPPNSGRDTVPKFLHRGKLPKH-APIPKRQPGEITDRTVLNVFGPVGQGGRYILDSLK 321          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Zebrafish
Match: efhc1 (EF-hand domain (C-terminal) containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1300])

HSP 1 Score: 360.533 bits (924), Expect = 4.749e-115
Identity = 214/565 (37.88%), Postives = 313/565 (55.40%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKN---GIGGAPLPGQRIGAPTSNYPAGDGSKM--------------PAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYM----EPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRI 1696
             LP LPGN F R+L K  +H++   D KN     +   +    GIG  PL    I     N    D   +              PA  A+DK+VL F  YF++ V    +E +RIR     ++LEDD+I V EP   NS +PQG +I+R R++K    D   Y   D NVG+++  +G+++RI  CD FT +F+   G+ + + E IP D Y   R+A ++    + PY+   +L++FL  DR VLRFF  WDDSD+LYG+KR + +HY+L DD+VEI E   AN+GRD  P  L+RQK+PK++    EP PS        +L V  H               D K E++  +D ++G  +N+ GR+F++ D D FT +YY + +               + I R  PP+NG+GS EDSL NC  L+PQPPK++ IK +E D K     VLR+ ARL +   LD+ RRFI+SF LADD   +FE   +NSG +GGKFLE+++I KPG    + E P+YYQ +D+ +GA +E+   +F + DAD +   ++E    + P+  +  +
Sbjct:    8 GLPFLPGNTF-RDLTKSAFHRAQTLDFKNG----YAQPRRPVVGIGQDPLLSVNISHSERNQLITDIPNLTYGTDRSHLPLEFIPAHAAYDKKVLRFYGYFRQEVLHSWDEHFRIRPVVFYYHLEDDSICVTEPPVENSGIPQGKLIKRQRLSKNPRGD--LYHWKDLNVGMDINLFGEVYRITHCDPFTQDFMESQGIVLNEFESIPSDPYT-ARRAHNQQTH-ITPYDHNHQLERFLALDRQVLRFFALWDDSDSLYGEKRPVTLHYYLVDDSVEICEHHEANSGRDPFPVLLRRQKIPKHIKPTCEPFPS-------CVLEVSPH---------------DVK-EYFCPQDFRVGEEVNLMGRRFLLYDCDDFTHKYYQHHHPDIPIKPFTVDTRTQQDIKRVIPPYNGFGSLEDSLQNCLSLIPQPPKKNVIKLLENDHK-----VLRYAARLDSQNRLDEGRRFILSFHLADDMISIFEKSTRNSGIIGGKFLEKTRIPKPGS---TAEKPEYYQPADLCVGATVEVFGHRFVVTDADRFVLSFLESQSHQTPEHTLSSL 532          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Zebrafish
Match: efhb (EF-hand domain family, member B [Source:ZFIN;Acc:ZDB-GENE-091001-1])

HSP 1 Score: 54.6842 bits (130), Expect = 3.579e-7
Identity = 33/119 (27.73%), Postives = 63/119 (52.94%), Query Frame = 2
Query: 1910 ALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVSSGELLKGKCVEDINYNQL 2266
            AL+  ++Q L+K N+++FS +   F   DK+G  ++++ ++ +     ++ IS  LL  L D C V  D  LID+ +   F+NW+      P+S +E  + +GE +      +++   L
Sbjct:  305 ALVSAVRQHLKKSNYQKFSSLLEAFRYYDKKGLGKIDKEDLREACHQFNMIISDPLLDELMDYCDVHKD-GLIDFVEFSNFLNWKDK---MPISRMEQDILTGERVAWTAPANMHRTHL 419          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 368/708 (51.98%), Postives = 498/708 (70.34%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYM-EPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPA 2182
            MALP LPGN FNRNLGKEK+HKS HF   N+++   G++K G+GGAPL GQ +    S +P G GS  P+W+AFDKQVL FDAYF+E V++RREE YRIR CK+ FYLEDDTIQV+EP  +NS +PQGTIIRRHRI  PAPND  FYTV   N+  ++ FY K++RI++CDEFT NFLRKLGV++  P+ +P D Y+ TRK M+E MQPLRPYER D LKQFL+HDRHVLRFFCFWDD+  L+GD RE+V++Y+LADDTVEI E+IPAN+GRD  P FL R KLPK   + +P  G  T RT+LNV G    GGRY++DNLKTG    EFY D DL IGA +NV+GRK ++ D D FTK YY  K+G+ +FT +  +  +     +  PP+NG+GSE D+L +C  L+P+PP+RDF KFMEKDR GLES+VLRF ARL TD  +DK+R+FI+S+FL+DD+  VFE   +NSG +GGKFLERS++KKPGQ+ + +EL +Y++  D+ +GA +  N F F + DADEY + YME+N  EFP S+I  I  KLR+   +K REI  HF+  D      + +   +++L +   E +LT+HEI T  R+Y+ R   ++++ +L  + Q+QL+K +FE FS++ ++F+  D+  N  L   +   I K   +P++ D L++L ++     + D ++Y  ++  +NWR NP  A
Sbjct:    1 MALPFLPGNSFNRNLGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPLLGQNLKPKFSVFPKGVGSDAPSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEE-MQPLRPYERIDTLKQFLEHDRHVLRFFCFWDDT-TLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPKSSPQNVPQPGQVTARTVLNVFGPMGHGGRYILDNLKTGAVHEEFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQHFEANDPTGTSHMPYEIFRNLL-VDIYENQLTEHEIMTTGRYYSIRDKPEIDLGSLTAIAQEQLKKKSFENFSKLSDVFVYNDQEKNGWLSFQKTLTICKAFKIPLADDFLRVLLEKH--TENGDQVNYISLVTGLNWRENPTAA 703          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 368/708 (51.98%), Postives = 498/708 (70.34%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYM-EPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPA 2182
            MALP LPGN FNRNLGKEK+HKS HF   N+++   G++K G+GGAPL GQ +    S +P G GS  P+W+AFDKQVL FDAYF+E V++RREE YRIR CK+ FYLEDDTIQV+EP  +NS +PQGTIIRRHRI  PAPND  FYTV   N+  ++ FY K++RI++CDEFT NFLRKLGV++  P+ +P D Y+ TRK M+E MQPLRPYER D LKQFL+HDRHVLRFFCFWDD+  L+GD RE+V++Y+LADDTVEI E+IPAN+GRD  P FL R KLPK   + +P  G  T RT+LNV G    GGRY++DNLKTG    EFY D DL IGA +NV+GRK ++ D D FTK YY  K+G+ +FT +  +  +     +  PP+NG+GSE D+L +C  L+P+PP+RDF KFMEKDR GLES+VLRF ARL TD  +DK+R+FI+S+FL+DD+  VFE   +NSG +GGKFLERS++KKPGQ+ + +EL +Y++  D+ +GA +  N F F + DADEY + YME+N  EFP S+I  I  KLR+   +K REI  HF+  D      + +   +++L +   E +LT+HEI T  R+Y+ R   ++++ +L  + Q+QL+K +FE FS++ ++F+  D+  N  L   +   I K   +P++ D L++L ++     + D ++Y  ++  +NWR NP  A
Sbjct:    1 MALPFLPGNSFNRNLGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPLLGQNLKPKFSVFPKGVGSDAPSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEE-MQPLRPYERIDTLKQFLEHDRHVLRFFCFWDDT-TLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPKSSPQNVPQPGQVTARTVLNVFGPMGHGGRYILDNLKTGAVHEEFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQHFEANDPTGTSHMPYEIFRNLL-VDIYENQLTEHEIMTTGRYYSIRDKPEIDLGSLTAIAQEQLKKKSFENFSKLSDVFVYNDQEKNGWLSFQKTLTICKAFKIPLADDFLRVLLEKH--TENGDQVNYISLVTGLNWRENPTAA 703          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 360/708 (50.85%), Postives = 484/708 (68.36%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYM-EPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPA 2182
            MALP LPGN FNRNLGKEK+HKS HF   N+++   G++K G+GGAPL GQ +    S +P G GS  P+W+AFDKQVL FDAYF+E V++RREE YRIR CK+ FYLEDDTIQV+EP  +NS +PQGTIIRRHRI  PAPND  FYTV   N+  ++ FY K++RI++CDEFT NFLRKLGV++  P+ +P D Y+ TRK M+E MQPLRPYER D LKQFL+HDRHVLRFFCFWDD+  L+GD RE+V++Y+LADDTVEI E+IPAN+GRD  P FL R KLPK   + +P  G  T RT+LNV G    GGRY++DNLKTG    EFY D DL IGA +NV+GRK ++ D D FTK YY  K+G+ +FT +  +  +     +  PP+NG+GSE D+L +C  L+P+PP+RDF KFMEKDR GLES+VLRF ARL TD  +DK+R+FI+S+FL+DD+  VFE   +NSG +GGKFLERS++KKPGQ+ + +EL +Y++  D+ +GA +  N F F + DADEY + YME+N  EFP S+I  I  KLR+   +K REI  HF+  D      + +   +++L +   E +LT+HEI T  R+Y+ R   ++++ +L  + Q+QL+K +FE FS++ ++F+  D+  + +                                 + D ++Y  ++  +NWR NP  A
Sbjct:    1 MALPFLPGNSFNRNLGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPLLGQNLKPKFSVFPKGVGSDAPSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEE-MQPLRPYERIDTLKQFLEHDRHVLRFFCFWDDT-TLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPKSSPQNVPQPGQVTARTVLNVFGPMGHGGRYILDNLKTGAVHEEFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQHFEANDPTGTSHMPYEIFRNLL-VDIYENQLTEHEIMTTGRYYSIRDKPEIDLGSLTAIAQEQLKKKSFENFSKLSDVFVYNDQEKHTE---------------------------------NGDQVNYISLVTGLNWRENPTAA 672          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 350/647 (54.10%), Postives = 466/647 (72.02%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYM-EPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADK 1999
            MALP LPGN FNRNLGKEK+HKS HF   N+++   G++K G+GGAPL GQ +    S +P G GS  P+W+AFDKQVL FDAYF+E V++RREE YRIR CK+ FYLEDDTIQV+EP  +NS +PQGTIIRRHRI  PAPND  FYTV   N+  ++ FY K++RI++CDEFT NFLRKLGV++  P+ +P D Y+ TRK M+E MQPLRPYER D LKQFL+HDRHVLRFFCFWDD+  L+GD RE+V++Y+LADDTVEI E+IPAN+GRD  P FL R KLPK   + +P  G  T RT+LNV G    GGRY++DNLK      EFY D DL IGA +NV+GRK ++ D D FTK YY  K+G+ +FT +  +  +     +  PP+NG+GSE D+L +C  L+P+PP+RDF KFMEKDR GLES+VLRF ARL TD  +DK+R+FI+S+FL+DD+  VFE   +NSG +GGKFLERS++KKPGQ+ + +EL +Y++  D+ +GA +  N F F + DADEY + YME+N  EFP S+I  I  KLR+   +K REI  HF+  D      + +   +++L +   E +LT+HEI T  R+Y+ R   ++++ +L  + Q+QL+K +FE FS++ ++F+  D+
Sbjct:    1 MALPFLPGNSFNRNLGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPLLGQNLKPKFSVFPKGVGSDAPSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEE-MQPLRPYERIDTLKQFLEHDRHVLRFFCFWDDT-TLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPKSSPQNVPQPGQVTARTVLNVFGPMGHGGRYILDNLK------EFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQHFEANDPTGTSHMPYEIFRNLL-VDIYENQLTEHEIMTTGRYYSIRDKPEIDLGSLTAIAQEQLKKKSFENFSKLSDVFVYNDQ 638          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 345/658 (52.43%), Postives = 463/658 (70.36%), Query Frame = 2
Query:  104 LGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDL 2077
            LGKEK+HKS HF   N+++   G++K G+GGAPL GQ +    S +P G GS  P+W+AFDKQVL FDAYF+E V++RREE YRIR CK+ FYLEDDTIQV+EP  +NS +PQGTIIRRHRI  PAPND  FYTV   N+  ++ FY K++RI++CDEFT NFLRKLGV++  P+ +P D Y+ TRK M+E MQPLRPYER D LKQFL+HDRHVLRFFCFWDD+  L+GD RE+V++Y+LADDTVEI E+IPAN+GRD  P FL R KLPK        G  T RT+LNV G    GGRY++DNLKTG    EFY D DL IGA +NV+GRK ++ D D FTK YY  K+G+ +FT +  +  +     +  PP+NG+GSE D+L +C  L+P+PP+RDF KFMEKDR GLES+VLRF ARL TD  +DK+R+FI+S+FL+DD+  VFE   +NSG +GGKFLERS++KKPGQ+ + +EL +Y++  D+ +GA +  N F F + DADEY + YME+N  EFP S+I  I  KLR+   +K REI  HF+  D      + +   +++L +   E +LT+HEI T  R+Y+ R   ++++ +L  + Q+QL+K +FE FS++ ++F+  D+  N  L   +   I K   +P++ D 
Sbjct:   29 LGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPLLGQNLKPKFSVFPKGVGSDAPSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEE-MQPLRPYERIDTLKQFLEHDRHVLRFFCFWDDT-TLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPK-------PGQVTARTVLNVFGPMGHGGRYILDNLKTGAVHEEFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQHFEANDPTGTSHMPYEIFRNLL-VDIYENQLTEHEIMTTGRYYSIRDKPEIDLGSLTAIAQEQLKKKSFENFSKLSDVFVYNDQEKNGWLSFQKTLTICKAFKIPLADDF 676          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Mouse
Match: Efhc2 (EF-hand domain (C-terminal) containing 2 [Source:MGI Symbol;Acc:MGI:1921655])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 328/733 (44.75%), Postives = 456/733 (62.21%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEP-LPSIGTQTERTLLNVLG--HPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVSSGELLKGKCVEDI 2251
            MALP LPGN FNRN+GKE++HKS H+   N V  +  ++K G+GG  L GQ+I    S +P GDG+  P+W+AFDKQVL FDAY ++ ++++R+E +RIR  K+ FYLEDDTIQV EP   NS LPQGT IRR RI  P PND  FYTV+DFN+ I + FYG+ F+I  CD FT NFL+K+G+++  P + P D Y   R+   E + P RPY+  D LK+F+ +D  VLRFFC WDDS +L+GD+RE V+HYFL D TVEIREV+P+N+GRDA  +FL+R KLPKY  P +   G  T+R +LNV G     R   YL+D  + G  + +FYTD+DL IGA INV+GRK ++ D D FTK YY  KYG+ NFT I  +      I R  PP+ G+GSEEDS  +C GL P P +++F KFME D  G  S++LR+  +L+T K  D DR F+I+F+L+DD+  VFE +  NSG  GG FL+RS++KKPGQE + +E  +Y +A +++IGA + IN + F + +ADEY   YME N  +FP SN +  + KL+Q+  SK REI   F   D  +   V ++  + +L +  +  +L D E+ TIARHY    + D +++ LI    ++ +K  FE F       +  D+     L   ++ ++ K   +P+  D L  L  +   +     I+Y      +NWR NP P         + +   LK KC ED+
Sbjct:    1 MALPFLPGNSFNRNIGKERFHKSQHWGFCNNVRMLVSENKPGVGGDLLYGQKIKPKHSVFPKGDGTDAPSWVAFDKQVLSFDAYLEDEISDKRQEIFRIRYYKIYFYLEDDTIQVNEPEVINSGLPQGTSIRRQRIPYPPPNDDQFYTVYDFNINISVVFYGRTFKIYDCDPFTKNFLKKIGIKLNPPGQCPLDPYMKMRRETLEFVDPFRPYQSFDTLKRFIQYDGKVLRFFCLWDDSTSLFGDRREFVLHYFLCDGTVEIREVLPSNSGRDAMSSFLRRGKLPKYGPPGIYQPGQITDRAVLNVYGGLSEWRADGYLLDKYQLGKVEQDFYTDQDLSIGATINVWGRKVLLCDCDEFTKTYYRTKYGVDNFTPISCKPPHLPKIERKYPPYTGFGSEEDSFRSCVGLKPTPHRKNFKKFMELDSFGNISNILRYFGKLITHKCADVDRIFVIAFYLSDDTISVFEPIENNSGNAGGMFLKRSRVKKPGQEVFKSEFSEYIKAEELYIGATVNINGYLFILLNADEYTLNYMENNTDKFPYSNFELAIQKLKQE-KSKSREITQVFAAADYNHTKVVPYNTFRDIL-MSITMGKLIDQELITIARHYRVPEIMDPDLAYLIARAHEKFKKNIFENFDMFIYNCVYEDREKKGVLPTKDIRRMCKSSRLPLDDDFLDCLLSR--FEDKDHQINYEIFFSVLNWRMNPTPD--------LQAPPYLKEKC-EDV 720          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Mouse
Match: Efhc1 (EF-hand domain (C-terminal) containing 1 [Source:MGI Symbol;Acc:MGI:1919127])

