Maestro heat-like repeat-containing protein family member 1

Overview
NameMaestro heat-like repeat-containing protein family member 1
Smed IDSMED30005250
Length (bp)5396
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Maestro heat-like repeat-containing protein family member 1 (SMED30005250) t-SNE clustered cells

Violin plots show distribution of expression levels for Maestro heat-like repeat-containing protein family member 1 (SMED30005250) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Maestro heat-like repeat-containing protein family member 1 (SMED30005250) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Maestro heat-like repeat-containing protein family member 1 (SMED30005250) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005250

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005250SMESG000073404.1 Contig1414GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30005250SMESG000073404.1 dd_Smed_v4_3372_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Human
Match: MROH1 (maestro heat like repeat family member 1 [Source:HGNC Symbol;Acc:HGNC:26958])

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 477/1746 (27.32%), Postives = 856/1746 (49.03%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALK----ILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEERED--LSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNC-LPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLL 5332
            LA  L++ + D++   +E +  +L SLG   P   L     +L +    K++  +R ++L +M  +L  +  ++    D  S II     E+T +K+++ +WQ  A+ VLV +   +   +M  L+ +L P  LPH  V+H L +++V N + +V +L  +++ +L +L +AK D  R    ++  +F E  LEY+AN DRAPDP V   +F+  IFSA++V F  WL ++E+KLR AV++A+G M  ++     E  LPKL+ GI+  YKKH E+++++K+L Q+L++A                          +   S   E +    +  L  Q C+   +   L        + NQ EV RCFT +    PD+L++  L RL+   E+ ++  L ++RH+I+S   Q+  K+  I+S            S        ++ VK  +   I AM    YL + GG  +IE+IV+QCAL  + E   +K      D   + V      R +    L L S+T+  M  VLWPYL++ L PV  T A+  +C S+ +L             + + E+  ++     +I YD H ++P P  +  RL+V++  P   + RG   L+ + +L  N H  L   W+  +P L+ YL++     L  +        +WEE LL  +  ++  I+D  W  +    + +Q+  YD+ P+E+ FL+KC+GT L  ++ K  + K L  +  + R+ E  ER G A  FG+CA +HL+  LA+LE +  +E  +++ G+  +FKD+      + +E +++++IL  G+    A  ELV +++ES++++ +  +    KD  +   +V+S+ +V+RA+  +    ++ F  + +LV+ ++ +I AE   +L   +R  AM T   L+ + P +       V++ C+