HSP 1 Score: 360.147 bits (923), Expect = 1.050e-113
Identity = 244/696 (35.06%), Postives = 352/696 (50.57%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFM------FGDDK---NGIGGAPLPGQRIGAPTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERK---DKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKV-EFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQC 2101
             LP LPG+ F  +  K  +H+S   + +N    +       G D+   N +  A L      AP   Y     A     +PA +AFDK+VL F AYFQE V    EE YRIR+  + +YLEDD++ VIEP   NS +PQG +I+R R  K    DH  Y   D N GI L  YGK FRI+ CD FT +FL   G+++   EKIP D Y   RK      +P+R Y      D+LKQFL  D+ VLRF+  WDD+D+L+G+ R  +IHY+L DDTVEIREV   N GRD  P  + RQ++PK +             + N    P+         L+  D +V E+YT +D  +G  + + GR F I D D FT+++Y  K+GM +   +D       P+ +  PP+NG+G  EDS  NC  L+P+ P++D +K +  D K     VLR+ A L +    DKDRRF+ S+FLA D   +FE  ++NSG +GGKFL R+K+ K        + P YY  SD  IGA+IE+   +F I D DEY  +YME N  ++    +  I  ++++       E+ +   E++++ A      Q                               K  ++ ALI  I   L+  + +E   ++  F   DK  +  ++R    KI + L+VP+   L++ L   C
Sbjct:    8 GLPFLPGSSFTDST-KTAFHRSQTLNYRNGYAVVRRPTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDH--YHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLRK------EPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVL-------------VENAKNFPKCV-------LEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNK-----VLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFS---PVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKP------ELPA--PELESKQATGEPMVQ--------------------------GTEESKVQDLDALIDQIHMHLKYNSCKE--NLRETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLC 630          
BLAST of EF-hand domain-containing family member C2 vs. UniProt/SwissProt
Match: sp|Q32TF8|EFHC2_DANRE (EF-hand domain-containing family member C2 OS=Danio rerio OX=7955 GN=efhc2 PE=2 SV=2)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 363/748 (48.53%), Postives = 502/748 (67.11%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLP--SIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVSSGELLKGK----CVEDINYNQLLSDLLGA 2287
            MALP+LPGN  NRNLGK+K+HKS HFD  N V  M G +K GIGG  L GQ   A  S +P G+GS  PAW+AFDKQVL FDAYF E+V +RREE+YR+R CK+ FYLEDDTIQV+EP  +NS +PQGT+IRRHRI  PAP D  FY VH FN+  E+ FY + F I  CD FT NFL K+GV++  P   P D Y   R+ ++E+M+PLRPYER D LKQFL+HDR VLRF+C+WDDS++++GD RE+++HYFLADDT+E+ EV+P N+GRD  P FL R KLPK+  P+P    G  T+RT+LNV G   +GG Y++D+LKTG  + EFY D DL IGA INV+GR+ +I D D FTKEYY  KYG+ +F +I  +        +  PP+ G+GSEEDSL +C GL+P+PP++DF K MEKDR+GL S+VLRF  +++TD  +DK+R FII F+L DD+  VFE   +NSG +GGKFLER ++KKPGQE + +E+ +Y+ A D+++GA + +N+  F + DAD++ + YME++  EFP++NI  I+ K++     +++ +   F   D  +  ++ +   +++L     + EL++HEI T+ R Y+ R   +VNV  ++ V Q  L+K NFE+FS++   F   D+    QL   E   I K   +P+S DLL+ L ++     + + IDY+  L  INWR NP PA +   E  V      +G+     V+ INY+ LL D+ G+
Sbjct:    1 MALPMLPGNSVNRNLGKDKFHKSQHFDYSNGVAMMVGTEKPGIGGDLLLGQSARAKYSRFPKGEGSGAPAWLAFDKQVLCFDAYFNEAVPQRREEKYRVRKCKIYFYLEDDTIQVVEPEFKNSGIPQGTLIRRHRIPLPAPKDDCFYNVHHFNINQEVLFYSRNFMITDCDPFTRNFLVKMGVRLNPPASTPADPYTTLRQELEENMKPLRPYERLDTLKQFLEHDRQVLRFYCYWDDSESMFGDPRELILHYFLADDTMEMYEVVPPNSGRDTVPKFLHRGKLPKHA-PIPKRQPGEITDRTVLNVFGPVGQGGPYILDSLKTGALEEEFYKDSDLTIGAVINVWGRRVLICDCDYFTKEYYRSKYGIEDFPSISYKASPPPKPAKQVPPYTGFGSEEDSLCSCQGLLPKPPQKDFKKLMEKDRRGLVSNVLRFVGKMLTDSPVDKERVFIICFYLTDDTIAVFEPPQRNSGVIGGKFLERGRVKKPGQELFKSEMSEYFTAQDLYVGAHLLLNSQPFQLVDADDFTFSYMEQHADEFPKANIGTIISKVKSISEEQQKTVKQFFTMSDPSSTGSLPYESFRTLLADL--DVELSEHEIMTLGRVYSVRQQPEVNVGLMLAVAQDHLKKKNFEKFSEMIQAFTHEDRDRCGQLSSKEARIICKAFRLPLSDDLLRALLEK--FAGESEKIDYHAFLSGINWRENPVPAVLP--EDTVKFDADWRGEAPEPAVKTINYSLLLEDVFGS 741          
BLAST of EF-hand domain-containing family member C2 vs. UniProt/SwissProt
Match: sp|Q32TG3|EFHC2_CHICK (EF-hand domain-containing family member C2 OS=Gallus gallus OX=9031 GN=EFHC2 PE=2 SV=1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 340/749 (45.39%), Postives = 478/749 (63.82%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEP-LPSIGTQTERTLLNVLGH-PQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPA------PVSDVETLVSSGELLKGKCVEDINYNQLLSDLLG 2284
            MALPLLPG    RN+GKEK+HKS H+   N V  +  +DK GIGG PLPGQ++   +S +PA  G   PAW+AFDKQVL FDAYF+E V ++ +E YRIR+CK+ FYLEDDTIQV+EP+ +NS + QGTI+RRHRI  P+PN+  FYT+  FN+  E+ FY + ++II CD+FT +FLRK+G ++  P   P D Y   R+ + +SM PLRPYER D LKQFL+HD HVLRF+C WDD ++L+ D RE+V+HY+L+DDT++I+EVIP N+GRD  P FL+R KLPKY    L   GT T RT+LNV G+     GRY++DN KTG    EFY D DL+IGA INV+GR+ ++ D D FTK+YY  KYG+ +FT +  +        +  PP+ G+GSEEDSL +C  L+P+PP++DF KFMEKDR GLES+ LRF A+LVTD  +DKDR+FII +FL      VFE   +N+G +GGKFLE+ +IKKPGQE + +E  +Y++A D+ IGA +  +   F + DADEY   YMEK+  EF  ++   I  KL+     + REI   F   D ++   + +   ++++ +  ++   ++HEI T+ RHY  +   +++   L+   Q+QL+K +FE F Q+  + +  D+     L       I K   +P+S DLLQ +    + + D   ++Y + +  +NWR +  P+      P  + +        L    V+ I Y  LL DL G
Sbjct:    1 MALPLLPGFSLGRNVGKEKFHKSQHWGYCNNVAMLLAEDKPGIGGEPLPGQKLIPKSSVFPAELGCGAPAWLAFDKQVLSFDAYFEEEVPDKNQEPYRIRHCKIYFYLEDDTIQVLEPQVKNSGIIQGTIVRRHRIPLPSPNEDQFYTIDHFNINAEVIFYARRYKIIDCDQFTKHFLRKMGFKLNPPGNRPDDPYTKERQKILDSMNPLRPYERIDTLKQFLEHDGHVLRFYCVWDDPESLFHDPRELVLHYYLSDDTIDIKEVIPVNSGRDVVPLFLRRDKLPKYAPTGLYQPGTITSRTVLNVFGNLVGNRGRYILDNRKTGAVHQEFYRDSDLKIGAVINVWGRQIMLCDCDEFTKDYYRTKYGIEDFTPVPYKAPPPPKAEKPIPPYTGFGSEEDSLCSCMSLLPKPPQKDFKKFMEKDRCGLESNTLRFLAKLVTDSPIDKDRKFIICYFLMMPLYSVFEHSQRNTGIIGGKFLEKGRIKKPGQELFKSEPSEYFKAQDLFIGARVCFHGHNFLLVDADEYTINYMEKHANEFAVADTGFIFKKLKDIAEPRSREIRQVFAAADPQHTKVIEYDPFRNLI-VSITDGAFSEHEIMTLGRHYGEKEEYEIDHHFLLAKAQEQLKKNSFENFEQLSTILVYNDREKCGALPYETCRTICKSFKLPLSDDLLQTIL--TMFEDDHKQVNYKKFVDAVNWREHQIPSFHTIKLPPKNEDDWNGQPPFLP---VKRIKYLPLLDDLFG 743          
BLAST of EF-hand domain-containing family member C2 vs. UniProt/SwissProt
Match: sp|Q5JST6|EFHC2_HUMAN (EF-hand domain-containing family member C2 OS=Homo sapiens OX=9606 GN=EFHC2 PE=1 SV=2)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 329/710 (46.34%), Postives = 452/710 (63.66%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEP-LPSIGTQTERTLLNVLGH--PQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPII-RHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYP 2179
            MALPLLPGN FNRN+GKEK+HKS H+   N V  +  D+K GIGG PL GQ+I    S YP GDGS +P+W+AFDKQVL FDAY +E V ++ +  YRIR  K+ FY EDDTIQV EP  +NS L QGT IRRHRI  P P++  FYTV+ FNVG E+ FYG+ F+I  CD FT NFLRK+GV+V  P + P+D Y   R+ + E ++PLRPYE  D LKQFL +   +L FFC WDDS +++GD+RE+++HYFL DDT+EI+E++P ++GRDA   FL+R KLPK   P +   G  T+R +LN  G     +   YL D  K G    EFY D DL +G  INV+GRK ++ D D FTK YY  KYG+ NFT++  +     P I R  PP+NG+GSEEDSL NC  L P P +R+F KFMEKD  G +S++LRF A+LVTDK +D DR F+IS++L DD+  VFE + +NSG  GG FL+RS++KKPGQE + +EL +Y +A +++IG  + +N + F + +ADEY   YME+N  ++P SN+   + KL+Q+   K RE+   FK  D+++   V ++  + +L +  +   L + E  TIARHY        ++  LI +  ++ +K  FE F       +  D+     L   ++ ++ K   +P+S DLL+ L  +   +     IDY      +NWR NP P
Sbjct:    1 MALPLLPGNSFNRNVGKEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIYPKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPEVKNSGLLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRKIGVKVNPPVQCPEDPYMKIRREVVEHVEPLRPYESLDTLKQFLQYHGKILCFFCLWDDSVSMFGDRRELILHYFLCDDTIEIKELLPHSSGRDALKMFLRRSKLPKNCPPRVYQPGQITDRAVLNSYGDFIKNQADGYLFDRYKLGKVDQEFYKDSDLSLGVTINVWGRKVLLYDCDEFTKSYYKSKYGIENFTSVSCKPPSPPPKIERKFPPYNGFGSEEDSLRNCIDLKPTPHRRNFKKFMEKDSYGSKSNILRFFAKLVTDKCVDLDRMFVISYYLGDDTISVFEPIERNSGIAGGMFLKRSRVKKPGQEVFKSELSEYIKAEELYIGVTVNVNGYLFRLLNADEYTLNYMEQNTDKYPFSNLKLALQKLKQE-EGKSRELKQVFKAADSKHTNMVDYNTFRDIL-MSLTVGNLAEQEFVTIARHYRVPEGTCSDMDFLIALAHEKFKKNMFENFDTFIYSCVYEDREKKNVLPTKDIKRLCKSSRLPLSDDLLESLLSR--FEDSEKQIDYKSFFSALNWRKNPVP 706          
BLAST of EF-hand domain-containing family member C2 vs. UniProt/SwissProt
Match: sp|Q9D485|EFHC2_MOUSE (EF-hand domain-containing family member C2 OS=Mus musculus OX=10090 GN=Efhc2 PE=2 SV=2)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 328/733 (44.75%), Postives = 456/733 (62.21%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEP-LPSIGTQTERTLLNVLG--HPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVSSGELLKGKCVEDI 2251
            MALP LPGN FNRN+GKE++HKS H+   N V  +  ++K G+GG  L GQ+I    S +P GDG+  P+W+AFDKQVL FDAY ++ ++++R+E +RIR  K+ FYLEDDTIQV EP   NS LPQGT IRR RI  P PND  FYTV+DFN+ I + FYG+ F+I  CD FT NFL+K+G+++  P + P D Y   R+   E + P RPY+  D LK+F+ +D  VLRFFC WDDS +L+GD+RE V+HYFL D TVEIREV+P+N+GRDA  +FL+R KLPKY  P +   G  T+R +LNV G     R   YL+D  + G  + +FYTD+DL IGA INV+GRK ++ D D FTK YY  KYG+ NFT I  +      I R  PP+ G+GSEEDS  +C GL P P +++F KFME D  G  S++LR+  +L+T K  D DR F+I+F+L+DD+  VFE +  NSG  GG FL+RS++KKPGQE + +E  +Y +A +++IGA + IN + F + +ADEY   YME N  +FP SN +  + KL+Q+  SK REI   F   D  +   V ++  + +L +  +  +L D E+ TIARHY    + D +++ LI    ++ +K  FE F       +  D+     L   ++ ++ K   +P+  D L  L  +   +     I+Y      +NWR NP P         + +   LK KC ED+
Sbjct:    1 MALPFLPGNSFNRNIGKERFHKSQHWGFCNNVRMLVSENKPGVGGDLLYGQKIKPKHSVFPKGDGTDAPSWVAFDKQVLSFDAYLEDEISDKRQEIFRIRYYKIYFYLEDDTIQVNEPEVINSGLPQGTSIRRQRIPYPPPNDDQFYTVYDFNINISVVFYGRTFKIYDCDPFTKNFLKKIGIKLNPPGQCPLDPYMKMRRETLEFVDPFRPYQSFDTLKRFIQYDGKVLRFFCLWDDSTSLFGDRREFVLHYFLCDGTVEIREVLPSNSGRDAMSSFLRRGKLPKYGPPGIYQPGQITDRAVLNVYGGLSEWRADGYLLDKYQLGKVEQDFYTDQDLSIGATINVWGRKVLLCDCDEFTKTYYRTKYGVDNFTPISCKPPHLPKIERKYPPYTGFGSEEDSFRSCVGLKPTPHRKNFKKFMELDSFGNISNILRYFGKLITHKCADVDRIFVIAFYLSDDTISVFEPIENNSGNAGGMFLKRSRVKKPGQEVFKSEFSEYIKAEELYIGATVNINGYLFILLNADEYTLNYMENNTDKFPYSNFELAIQKLKQE-KSKSREITQVFAAADYNHTKVVPYNTFRDIL-MSITMGKLIDQELITIARHYRVPEIMDPDLAYLIARAHEKFKKNIFENFDMFIYNCVYEDREKKGVLPTKDIRRMCKSSRLPLDDDFLDCLLSR--FEDKDHQINYEIFFSVLNWRMNPTPD--------LQAPPYLKEKC-EDV 720          
BLAST of EF-hand domain-containing family member C2 vs. UniProt/SwissProt
Match: sp|Q5JVL4|EFHC1_HUMAN (EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EFHC1 PE=1 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 2.288e-120
Identity = 259/697 (37.16%), Postives = 356/697 (51.08%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFM------FGDDK---NGIGGAPLPGQRIGAPTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERK---DKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKV-EFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYST-ELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQC 2101
             LP LPG  F ++  K  +H+S     +N    +       G D+   N +  A L      AP   Y     A     +PA +AFDK+VL FDAYFQE V    EEQYRIR   + +YLEDD++ VIEP   NS + QG +I+R R+AK    DH  Y   D N GI +  YGK FR++ CD+FT  FL   G+++  PEK+  D Y   RK      QPLR Y      D+LKQFL  D+ VLRF+  WDD+D++YG+ R  +IHY+L DDTVEIREV   N GRD  P  + RQ++PK +             + N    PQ         L+  D +V E+YT +D  +G  + + GR F I D D FT+ YY  K+G+T+   ID       P+ +  PP+NG+G  EDS  NC  L+P+ PK+D IK +  D K     VLR+ A L +    DKDRRF+ S+FLA D   +FE  ++NSG +GGK+L R+K+ KP    YST + P YY  SD  IGA+IE+   +F I D DEY  +YME N  ++    +  I   +R++ A    E +S   E D                      QEL                       ALI  IQ+QL+  + ++   I+  F   DK  +  ++R    KI + L+VP+   L++ L   C
Sbjct:    8 GLPFLPGTSF-KDSTKTAFHRSQTLSYRNGYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDH--YHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRK------QPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVL-------------VENAKNFPQCV-------LEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNK-----VLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKP----YSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAP-EAESKQTEKDP-------------------GVQEL----------------------EALIDTIQKQLKDHSCKD--NIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMC 622          
BLAST of EF-hand domain-containing family member C2 vs. TrEMBL
Match: A0A4S2LJA5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008410 PE=4 SV=1)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 404/708 (57.06%), Postives = 515/708 (72.74%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAI-----DTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVL-RIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRT 2167
            MALP LPGN FNRNLGK+K+HKSH+F+  N V F +GDDK GIGG  LPGQRI APTS YP+G G ++P W+AF+KQ L FDAYFQE+VNERREEQYR+R CKV FY EDDTIQV+EPR  ++ +PQGTIIRRHRIAKP P DHLFYTV DFNVG E   YGK FR++SCD+FT NFLRKLGV++G+PE IP D Y + RKA  ESMQPLRPYER DKL+QFLDHDRHVLRFFCFWDD+++LYGD REMV+HYFLADDT+EIREVIP N+GRD+AP FL+RQKLP+ +  +P  GT T+RTLLNV GHPQRGGRY++D+LK G  K +FYTD DL IGA +NV+GRKF++ D D FTKEYY  KYG+T+FT +     DT+     P++R  PP+NGWGSEEDSL NC  L+P  PK DF+KFM KD++GLES +LRF A+L+TD  +DKDR F+I+ FL+DD+  V+E   +NSGF GG FLER ++KKP  ER+S + P YY  SD+++GA +  N+FKFFI DADEYAY+YME++  EFP SNI +I  KLR     +  E+++  K  D     T  F QL+ ++ ++   +  L   E+ T+ R++A R + ++    L+G++QQ LR+  FE+F  +  +  +AD     ++ER  + +I K   VP+  D+L  L D    Q     I Y   +  +NWR 
Sbjct:    1 MALPFLPGNSFNRNLGKDKFHKSHYFERYNAVPFQYGDDKVGIGGDKLPGQRIEAPTSKYPSGIGKQLPTWLAFEKQCLSFDAYFQETVNERREEQYRVRRCKVYFYPEDDTIQVVEPRLADTGIPQGTIIRRHRIAKPPPEDHLFYTVDDFNVGNEFTAYGKKFRLVSCDQFTANFLRKLGVRLGEPEPIPDDPYMVHRKAYTESMQPLRPYERIDKLRQFLDHDRHVLRFFCFWDDTESLYGDPREMVLHYFLADDTIEIREVIPTNSGRDSAPCFLRRQKLPRGVPQVPLPGTITDRTLLNVFGHPQRGGRYILDSLKIGAYKEDFYTDRDLTIGASLNVYGRKFLLCDCDEFTKEYYRVKYGLTDFTPVKPNIPDTRI----PVVRENPPYNGWGSEEDSLANCKSLIPVAPKADFVKFMTKDKQGLESFILRFYAQLITDIPVDKDRVFVINCFLSDDTFSVYEPPRRNSGFKGGLFLERGRVKKPNTERFSVDPPDYYSPSDLYVGAEVIFNSFKFFILDADEYAYKYMEEHSAEFPYSNIKKIYDKLRPFVKERCEELNAFGKNQDPNETGTFGFQQLECLIYQLMGPQHALNKQELLTLGRYHADRPLTEIQHGTLLGLVQQALRRHAFEDFGSLLQVCRQADPEKTGEIEREVLRRICKSTRVPVPDDMLDTLMDFSSTQS--GTIRYESFINQLNWRC 702          
BLAST of EF-hand domain-containing family member C2 vs. TrEMBL
Match: A0A4S2LIE0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008410 PE=4 SV=1)

HSP 1 Score: 812.757 bits (2098), Expect = 0.000e+0
Identity = 398/684 (58.19%), Postives = 507/684 (74.12%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAI-----DTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVL-RIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFD 2095
            MALP LPGN FNRNLGK+K+HKSH+F+  N V F +GDDK GIGG  LPGQRI APTS YP+G G ++P W+AF+KQ L FDAYFQE+VNERREEQYR+R CKV FY EDDTIQV+EPR  ++ +PQGTIIRRHRIAKP P DHLFYTV DFNVG E   YGK FR++SCD+FT NFLRKLGV++G+PE IP D Y + RKA  ESMQPLRPYER DKL+QFLDHDRHVLRFFCFWDD+++LYGD REMV+HYFLADDT+EIREVIP N+GRD+AP FL+RQKLP+ +  +P  GT T+RTLLNV GHPQRGGRY++D+LK G  K +FYTD DL IGA +NV+GRKF++ D D FTKEYY  KYG+T+FT +     DT+     P++R  PP+NGWGSEEDSL NC  L+P  PK DF+KFM KD++GLES +LRF A+L+TD  +DKDR F+I+ FL+DD+  V+E   +NSGF GG FLER ++KKP  ER+S + P YY  SD+++GA +  N+FKFFI DADEYAY+YME++  EFP SNI +I  KLR     +  E+++  K  D     T  F QL+ ++ ++   +  L   E+ T+ R++A R + ++    L+G++QQ LR+  FE+F  +  +  +AD     ++ER  + +I K   VP+  D+L  L D
Sbjct:    1 MALPFLPGNSFNRNLGKDKFHKSHYFERYNAVPFQYGDDKVGIGGDKLPGQRIEAPTSKYPSGIGKQLPTWLAFEKQCLSFDAYFQETVNERREEQYRVRRCKVYFYPEDDTIQVVEPRLADTGIPQGTIIRRHRIAKPPPEDHLFYTVDDFNVGNEFTAYGKKFRLVSCDQFTANFLRKLGVRLGEPEPIPDDPYMVHRKAYTESMQPLRPYERIDKLRQFLDHDRHVLRFFCFWDDTESLYGDPREMVLHYFLADDTIEIREVIPTNSGRDSAPCFLRRQKLPRGVPQVPLPGTITDRTLLNVFGHPQRGGRYILDSLKIGAYKEDFYTDRDLTIGASLNVYGRKFLLCDCDEFTKEYYRVKYGLTDFTPVKPNIPDTRI----PVVRENPPYNGWGSEEDSLANCKSLIPVAPKADFVKFMTKDKQGLESFILRFYAQLITDIPVDKDRVFVINCFLSDDTFSVYEPPRRNSGFKGGLFLERGRVKKPNTERFSVDPPDYYSPSDLYVGAEVIFNSFKFFILDADEYAYKYMEEHSAEFPYSNIKKIYDKLRPFVKERCEELNAFGKNQDPNETGTFGFQQLECLIYQLMGPQHALNKQELLTLGRYHADRPLTEIQHGTLLGLVQQALRRHAFEDFGSLLQVCRQADPEKTGEIEREVLRRICKSTRVPVPDDMLDTLMD 680          
BLAST of EF-hand domain-containing family member C2 vs. TrEMBL
Match: A0A267FRT0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019958g2 PE=4 SV=1)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 400/706 (56.66%), Postives = 512/706 (72.52%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHE--PPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCL--VQPDLD-LIDYNQVLYFINWR 2164
            MALP LPGN FN+NLGK+KYHKSH+FD KNE  F+FGD+K GIGG PLPGQR+  P S  P G+GS+ PAW+AFDKQVL FDAYFQESV ERREEQYR+R+CK+ FYLEDD+IQVIE R +NS LPQGT++RRHRI KPAPND+ F+TV DFNVG  + FYGK FRI  CD+FT NFLRKLGV++G PE  P D Y   RKA+DESMQPLRPYER D L+QFLDHDRHVLRFFC WDD+D+LYG+ REMV+HYFL+DDTVEIREV+ AN+GRDAAP FL+RQ LPK ME L   G   +RT+LNV G  Q GGRY++DNLKTG  KVEFYTD+DL +G+CINVFGRKF++ D D FT+EYY+ KYG+T F  +  +   G      +   P+NG+GSEEDS+ N  GL+P PP+++ ++ ++KD+KGLES+VLRF ARLVTDK +DKDR+FI++FFL+DDS +VFE   +NSGF GGKFLER K+ KPG ER+ST+ P+YYQA D ++GA++EIN FK  I DADEYAY+YME N   F  +N++R+M KLR+      +E+ S F   D  ++  V++   + VL          +HE+ T+AR Y     ++V+   L+G +Q  LRK NFE F++++      D   +  L  A +  + + + +P+  DLL+           PD D  ++Y + +  INWR
Sbjct:    1 MALPFLPGNSFNKNLGKDKYHKSHYFDHKNETPFLFGDNKPGIGGDPLPGQRVDPPNSKIPPGEGSRSPAWVAFDKQVLSFDAYFQESVQERREEQYRVRHCKIYFYLEDDSIQVIEARLKNSGLPQGTLVRRHRIPKPAPNDNRFFTVEDFNVGQNITFYGKTFRITGCDQFTENFLRKLGVRIGLPETQPGDPYADHRKALDESMQPLRPYERHDTLRQFLDHDRHVLRFFCCWDDTDSLYGENREMVLHYFLSDDTVEIREVVKANSGRDAAPCFLRRQPLPKNMEDLRQPGELCDRTVLNVFGEIQ-GGRYILDNLKTGTVKVEFYTDKDLTVGSCINVFGRKFLLCDCDEFTREYYSTKYGITEFHPVTCKKPTGGACASGDSGAPYNGFGSEEDSMANTKGLIPAPPRKNIVQLIDKDKKGLESNVLRFLARLVTDKAIDKDRQFIVNFFLSDDSILVFEPPQRNSGFQGGKFLERIKLPKPGHERFSTKAPEYYQAYDFYVGAVLEINKFKMEILDADEYAYKYMESNPDYFLVANVNRVMEKLRRAAQGHCQELQSAFAAKDPNDSKRVSYQDFRCVLDKLAKCGNFVEHELITVARFYGYHPPEEVDAIVLLGSVQAHLRKHNFELFNRLKEAAQHYDTESSGSLPSATLVTVCRTVGLPVPADLLRATLGALAESTSPDGDSCVNYCEFVDRINWR 705          
BLAST of EF-hand domain-containing family member C2 vs. TrEMBL
Match: A0A0X3PC41 (EF-hand domain-containing family member C2 (Fragment) OS=Schistocephalus solidus OX=70667 GN=EFHC2 PE=4 SV=1)

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 399/771 (51.75%), Postives = 526/771 (68.22%), Query Frame = 2
Query:   56 LKMALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAI-DTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQE-----LTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLD--LIDYNQVLYFINWRTNPYPAPVSDVE-----------TLVSSGELLKGKC--------VEDINYNQLLSDLLGA 2287
            + MALP LPGN+FN+ +G+EK+H S +   KN V ++FGD+K GIGG PLPGQRI  PTS+YP GDGS +PAW+AFDKQVL FD YFQE+VNERREE YR+R CKV+FYLEDD IQVIEPR RNS LPQGT+I+RHRIAKP PNDHLFYTVHDFNVG++LE YG+  R+++CD+FT NFLRKLGV+V +PE IP+D Y   R  + ESMQP RPYE  DKL++FLDHDRHVLRF CFWDD+++LYGD REM++HYFLADDT+EIREV+  NAGRD+A  FL+RQKLPK +  +P  G  T++TLLNV         YL+D+LK G  K ++YTD +L +GA INV+GRKF+I D D FT+EYY  KYG+ +FT +   +    +P +   PP+NGWGS+EDSL NC GL+P+PP +DF+KFMEKD+ GLESHVLRF AR+VTD   D+DR FII  FL DD+ +++E  ++NSGF GGKF+ER K+ KPGQER+   LP YY   D+++GA++E NNF F +  ADEYAYRYME++  EFP S++ RIM KLR     +E E+++  KE+D   A ++ +   + +++   S+       +  HEI T+AR+YA R     N  A+IG+ QQQLRK  FE F  + +     D      + + ++ +I +  H+P+  D+L  L +   V  + D  L+ Y   +  +NWR NP P      +            +   G    G C         E + Y + L+DL+ A
Sbjct:   21 VSMALPFLPGNVFNKKIGQEKFHLSQYLTKKNCVGYLFGDNKPGIGGEPLPGQRIDPPTSHYPTGDGSSVPAWVAFDKQVLSFDGYFQETVNERREESYRVRQCKVLFYLEDDGIQVIEPRIRNSGLPQGTLIKRHRIAKPPPNDHLFYTVHDFNVGMDLELYGRKIRLVACDKFTENFLRKLGVRVNEPEPIPEDPYTSLRLGVSESMQPKRPYEPVDKLRKFLDHDRHVLRFNCFWDDTESLYGDAREMILHYFLADDTIEIREVVQPNAGRDSASCFLRRQKLPKGVVDMPLPGAVTDKTLLNVSATAPDNRVYLVDSLKMGTLKTDYYTDRELTLGATINVYGRKFLICDCDAFTREYYKNKYGIMSFTPVPPPRTACPQPPLNKNPPYNGWGSDEDSLANCKGLIPKPPPKDFVKFMEKDKVGLESHVLRFAARIVTDLPQDRDRCFIIYCFLTDDTFLIYEPPVRNSGFKGGKFMERRKVMKPGQERFRINLPDYYTTVDVYVGAVVEFNNFLFEVCGADEYAYRYMEQHPAEFPFSDVPRIMSKLRPLMQGREEEMNNFVKELDPEGAKSMPYADFEKLIQKLLSDPRYDRVCIVAHEIATLARNYAERIPTKKNYMAIIGLAQQQLRKAPFENFQALLDACRYEDVNKTGSMSQTDLRRICRANHLPLPDDMLYTLME---VSKNFDNGLVYYESFISQLNWRCNPVPPGTVPCDYSGNLEVDWFTVVTGKGSKTAGSCKKVLTCLGAERVCYTKFLTDLMNA 788          
BLAST of EF-hand domain-containing family member C2 vs. TrEMBL
Match: A0A267E8T2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019958g1 PE=4 SV=1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 399/706 (56.52%), Postives = 511/706 (72.38%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHE--PPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCL--VQPDLD-LIDYNQVLYFINWR 2164
            MALP LPGN FN+NLGK+KYHKSH+FD KNE  F+FGD+K GIGG PLPGQR+  P S  P G+GS+ PAW+AFDKQVL FDAYFQESV ERREEQYR+R+CK+ FYLEDD+IQVIE R +NS LPQGT++RRHRI KPAPND+ F+TV DFNVG  + FYGK FRI  CD+FT NFLRKLGV++G PE  P D Y   RKA+DESMQPLRPYER D L+QFLDHDRHVLRFFC WDD+D+LYG+ REMV+HYFL+DDTVEIREV+ AN+GRDAAP FL+RQ LPK +E L   G   +RT+LNV G  Q GGRY++DNLKTG  KVEFYTD+DL +G+CINVFGRKF++ D D FT+EYY+ KYG+T F  +  +   G      +   P+NG+GSEEDS+ N  GL+P PP+++ ++ ++KD+KGLES+VLRF ARLVTDK +DKDRRFI++FFL+DDS +VFE   +NSGF GGKFLER K+ KPG ER+ST+ P+YYQA D ++GA++EIN FK  I DADEYAY+YME N   F  +N++R+M KLR+      +E+ S F   D  ++  V++   + VL          +HE+ T+AR Y     ++V+   L+G +Q  L K NFE F++++      D   +  L  A +  + + + +P+  DLL+           PD D  ++Y + +  INWR
Sbjct:    1 MALPFLPGNSFNKNLGKDKYHKSHYFDHKNETPFLFGDNKPGIGGDPLPGQRVDPPNSKIPPGEGSRSPAWVAFDKQVLSFDAYFQESVQERREEQYRVRHCKIYFYLEDDSIQVIEARLKNSGLPQGTLVRRHRIPKPAPNDNRFFTVEDFNVGQNITFYGKTFRITGCDQFTENFLRKLGVRIGLPETQPGDPYADHRKALDESMQPLRPYERHDTLRQFLDHDRHVLRFFCCWDDTDSLYGENREMVLHYFLSDDTVEIREVVKANSGRDAAPCFLRRQPLPKNVEDLRQPGELCDRTVLNVFGEIQ-GGRYILDNLKTGTVKVEFYTDKDLTVGSCINVFGRKFLLCDCDEFTREYYSTKYGITEFHPVTCKKPTGGACASGDSGAPYNGFGSEEDSMANTKGLIPAPPRKNIVQLIDKDKKGLESNVLRFLARLVTDKAIDKDRRFIVNFFLSDDSILVFEPPQRNSGFQGGKFLERIKLPKPGHERFSTKAPEYYQAYDFYVGAVLEINKFKMEILDADEYAYKYMESNPDYFLVANVNRVMEKLRRAAQGHCQELQSAFAAKDPNDSKRVSYQDFRCVLDKLAKCGNFVEHELITVARFYGYHPPEEVDAIVLLGSVQAHLCKHNFELFNRLKEAAQHYDTESSGSLPSATLVTVCRTVGLPVPADLLRATLGALAESTSPDGDSCVNYCEFVDRINWR 705          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Cavefish
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:103033063])

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 354/747 (47.39%), Postives = 482/747 (64.52%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPS--IGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVS---SGELLKGKCVEDINYNQLLSDLLGA 2287
            M LPLLPGN  NRNLGKEK+HKS HF+    +  M G  K GIGG PL GQ      S +P   GS  P+W+AFDKQVL FDAYFQE V + REE YR+R CK+ +YLE+DTIQV+EP  +NS +  GT+I RHRI  PAPND  FY +  FN+  E+EFY + + I  CD FT NFLRK+GV++      P D Y   R+ +++SM+P RPYER+D LKQFL+HD +VLRF+C+W+D+++++GD RE+++HYFLADDT+EIREV+  N+GRD AP FL R K+PK   P P+   G  T RT+LNV+G   +G RY++D L TG  + EFY D DL IG  INV+GR  +I D D FTKEYY  KYG+ +FT +  +        R  PP+ G+GSEEDSL +C GL+P+ P++DF K MEKDR+GLES+VLRF A+++T+  ++ +R FIISF+L DD+  +FE   +N+G LGGKFLERS++KKPGQE Y +E+ + Y A D+++GA + I+N  F + DADEYA+ YME++  EFP++NI  I+ KL+   A K++EI       D  N   V +   +S+L    +  +L++HEI T+ R Y+ R   + NV  ++ V Q  L+K  F+ F  +   F   D+     L   E   I K   +P++ DLL+ L  +     +   IDYN  L  INWR NP P  + D         SGE + G  V  +NY+ LL D+ G+
Sbjct:    1 MPLPLLPGNSLNRNLGKEKFHKSQHFEYSKGIPLMVGAKKPGIGGEPLLGQTAKPQYSLFPKEQGSG-PSWLAFDKQVLCFDAYFQEPVTQSREETYRVRKCKIYYYLENDTIQVVEPIIKNSGMQHGTLICRHRIPLPAPNDDQFYNIQHFNINQEIEFYSRTYMITDCDPFTRNFLRKMGVRINSSATAPADPYTTLRQELEDSMKPRRPYERQDTLKQFLEHDHNVLRFYCYWNDTESMFGDPRELILHYFLADDTIEIREVLYPNSGRDTAPKFLNRSKIPKNA-PTPTHQPGEVTGRTVLNVIGPVGQGSRYILDRLNTGAVEEEFYKDSDLTIGGVINVWGRSVLICDCDNFTKEYYRSKYGIEDFTPVQYKVPLPPKPAREMPPYTGFGSEEDSLCSCQGLIPKAPQKDFRKLMEKDRQGLESNVLRFVAKILTNNAVNNERTFIISFYLGDDTIAMFEPTQRNTGVLGGKFLERSRVKKPGQELYKSEMSECYMAQDLYVGARLCISNQLFQLVDADEYAFNYMEQHAEEFPRANIGIILSKLKSIHAEKQKEIKHFLANSDPGNTGLVPYESFRSLLAD--TGCQLSEHEIITLGRTYSLREQPEPNVGFMLAVAQDHLKKKLFDNFPDLLRAFTHEDRDRTGHLSAKEARTICKAFRLPLADDLLRALLQK--FANESGNIDYNAFLSGINWRENPSPPLLPDDAIKFDVDWSGEAV-GPAVTAVNYSLLLDDVFGS 740          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Cavefish
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:103033063])

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 354/764 (46.34%), Postives = 482/764 (63.09%), Query Frame = 2
Query:   62 MALPLLPGNIFNRN-----------------LGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPS--IGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVS---SGELLKGKCVEDINYNQLLSDLLGA 2287
            M LPLLPGN  NRN                 LGKEK+HKS HF+    +  M G  K GIGG PL GQ      S +P   GS  P+W+AFDKQVL FDAYFQE V + REE YR+R CK+ +YLE+DTIQV+EP  +NS +  GT+I RHRI  PAPND  FY +  FN+  E+EFY + + I  CD FT NFLRK+GV++      P D Y   R+ +++SM+P RPYER+D LKQFL+HD +VLRF+C+W+D+++++GD RE+++HYFLADDT+EIREV+  N+GRD AP FL R K+PK   P P+   G  T RT+LNV+G   +G RY++D L TG  + EFY D DL IG  INV+GR  +I D D FTKEYY  KYG+ +FT +  +        R  PP+ G+GSEEDSL +C GL+P+ P++DF K MEKDR+GLES+VLRF A+++T+  ++ +R FIISF+L DD+  +FE   +N+G LGGKFLERS++KKPGQE Y +E+ + Y A D+++GA + I+N  F + DADEYA+ YME++  EFP++NI  I+ KL+   A K++EI       D  N   V +   +S+L    +  +L++HEI T+ R Y+ R   + NV  ++ V Q  L+K  F+ F  +   F   D+     L   E   I K   +P++ DLL+ L  +     +   IDYN  L  INWR NP P  + D         SGE + G  V  +NY+ LL D+ G+
Sbjct:    1 MPLPLLPGNSLNRNPCLLVSLEYCSTSYYCELGKEKFHKSQHFEYSKGIPLMVGAKKPGIGGEPLLGQTAKPQYSLFPKEQGSG-PSWLAFDKQVLCFDAYFQEPVTQSREETYRVRKCKIYYYLENDTIQVVEPIIKNSGMQHGTLICRHRIPLPAPNDDQFYNIQHFNINQEIEFYSRTYMITDCDPFTRNFLRKMGVRINSSATAPADPYTTLRQELEDSMKPRRPYERQDTLKQFLEHDHNVLRFYCYWNDTESMFGDPRELILHYFLADDTIEIREVLYPNSGRDTAPKFLNRSKIPKNA-PTPTHQPGEVTGRTVLNVIGPVGQGSRYILDRLNTGAVEEEFYKDSDLTIGGVINVWGRSVLICDCDNFTKEYYRSKYGIEDFTPVQYKVPLPPKPAREMPPYTGFGSEEDSLCSCQGLIPKAPQKDFRKLMEKDRQGLESNVLRFVAKILTNNAVNNERTFIISFYLGDDTIAMFEPTQRNTGVLGGKFLERSRVKKPGQELYKSEMSECYMAQDLYVGARLCISNQLFQLVDADEYAFNYMEQHAEEFPRANIGIILSKLKSIHAEKQKEIKHFLANSDPGNTGLVPYESFRSLLAD--TGCQLSEHEIITLGRTYSLREQPEPNVGFMLAVAQDHLKKKLFDNFPDLLRAFTHEDRDRTGHLSAKEARTICKAFRLPLADDLLRALLQK--FANESGNIDYNAFLSGINWRENPSPPLLPDDAIKFDVDWSGEAV-GPAVTAVNYSLLLDDVFGS 757          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Cavefish
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:103033063])

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 349/762 (45.80%), Postives = 481/762 (63.12%), Query Frame = 2
Query:   62 MALPLLPGNIFNRN-----------------LGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPS--IGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSD--VETLVSSGELLKGKCVEDINYNQLLSDLLG 2284
            M LPLLPGN  NRN                 LGKEK+HKS HF+    +  M G  K GIGG PL GQ      S +P   GS  P+W+AFDKQVL FDAYFQE V + REE YR+R CK+ +YLE+DTIQV+EP  +NS +  GT+I RHRI  PAPND  FY +  FN+  E+EFY + + I  CD FT NFLRK+GV++      P D Y   R+ +++SM+P RPYER+D LKQFL+HD +VLRF+C+W+D+++++GD RE+++HYFLADDT+EIREV+  N+GRD AP FL R K+PK   P P+   G  T RT+LNV+G   +G RY++D L TG  + EFY D DL IG  INV+GR  +I D D FTKEYY  KYG+ +FT +  +        R  PP+ G+GSEEDSL +C GL+P+ P++DF K MEKDR+GLES+VLRF A+++T+  ++ +R FIISF+L DD+  +FE   +N+G LGGKFLERS++KKPGQE Y +E+ + Y A D+++GA + I+N  F + DADEYA+ YME++  EFP++NI  I+ KL+   A K++EI       D  N   V +   +S+L    +  +L++HEI T+ R Y+ R   + NV  ++ V Q  L+K  F+ F  +   F   D+     L   E   I K   +P++ DLL+ L  +     +   IDYN  L  INWR NP P  + D  ++   S+    K +    +NY+ ++ +L G
Sbjct:    1 MPLPLLPGNSLNRNPCLLVSLEYCSTSYYCELGKEKFHKSQHFEYSKGIPLMVGAKKPGIGGEPLLGQTAKPQYSLFPKEQGSG-PSWLAFDKQVLCFDAYFQEPVTQSREETYRVRKCKIYYYLENDTIQVVEPIIKNSGMQHGTLICRHRIPLPAPNDDQFYNIQHFNINQEIEFYSRTYMITDCDPFTRNFLRKMGVRINSSATAPADPYTTLRQELEDSMKPRRPYERQDTLKQFLEHDHNVLRFYCYWNDTESMFGDPRELILHYFLADDTIEIREVLYPNSGRDTAPKFLNRSKIPKNA-PTPTHQPGEVTGRTVLNVIGPVGQGSRYILDRLNTGAVEEEFYKDSDLTIGGVINVWGRSVLICDCDNFTKEYYRSKYGIEDFTPVQYKVPLPPKPAREMPPYTGFGSEEDSLCSCQGLIPKAPQKDFRKLMEKDRQGLESNVLRFVAKILTNNAVNNERTFIISFYLGDDTIAMFEPTQRNTGVLGGKFLERSRVKKPGQELYKSEMSECYMAQDLYVGARLCISNQLFQLVDADEYAFNYMEQHAEEFPRANIGIILSKLKSIHAEKQKEIKHFLANSDPGNTGLVPYESFRSLLAD--TGCQLSEHEIITLGRTYSLREQPEPNVGFMLAVAQDHLKKKLFDNFPDLLRAFTHEDRDRTGHLSAKEARTICKAFRLPLADDLLRALLQK--FANESGNIDYNAFLSGINWRENPSPPLLPDDAIKPFCSTLPKPKLEGHTKVNYSAVIKELFG 756          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Cavefish
Match: efhc1 (EF-hand domain containing 1 [Source:NCBI gene;Acc:103021369])

HSP 1 Score: 328.561 bits (841), Expect = 5.243e-102
Identity = 198/554 (35.74%), Postives = 298/554 (53.79%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRI-----------------GAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRP---YERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPK----YMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYME 1654
             LP LPGN F R+  K  +H+      KN           GIG  PL  + I                 G PT + P      +PA++A+DK+VL F  Y++E V     E + ++   + +YLEDD+I V++P+ +N+   +   I+RHR+ K  P +H  Y   DFN+ +++  Y  ++RI +CD FT  F+   G+ +  PE+IP D ++          QP  P       D+ KQFL  DR VLRFF  WDDSD+LYG+K E+++HY+L DD+VEIR V  +N+GRD  P  L RQK+PK      +P PS   +           PQ             D + EFY+ ++ ++G  + + G++F++ D D FT++YY   +       +  Q    E   +  PP+NG+GS EDSL NC  L+P+PPK+D +K +E D K     VLR+ A+L +    D+ R FI+S++L++D   +FE   +N G LGGKFLE+++I KP     + E P+YY  +D  IGA +E+   +F + DAD+Y   Y+E
Sbjct:   72 GLPFLPGNSF-RDTTKSAFHRPQTLSYKNGYALPLRPTA-GIGQDPLLSENILQNEMKQLSSQIPTLTYGTPTRSPPR---DFIPAFVAYDKKVLRFYGYYKEEVLHSPNEHFYVQPVVIYYYLEDDSICVMKPKLKNTNEKEIKQIKRHRLPKNQPGEH--YHWKDFNLAMDMIVYNTVYRITNCDPFTQEFMESQGIVLNDPEQIPGDPHS------SRQTQPQLPDISSTNYDRFKQFLTMDRKVLRFFAVWDDSDSLYGEKLEVIVHYYLVDDSVEIRIVQESNSGRDTVPVLLHRQKIPKDIKEVCQPFPSCVLEVS---------PQ-------------DVQ-EFYSPKNFRVGEELRLMGKRFLLYDCDEFTRKYYEQHHPDIPLKPLPVQQKAQEDCKKVIPPYNGFGSLEDSLQNCLSLIPKPPKKDLLKLLENDHK-----VLRYAAKLDSQNPNDEGRHFILSYYLSNDMISIFERSRRNFGILGGKFLEKTRIPKPSS---TVENPEYYGPADFAIGATVEVFRHRFVLTDADQYVLTYLE 581          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Cavefish
Match: efhc1 (EF-hand domain containing 1 [Source:NCBI gene;Acc:103021369])

HSP 1 Score: 327.791 bits (839), Expect = 1.077e-101
Identity = 198/554 (35.74%), Postives = 298/554 (53.79%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRI-----------------GAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRP---YERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPK----YMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYME 1654
             LP LPGN F R+  K  +H+      KN           GIG  PL  + I                 G PT + P      +PA++A+DK+VL F  Y++E V     E + ++   + +YLEDD+I V++P+ +N+   +   I+RHR+ K  P +H  Y   DFN+ +++  Y  ++RI +CD FT  F+   G+ +  PE+IP D ++          QP  P       D+ KQFL  DR VLRFF  WDDSD+LYG+K E+++HY+L DD+VEIR V  +N+GRD  P  L RQK+PK      +P PS   +           PQ             D + EFY+ ++ ++G  + + G++F++ D D FT++YY   +       +  Q    E   +  PP+NG+GS EDSL NC  L+P+PPK+D +K +E D K     VLR+ A+L +    D+ R FI+S++L++D   +FE   +N G LGGKFLE+++I KP     + E P+YY  +D  IGA +E+   +F + DAD+Y   Y+E
Sbjct:   72 GLPFLPGNSF-RDTTKSAFHRPQTLSYKNGYALPLRPTA-GIGQDPLLSENILQNEMKQLSSQIPTLTYGTPTRSPPR---DFIPAFVAYDKKVLRFYGYYKEEVLHSPNEHFYVQPVVIYYYLEDDSICVMKPKLKNTNEKEIKQIKRHRLPKNQPGEH--YHWKDFNLAMDMIVYNTVYRITNCDPFTQEFMESQGIVLNDPEQIPGDPHS------SRQTQPQLPDISSTNYDRFKQFLTMDRKVLRFFAVWDDSDSLYGEKLEVIVHYYLVDDSVEIRIVQESNSGRDTVPVLLHRQKIPKDIKEVCQPFPSCVLEVS---------PQ-------------DVQ-EFYSPKNFRVGEELRLMGKRFLLYDCDEFTRKYYEQHHPDIPLKPLPVQQKAQEDCKKVIPPYNGFGSLEDSLQNCLSLIPKPPKKDLLKLLENDHK-----VLRYAAKLDSQNPNDEGRHFILSYYLSNDMISIFERSRRNFGILGGKFLEKTRIPKPSS---TVENPEYYGPADFAIGATVEVFRHRFVLTDADQYVLTYLE 581          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Sea Lamprey
Match: efhc1 (EF-hand domain (C-terminal) containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1300])

HSP 1 Score: 325.865 bits (834), Expect = 1.031e-102
Identity = 200/564 (35.46%), Postives = 306/564 (54.26%), Query Frame = 2
Query:   68 LPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPA-GDGSKMP---------------------AWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVE-FYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAID-TQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNI 1687
            LP LPGN F R+  K ++H+    D +N     +   +    G      + G PT   P+  +  +M                      A + +DK+VL FDAYF+++ +E  +E   IR   + +YLEDD++ V+EP   NS L QG +++R ++  P  N+   +   D NV   +  YGK F II+CD FT +FL   G+ + +PE +P +     R+ M             DKL QFL  DR VLRF+C WDD ++  G+ R +V+ Y+L DDT+E+REV   N GRD  P  L+RQ++PK               LLN +        +    L+  D +V  + + +DL +G  + V GR+F++ D D FTK++Y     M++ T ++  Q Y    I R  PP+NG GS EDSL NC  L+PQPPK+D +K +E + K     VLR++A L + + +++ RRFIIS++L+ D+  ++E  ++NSG +GGK LE+++I KPG    STE P+YY  +D  IGA I     ++ I DAD+Y  +++E+N    PQ+ +
Sbjct:    8 LPFLPGNSF-RDPAKPRFHRLQTLDYRNG----YAQPRVASAGVGAEAPQWG-PTQVQPSLAELEEMATQQALLTYGPPRTPPPPPFVPAHVIWDKKVLRFDAYFKQNADEYSDEDGFIRPVIIYYYLEDDSMVVMEPPVENSGLTQGKLMKRQQM--PKNNEGHTWHWKDLNVATSITMYGKTFHIINCDRFTADFLESEGILLNEPEAMPSN----PRQEMPPPASAAPMQTALDKLGQFLTMDRKVLRFYCVWDDKES--GEVRPVVLQYYLVDDTLEVREVHQPNDGRDPFPVLLRRQRIPKVW-------------LLNTV-----RATFPSCVLELSDQEVSGWLSPKDLVLGKEVEVMGRRFLLYDADRFTKDFYQKYLKMSDVTPVEPPQQYPTYSITREIPPYNGLGSLEDSLQNCLTLVPQPPKKDVVKMLENNGK-----VLRYEAVLDSVRAVERGRRFIISYYLSTDTVSIYEPPVRNSGIVGGKVLEKTRISKPGT---STESPEYYGPADFAIGATIHAFGHRYIITDADKYVLKFLEENAAMIPQATL 531          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Nematostella
Match: EDO32661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUE4])

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 384/750 (51.20%), Postives = 507/750 (67.60%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPII---RHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLD---LIDYNQVLYFINWRTNPYP----APVSDVETLVSSGELLKGKCVEDINYNQLLSDLL 2281
            MALP LPG +F+R LGK K+HK+H FD +N+V+   G+ K GIGG PLPGQ++    S+YP G G++ PAW+AFD+QVL FDAYFQE+V+E+REEQYRIR CK+ F+LEDD+IQV EP+  NS +PQGT+IRRHRI  P PND  FYTV  FN+G E+  Y ++F++  CD+FTHNFLRKLGV+V +P +IP+D Y   RK M ESMQPLRPYE++D LKQFL HDR VLRF+C WDD+DN++GD REM++HYFLADDTVEIREVIP N+GRDAAP FL+RQ+LPK    L   G  T RT+LNV G    GGR+++D+LKTG    ++Y D DL IG+ +N++GRKF + D D FTK YY  KYG+ +F  I    YR  P +   R  PP+NG+GSEEDSL +C  L+P+PPKRDFIKFMEKDR GLES+VLRF  RL T + +D DRRFIIS+FL+DD+ +VFE   +NSG LGGKFLER  IKKP            Y A D+ IGA ++    +F + DADEYA  YMEK+  EFPQ+NI+ I+ KL+     K  E+ + F E DA N+  V+F    +VL  +   Q L++HE+ T++R++A     D ++  +I  +Q+QLRK NFE+F  ++      D  G   LE  +++ + +  ++P   +LL    D+ L + + +   L++Y Q L  +NWR +P       PV   E   S     K + V+ INY  LL  LL
Sbjct:    1 MALPFLPGQVFDRKLGKTKFHKTHQFDYRNDVSSYVGEAKCGIGGDPLPGQKLKPRHSHYPKGVGAEAPAWVAFDRQVLCFDAYFQEAVHEKREEQYRIRKCKIYFHLEDDSIQVNEPKVDNSGIPQGTLIRRHRIPLPPPNDDQFYTVEHFNIGKEIALYSRIFKVTGCDDFTHNFLRKLGVRVNRPSEIPKDPYTDHRKQMVESMQPLRPYEKEDTLKQFLQHDRRVLRFYCLWDDTDNMFGDAREMILHYFLADDTVEIREVIPPNSGRDAAPMFLRRQRLPKEPTSLRQPGEITGRTVLNVFGPMGHGGRWILDSLKTGAVYTDYYHDSDLTIGSVLNIWGRKFQVCDCDDFTKAYYKSKYGIDSFEPI---KYRAPPAMFPPREVPPYNGFGSEEDSLCSCLSLIPKPPKRDFIKFMEKDRHGLESNVLRFVGRLNTTRPIDMDRRFIISYFLSDDTILVFEPPQRNSGILGGKFLERGSIKKPNAM-------SSYVAQDLFIGATVQFFKHEFVLIDADEYAVEYMEKHSNEFPQANINYILPKLKNIADEKYEELKAIFAENDADNSGKVSFSAFWTVLHRF--GQFLSEHEMLTVSRYFADAKAVDDDLQMVIAAVQEQLRKANFEDFIAMKEACQYEDMHGTGFLEAKDIHNLCRRFNIPAKSELL----DEILARAERNAEGLVNYEQFLRLLNWRDSPVSVQKFVPVQAPEARPSERVGPKDR-VKLINYKSLLQHLL 733          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Nematostella
Match: EDO33757 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR82])

HSP 1 Score: 381.719 bits (979), Expect = 1.448e-123
Identity = 223/587 (37.99%), Postives = 335/587 (57.07%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLP---------------------GQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERK---DKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKV-EFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDS 1747
            MALP LPGN F  +  K KYH+      +N  + +      GIGG P+P                     GQ++ AP  ++       +PA +AFDK+VL F  YF+++V+E   E +R+R  K+ +YLEDD+I V+EP   NS +PQG +I+R R+ K    D+  +   D N+GI + FYGK+F I  CD +T  ++   G+ +  PE I +D YN +R+      QPL  Y      DKLKQF++ DR VLRF+C WDD D+++G+ R  ++HY+L DDTVEIREV   N GRD  P  + RQKL K         T  E +  +V+             L+  D ++ E++   D  +G  +++ GR+F++ D D +TK++Y   +G+T F A+D +    E + +  PP+NG+GS EDSL +C  L+PQPPK+DFIK +E D K     VLR+ A + + +  DK+RRFIIS+ LADD   ++E  ++N+G +GGKFLER++ KKPG    S + P +Y  +D  I +II+I   +F I DADEY  +++E +   +P   I+ I  +  +   + E  ++S
Sbjct:    1 MALPFLPGNSFT-DPTKTKYHRPQTLGWRNGYS-LPTQPIIGIGGDPVPVNKLTQEELDELANIKPSLTYGQKVQAPPEDF-------VPAHVAFDKKVLLFHGYFKQTVHESSNEYFRVRPVKIYYYLEDDSIAVVEPVVENSGIPQGKLIKRQRLPKNDLGDYWHWK--DLNLGINVTFYGKVFFICDCDAWTREYMASEGIDLNPPESIAKDPYNESRQ------QPLHSYTTPSTFDKLKQFIELDRKVLRFYCVWDDRDSMFGEMRPCILHYYLVDDTVEIREVHTPNDGRDPFPVLVCRQKLAKDR-------TDVESSFPSVV-------------LELSDHEIKEWFRPRDFMVGRTLHIMGRRFLLYDCDQYTKDFYRTNFGVTEFPAVDVKGAPRELLEKVTPPYNGFGSLEDSLQSCLSLVPQPPKKDFIKMLENDHK-----VLRYAASMESVRPEDKNRRFIISYRLADDMLTIYEPPVRNAGIIGGKFLERTRAKKPGS---SVDNPNFYNPADFKIDSIIQIFKHRFRITDADEYVLKHLESHAGHYPIETINSIRQRHGRPPTTTEELLNS 542          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Medaka
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:101168160])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 310/744 (41.67%), Postives = 456/744 (61.29%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEP-LPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPY-PAPVSDV---ETLVSSGELLKGKCVEDINYNQLLSDLL 2281
            +LP LPGN F+ +LG+E++HKS HF     +  + G +K GIGG PLPGQ+I A  S YP  DGS +P+W+AFDKQVL F+AYFQE      +E Y+IR CKV FY EDDTI+V+EP  +NS +PQGT+I RHRI  P PND  +Y V  FN+  ++ FY + F + +CD FT NFL +LGVQ+  P  +P D Y+  R+  +++  P+ PYE+ +KL+QFLD+DR VLRF+CFW+D +N     RE+++HYFL DDT++I EV  A AG  +A  FL+R+KLPK +   +  +G  TE  LLNVLG    G R++ D LKTG  K +FY D DL+IG  +NV+GR+ VI D D FTK++Y +KYG+ +FT +  +        +  PP+NG+GSEEDSL +C+G+  + P++D   F+EKD     S VL+F+A++ TD   ++ R+F+ISF+  D +  V+E  LK+SG  GGKFL RS +KKPGQ + S      Y A D+++GA + I+   F + +ADEY  +YME++  EF ++N   I+ KLR     K+ EI       D  N   +++   +++L     +  L DHE+  + R ++ +   + +V+ ++ V Q  LR+  +++F  +   F K D   N ++ R     I + +H+P+S++LL  L  +       D IDY   L  INW  +P  P    D+   E     G +  G+   ++NY+ LL D+L
Sbjct:    3 SLPFLPGNSFDLHLGRERFHKSQHFALVEGLPKLVGLEKPGIGGEPLPGQKIKAAHSVYPKVDGSHVPSWLAFDKQVLCFEAYFQE------KEPYQIRKCKVYFYPEDDTIKVVEPVCKNSGIPQGTLIYRHRIPLPPPNDDQYYKVFHFNINQQVVFYSRTFTLTNCDTFTRNFLTRLGVQLNDPAPVPDDPYSRQRQQFEKNTNPIPPYEKNNKLRQFLDYDRQVLRFYCFWNDQENPSAKPRELILHYFLFDDTIQIHEVTSAKAGNKSAVKFLQRRKLPKSLPAQVDQLGGDTESILLNVLGSDGLGNRFMADRLKTGAVKQDFYKDCDLRIGGEVNVWGRRVVIADCDEFTKQHYRFKYGIEDFTPVKYKLPPTPKPPKTLPPYNGFGSEEDSLSSCYGIQLRRPRKDLQSFLEKD-----SIVLKFRAKMKTDDGNERKRKFVISFYPCDGTMSVYELSLKSSGMPGGKFLRRSVVKKPGQSKPSER----YTAQDLYVGAELHISGQTFMLVNADEYTLKYMEQHAEEFSKANTGNILSKLRSIPEDKKSEIKKFLTLSDPNNTGLISYESFRNMLMDL--DCGLVDHEVLVLGRTFSEQQQPEDDVALMLAVAQDTLRRKLYDDFQSLTLAFNKQDPLKNGRIPRKMAWNICESVHLPVSENLLGTLLTKF---EGADGIDYQAFLAGINWVEHPASPVKYEDILRFEVNARVGAVEAGR--RNVNYSALLQDVL 724          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Medaka
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:101168160])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 303/731 (41.45%), Postives = 446/731 (61.01%), Query Frame = 2
Query:  104 LGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEP-LPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPY-PAPVSDV---ETLVSSGELLKGKCVEDINYNQLLSDLL 2281
            LG+E++HKS HF     +  + G +K GIGG PLPGQ+I A  S YP  DGS +P+W+AFDKQVL F+AYFQE      +E Y+IR CKV FY EDDTI+V+EP  +NS +PQGT+I RHRI  P PND  +Y V  FN+  ++ FY + F + +CD FT NFL +LGVQ+  P  +P D Y+  R+  +++  P+ PYE+ +KL+QFLD+DR VLRF+CFW+D +N     RE+++HYFL DDT++I EV  A AG  +A  FL+R+KLPK +   +  +G  TE  LLNVLG    G R++ D LKTG  K +FY D DL+IG  +NV+GR+ VI D D FTK++Y +KYG+ +FT +  +        +  PP+NG+GSEEDSL +C+G+  + P++D   F+EKD     S VL+F+A++ TD   ++ R+F+ISF+  D +  V+E  LK+SG  GGKFL RS +KKPGQ + S      Y A D+++GA + I+   F + +ADEY  +YME++  EF ++N   I+ KLR     K+ EI       D  N   +++   +++L     +  L DHE+  + R ++ +   + +V+ ++ V Q  LR+  +++F  +   F K D   N ++ R     I + +H+P+S++LL  L  +       D IDY   L  INW  +P  P    D+   E     G +  G+   ++NY+ LL D+L
Sbjct:   13 LGRERFHKSQHFALVEGLPKLVGLEKPGIGGEPLPGQKIKAAHSVYPKVDGSHVPSWLAFDKQVLCFEAYFQE------KEPYQIRKCKVYFYPEDDTIKVVEPVCKNSGIPQGTLIYRHRIPLPPPNDDQYYKVFHFNINQQVVFYSRTFTLTNCDTFTRNFLTRLGVQLNDPAPVPDDPYSRQRQQFEKNTNPIPPYEKNNKLRQFLDYDRQVLRFYCFWNDQENPSAKPRELILHYFLFDDTIQIHEVTSAKAGNKSAVKFLQRRKLPKSLPAQVDQLGGDTESILLNVLGSDGLGNRFMADRLKTGAVKQDFYKDCDLRIGGEVNVWGRRVVIADCDEFTKQHYRFKYGIEDFTPVKYKLPPTPKPPKTLPPYNGFGSEEDSLSSCYGIQLRRPRKDLQSFLEKD-----SIVLKFRAKMKTDDGNERKRKFVISFYPCDGTMSVYELSLKSSGMPGGKFLRRSVVKKPGQSKPSER----YTAQDLYVGAELHISGQTFMLVNADEYTLKYMEQHAEEFSKANTGNILSKLRSIPEDKKSEIKKFLTLSDPNNTGLISYESFRNMLMDL--DCGLVDHEVLVLGRTFSEQQQPEDDVALMLAVAQDTLRRKLYDDFQSLTLAFNKQDPLKNGRIPRKMAWNICESVHLPVSENLLGTLLTKF---EGADGIDYQAFLAGINWVEHPASPVKYEDILRFEVNARVGAVEAGR--RNVNYSALLQDVL 721          
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Medaka
Match: efhc1 (EF-hand domain containing 1 [Source:NCBI gene;Acc:101173758])

HSP 1 Score: 219.55 bits (558), Expect = 2.205e-62
Identity = 178/586 (30.38%), Postives = 272/586 (46.42%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKN------EVNFMFG-----DDKNGIGGAPLPGQRIGAPTSNYPAGDGSKM------PAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDH-LFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQ--PPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEV 1762
             LP LPG  F  +  K  +H+    D KN       ++   G      ++       L     G P  + P G   +       P ++A DK+VL F A+F+E      EE YR+    + ++LEDDT+ ++EP+  NS    G  ++R +I K   NDH  +Y   D N+G++L+ YG  + I  CD+FT  F+   G+ + +PE  P+D Y   RK    S QP       DKL QFL  D  VL F    +D +  Y     + IHYFL DDTVEIREV+     ++  P  ++R K+PK M+      ++T  T +  + H        +D         E+Y+ +D Q+G  + +  R F++ D D FTK+YY   +       ++       P             +++ L       PQ  PPK      +EK+ + L + VLR+KA+LV+    DKDR FI+ + L + +  +FE     S F  G  L    + KPG    S E P  Y  +D  IGA +E+ + +F + DAD Y  +Y+E    + P   +D +  KL  +  + E    SH  +V
Sbjct:    9 GLPFLPGYSFP-DYTKSAFHRPQTLDYKNGYPLAQRLSMGIGQELHLSEQLSTTAQHLSDLSFGMPGED-PYGASDRKVYEPFKPVYVALDKKVLCFKAFFKEEFLNSSEE-YRVCPVVIYYHLEDDTMTIVEPKEENSGFEHGKRLKRQKIPK---NDHGEYYLWKDLNIGMDLKVYGFTYHITQCDDFTKEFMESEGIILNEPEPTPEDPYIKKRKG---SPQPHTQPSTTDKLHQFLTMDGKVLSFSALGEDVNRQY--TLPVTIHYFLVDDTVEIREVVYKGRRQNHFPVVMRRVKIPKKMK------SETFPTCVMEISHLD------VD---------EYYSPKDFQLGQTVTLLARSFLLCDCDDFTKKYYKENHPDMEMKPLEVPEKVDTP-------------QKEKLKMA---APQKNPPK------VEKNLENL-NKVLRYKAKLVSPYPEDKDRSFILMYSLFNQTISIFEK--GTSSFDSGFLLRNRHVPKPGS---SQENPDLYSPADFAIGATVEVFSHRFILTDADLYVLKYLESISDQVPSQTLDSLRQKLSTQSNNGEEVKSSHVSQV 534          
BLAST of EF-hand domain-containing family member C2 vs. Planmine SMEST
Match: SMESG000076759.1 (SMESG000076759.1)

HSP 1 Score: 1514.98 bits (3921), Expect = 0.000e+0
Identity = 740/742 (99.73%), Postives = 740/742 (99.73%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVSSGELLKGKCVEDINYNQLLSDLLGA 2287
            MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAIIEINNF FFIEDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSA IGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVSSGELLKGKCVEDINYNQLLSDLLGA
Sbjct:    1 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAIIEINNFNFFIEDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSAFIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVSDVETLVSSGELLKGKCVEDINYNQLLSDLLGA 742          
BLAST of EF-hand domain-containing family member C2 vs. Planmine SMEST
Match: SMESG000066984.1 (SMESG000066984.1)

HSP 1 Score: 926.006 bits (2392), Expect = 0.000e+0
Identity = 455/746 (60.99%), Postives = 570/746 (76.41%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGS-KMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINWRTNPYPAPVS---DVETLVSSGELLK---GKCVEDINYNQLLSDL 2278
            M+LPL+PG  F+R +GKEK+HKSH+FD+KN++ F FG DK GIGG PLPGQRI APTS+YP  + + K PAW+AFDKQVL FDAY+QE+V E   EQYRIRNCK+ FYLEDDTIQVIEPR RNS LPQGTII+RHRI+K  P DHL+YTVHDFNVGI++ FY K+FRI+SCD FT NFLRKLGV +G PE IP+D + + RKA++ESMQPLRPYERKD LKQFLDHDRHVLRFFCFWDD+D+LYGD REM++HYFL+DDT+E+RE+IP NAGRDAAP+FL+RQKLPK +EPLP +GT T+R +LNVLGHPQRGGR+++D+LKTG+ K+++YTD DL IG+ IN++GRK VI  MD FTKE+Y  KYG+  F  I     +G P++  +PP+NGWG+EEDSL NCHGL+PQP K+D+I+FMEKDR+GL+S++LRFKARL+TDK LD DRRFIISFFL DDS ++FE  ++NSGF GG FLER+KIKKPGQER+STELP YY   D++IGAI+EIN FKF IEDADEYAY YME +  EF  S+IDRI+ K+      K  E+ ++F   D  N  TV F QL  +LR  +S  ELTDHEI  +AR YA R + +VNV  +IG+ QQ+LRK++FE+ + ++   +++D      L R EM  I K+LH+   + LLQ LFD      D   I Y+Q ++ +NWR NPY AP      VE   S     K   GK V++I Y +L+ DL
Sbjct:    1 MSLPLIPGQCFDRKIGKEKFHKSHYFDNKNDIRFSFGIDKIGIGGDPLPGQRINAPTSHYPFNNNTTKSPAWVAFDKQVLAFDAYYQEAVTESPAEQYRIRNCKIFFYLEDDTIQVIEPRIRNSGLPQGTIIKRHRISKKEPEDHLYYTVHDFNVGIDINFYDKVFRIVSCDIFTENFLRKLGVHIGFPEMIPEDQHFIQRKALEESMQPLRPYERKDTLKQFLDHDRHVLRFFCFWDDTDSLYGDPREMILHYFLSDDTIEVREIIPVNAGRDAAPSFLRRQKLPKKLEPLPEVGTITDRIVLNVLGHPQRGGRFVLDSLKTGEKKIDYYTDADLTIGSYINLYGRKVVICSMDEFTKEFYRTKYGIQTFNDIRYSINKGVPVVHQDPPYNGWGTEEDSLANCHGLIPQPRKKDYIRFMEKDRRGLDSNILRFKARLITDKPLDVDRRFIISFFLTDDSILIFEPPIRNSGFAGGVFLERNKIKKPGQERFSTELPIYYLCQDLYIGAILEINTFKFLIEDADEYAYHYMETHPYEFAHSSIDRILRKMHPNAVGKRSEMMAYFVRQDPENRGTVNFAQLTCLLRQMYSPAELTDHEITILARQYAHRPINEVNVPEIIGIAQQELRKISFEDLTGLKEACLRSDIDKRGYLSREEMRAICKVLHITFPEGLLQALFD-ISQNADNTGICYDQFIWHLNWRLNPYQAPCEPDLPVELAYSWKATEKSPVGKLVDEIFYEKLVHDL 745          
BLAST of EF-hand domain-containing family member C2 vs. Planmine SMEST
Match: SMESG000078434.1 (SMESG000078434.1)

HSP 1 Score: 369.392 bits (947), Expect = 1.480e-117
Identity = 239/695 (34.39%), Postives = 369/695 (53.09%), Query Frame = 2
Query:   65 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGA----------PTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDH-EICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIK--ADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQ 2098
             LP+LPGN F R++ K  +H S     KN           GIGG PL   ++            PT  Y     A   + +P  +AFDK+VL F  Y++E+V E   E YR+ + K+ +YLEDD+IQ+ E    NS +PQGTI+RR R+ K    DH  YT  D N G  +  YGK++R  SCD+FT ++L   G+ V  PE IP+D Y L  +A  E+++  +     D  KQFL+ D+ +LRF+  WDD D ++G+ R  +IHY+L++DT+EI+EV   N GRD  P  ++R ++PK  + +         T  NV           +  L   + K E+++ +DL+IG  INV GR+F++ D D FTK +Y   +G T+FT I   +   E      PP+NG+G+ EDSL N    MPQPPK+DFIK ++ + K     VLR++ ++ + +  DKDRRFI+S+ LADD   ++E   +NSGFLGG FL+R+++ KPG    + + P+YY   D  +GAIIE+   +F I  AD Y   +M+ N   FP+  I+ +   L                                       +E+++  H E+    R    R  KD ++  ++  ++ QL+++   + ++I  MF++   D+ G+  LE   M  I + +++P  +D+L  L ++
Sbjct:    3 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDH--YTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPY-LAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSP-------TFPNV-----------VLELTPNEIK-EYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENK-----VLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--------------------------------------IAEEQMRPHKEVIKGGRVTICR--KDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLE--NMQDICRKMNLPDDEDILACLLEE 624          
BLAST of EF-hand domain-containing family member C2 vs. Planmine SMEST
Match: SMESG000078434.1 (SMESG000078434.1)

HSP 1 Score: 364.77 bits (935), Expect = 7.639e-116
Identity = 237/692 (34.25%), Postives = 367/692 (53.03%), Query Frame = 2
Query:   74 LLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGA----------PTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAXXXXXXXXXXXXDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDH-EICTIARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIK--ADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQ 2098
            +LPGN F R++ K  +H S     KN           GIGG PL   ++            PT  Y     A   + +P  +AFDK+VL F  Y++E+V E   E YR+ + K+ +YLEDD+IQ+ E    NS +PQGTI+RR R+ K    DH  YT  D N G  +  YGK++R  SCD+FT ++L   G+ V  PE IP+D Y L  +A  E+++  +     D  KQFL+ D+ +LRF+  WDD D ++G+ R  +IHY+L++DT+EI+EV   N GRD  P  ++R ++PK  + +         T  NV           +  L   + K E+++ +DL+IG  INV GR+F++ D D FTK +Y   +G T+FT I   +   E      PP+NG+G+ EDSL N    MPQPPK+DFIK ++ + K     VLR++ ++ + +  DKDRRFI+S+ LADD   ++E   +NSGFLGG FL+R+++ KPG    + + P+YY   D  +GAIIE+   +F I  AD Y   +M+ N   FP+  I+ +   L                                       +E+++  H E+    R    R  KD ++  ++  ++ QL+++   + ++I  MF++   D+ G+  LE   M  I + +++P  +D+L  L ++
Sbjct:    1 MLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDH--YTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPY-LAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSP-------TFPNV-----------VLELTPNEIK-EYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENK-----VLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--------------------------------------IAEEQMRPHKEVIKGGRVTICR--KDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLE--NMQDICRKMNLPDDEDILACLLEE 619          
BLAST of EF-hand domain-containing family member C2 vs. Planmine SMEST
Match: SMESG000003987.1 (SMESG000003987.1)

HSP 1 Score: 225.713 bits (574), Expect = 1.039e-67
Identity = 114/275 (41.45%), Postives = 167/275 (60.73%), Query Frame = 2
Query:   62 MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAA 886
            MALPL PG  F+R+LGK    +    D   +    + +DK      P        P        G+K P+W+ +DK+VL FD Y+ E+V E  ++ Y  R+CKV +YLEDDT+QV+EPR RNS L QGT+++R +  K  P+D+LFY +HDFN+G  L+  G+  ++ SCD FT N+LR+LGV +  P   P D     +  +    +    Y + D L QFLD+++++LRF+CF+D++D +Y D R M +HYFL DDT+EI E +P N GR+ +
Sbjct:    1 MALPLWPGFCFDRDLGKSNRPRIQVLDRIRDTTHTYYNDKLFKSKTPRKDDLPFEPR-------GAKGPSWVVYDKKVLCFDGYWLENVTEEPDKFYNCRSCKVFYYLEDDTVQVLEPRIRNSRLCQGTVVKRMKFLKSPPDDNLFYNIHDFNIGSILQLCGRHIKLTSCDNFTFNYLRRLGVDIKNPIPQPIDPVESLKNNLAGQKKGKGFYRKNDTLGQFLDYNKYILRFYCFFDNTD-IYNDPRSMNLHYFLEDDTMEIMENLPNNCGREVS 267          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EFHC20.000e+046.34EF-hand domain containing 2 [Source:HGNC Symbol;Ac... [more]
EFHC14.764e-12137.16EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
EFHC16.954e-12140.20EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
EFHC18.723e-12140.20EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
EFHC11.303e-12040.20EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
efhc-11.785e-1932.88EF-Hand domain-Containing protein 1 homolog [Sour... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Efhc1.22.843e-14235.19gene:FBgn0034487 transcript:FBtr0086316[more]
Efhc1.17.013e-13337.18gene:FBgn0030691 transcript:FBtr0074192[more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
efhc20.000e+048.66EF-hand domain (C-terminal) containing 2 [Source:N... [more]
efhc28.942e-13158.82EF-hand domain (C-terminal) containing 2 [Source:N... [more]
efhc14.749e-11537.88EF-hand domain (C-terminal) containing 1 [Source:Z... [more]
efhb3.579e-727.73EF-hand domain family, member B [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efhc20.000e+051.98EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc20.000e+051.98EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc20.000e+050.85EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc20.000e+054.10EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc20.000e+052.43EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Efhc20.000e+044.75EF-hand domain (C-terminal) containing 2 [Source:M... [more]
Efhc11.050e-11335.06EF-hand domain (C-terminal) containing 1 [Source:M... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32TF8|EFHC2_DANRE0.000e+048.53EF-hand domain-containing family member C2 OS=Dani... [more]
sp|Q32TG3|EFHC2_CHICK0.000e+045.39EF-hand domain-containing family member C2 OS=Gall... [more]
sp|Q5JST6|EFHC2_HUMAN0.000e+046.34EF-hand domain-containing family member C2 OS=Homo... [more]
sp|Q9D485|EFHC2_MOUSE0.000e+044.75EF-hand domain-containing family member C2 OS=Mus ... [more]
sp|Q5JVL4|EFHC1_HUMAN2.288e-12037.16EF-hand domain-containing protein 1 OS=Homo sapien... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LJA50.000e+057.06Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LIE00.000e+058.19Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A267FRT00.000e+056.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0X3PC410.000e+051.75EF-hand domain-containing family member C2 (Fragme... [more]
A0A267E8T20.000e+056.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efhc20.000e+047.39EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc20.000e+046.34EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc20.000e+045.80EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc15.243e-10235.74EF-hand domain containing 1 [Source:NCBI gene;Acc:... [more]
efhc11.077e-10135.74EF-hand domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
efhc11.031e-10235.46EF-hand domain (C-terminal) containing 1 [Source:Z... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO326610.000e+051.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337571.448e-12337.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
efhc20.000e+041.67EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc20.000e+041.45EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc12.205e-6230.38EF-hand domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of EF-hand domain-containing family member C2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076759.10.000e+099.73SMESG000076759.1[more]
SMESG000066984.10.000e+060.99SMESG000066984.1[more]
SMESG000078434.11.480e-11734.39SMESG000078434.1[more]
SMESG000078434.17.639e-11634.25SMESG000078434.1[more]
SMESG000003987.11.039e-6741.45SMESG000003987.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005253 ID=SMED30005253|Name=EF-hand domain-containing family member C2|organism=Schmidtea mediterranea sexual|type=transcript|length=2358bp
TTTGTTATAACTTAATATATCATAGAAACGTTACTTAGCAACTGAGTTTA
ATATTTTAAAAATGGCTTTACCTCTTTTACCGGGTAATATATTCAATAGG
AATTTAGGAAAAGAAAAATATCATAAATCTCATCATTTTGATAGTAAAAA
TGAAGTTAATTTCATGTTTGGTGATGACAAGAATGGCATTGGAGGGGCTC
CGTTGCCAGGACAGAGGATTGGCGCACCAACTAGTAATTATCCAGCGGGA
GATGGAAGTAAAATGCCAGCCTGGATCGCATTTGATAAACAAGTCTTATT
TTTTGATGCCTACTTTCAAGAATCCGTGAATGAAAGAAGAGAAGAACAAT
ATAGAATTAGAAATTGCAAAGTTATGTTTTATCTTGAGGATGACACAATT
CAAGTTATCGAGCCTCGTACACGTAATAGTTGCTTGCCACAAGGAACAAT
AATCCGTCGTCACAGAATAGCTAAACCGGCACCAAATGACCATTTGTTTT
ACACTGTGCATGATTTCAATGTCGGGATCGAATTAGAATTTTATGGGAAG
TTATTTCGTATAATCAGCTGTGATGAATTTACTCACAATTTTCTAAGAAA
ACTTGGAGTGCAAGTAGGGCAACCGGAAAAGATTCCACAGGATAATTATA
ATTTAACTCGAAAGGCAATGGATGAATCTATGCAGCCTCTTAGACCATAT
GAGAGAAAGGATAAATTGAAACAGTTTCTTGATCATGATCGTCATGTTTT
AAGGTTTTTCTGTTTCTGGGATGATTCGGATAATTTGTATGGAGATAAAC
GAGAAATGGTCATTCATTATTTTCTAGCTGACGACACCGTGGAGATTCGT
GAAGTTATTCCTGCAAATGCTGGTAGAGATGCAGCTCCAACATTTTTGAA
GCGACAAAAATTGCCGAAATATATGGAACCACTCCCAAGCATTGGAACTC
AAACTGAAAGAACGTTGCTTAATGTTTTAGGTCATCCACAGCGAGGTGGC
AGATATTTAATTGATAATTTAAAAACCGGAGACACAAAAGTTGAATTCTA
TACTGATGAAGATCTTCAAATCGGAGCTTGCATTAATGTTTTTGGGAGAA
AATTCGTTATAACGGATATGGACATGTTCACTAAAGAATATTATAATTAC
AAATATGGAATGACGAATTTTACTGCAATTGATACTCAAAATTACCGCGG
AGAACCAATAATTCGTCATGAACCGCCATTTAATGGCTGGGGATCGGAGG
AAGATTCACTGGGTAATTGTCATGGCTTAATGCCTCAACCCCCAAAACGA
GATTTCATCAAATTTATGGAGAAAGATCGCAAAGGCTTAGAATCCCACGT
TTTAAGATTTAAAGCTAGACTTGTTACTGATAAAGTATTAGATAAAGACA
GGCGATTTATAATTTCATTCTTTTTGGCCGATGACAGCGCTGTTGTGTTT
GAAACTGTACTAAAAAATTCAGGATTTCTTGGAGGGAAATTTCTCGAACG
AAGCAAAATTAAAAAACCCGGACAAGAAAGATACAGTACAGAATTGCCTA
AATATTACCAAGCTTCAGATATACATATCGGAGCTATTATAGAAATTAAC
AATTTCAAATTTTTCATTGAAGATGCTGATGAATATGCTTACAGATACAT
GGAGAAAAATTACATTGAATTCCCACAAAGTAATATTGATAGAATTATGC
TGAAACTGAGACAAAAATTTGCTTCCAAAGAGAGAGAAATAGATTCACAT
TTTAAAGAGGTTGATGCGCGGAATGCGATGACCGTTACCTTTCATCAACT
TCAATCGGTTTTACGAATATGGTTTTCTGAACAAGAATTAACAGACCATG
AGATCTGTACCATTGCTAGACATTATGCAGCAAGGTCTGTCAAAGATGTT
AATGTTTCCGCCTTGATTGGTGTTATTCAGCAACAATTAAGAAAAGTTAA
TTTCGAAGAGTTTTCTCAAATACAGAACATGTTTATCAAAGCTGATAAGA
GAGGTAATTGTCAATTGGAAAGAGCTGAAATGAATAAAATTTTTAAACTT
CTTCACGTACCGATTTCCCAAGATCTTTTACAAATACTGTTTGATCAATG
TTTGGTTCAACCTGATCTTGATTTGATCGATTACAATCAGGTTTTATATT
TCATCAATTGGCGCACTAATCCGTATCCGGCACCCGTTTCGGACGTGGAA
ACTCTAGTAAGTTCCGGAGAACTTCTAAAAGGAAAATGTGTAGAAGATAT
TAATTATAATCAATTACTCTCAGACTTGTTAGGAGCTTGAATACAAAAAT
ATTAACATCATTGATGAAATATACATTTTACTATCTTAATAAATAAATAT
TTGTCTGG
back to top

protein sequence of SMED30005253-orf-1

>SMED30005253-orf-1 ID=SMED30005253-orf-1|Name=SMED30005253-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=743bp
MALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPG
QRIGAPTSNYPAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIR
NCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVH
DFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTR
KAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMV
IHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTER
TLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVI
TDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSL
GNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFI
ISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQ
ASDIHIGAIIEINNFKFFIEDADEYAYRYMEKNYIEFPQSNIDRIMLKLR
QKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDHEICT
IARHYAARSVKDVNVSALIGVIQQQLRKVNFEEFSQIQNMFIKADKRGNC
QLERAEMNKIFKLLHVPISQDLLQILFDQCLVQPDLDLIDYNQVLYFINW
RTNPYPAPVSDVETLVSSGELLKGKCVEDINYNQLLSDLLGA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040193EFHC1/EFHC2/EFHB
IPR006602Uncharacterised_DM10
IPR010554DUF1126
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006602Uncharacterised domain DM10SMARTSM00676dm10coord: 75..182
e-value: 1.1E-40
score: 151.2
coord: 226..365
e-value: 1.9E-42
score: 157.0
coord: 427..534
e-value: 5.4E-29
score: 112.3
IPR006602Uncharacterised domain DM10PROSITEPS51336DM10coord: 75..182
score: 32.359
IPR006602Uncharacterised domain DM10PROSITEPS51336DM10coord: 226..365
score: 34.705
IPR006602Uncharacterised domain DM10PROSITEPS51336DM10coord: 427..534
score: 33.245
IPR010554Domain of unknown function DUF1126PFAMPF06565DUF1126coord: 416..525
e-value: 6.6E-28
score: 96.6
coord: 69..174
e-value: 1.1E-29
score: 102.4
coord: 219..357
e-value: 8.4E-34
score: 115.6
NoneNo IPR availableGENE3DG3DSA:2.30.29.170coord: 418..544
e-value: 3.1E-24
score: 86.9
coord: 65..195
e-value: 3.5E-46
score: 157.9
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 554..698
e-value: 8.1E-9
score: 37.5
NoneNo IPR availablePANTHERPTHR12086:SF11EF-HAND DOMAIN-CONTAINING FAMILY MEMBER C2coord: 2..739
IPR040193EF-hand domain-containing protein EFHC1/EFHC2/EFHBPANTHERPTHR12086EF-HAND DOMAIN C-TERMINAL CONTAINING PROTEINcoord: 2..739
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 555..590
score: 7.261
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 632..667
score: 9.213
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 558..693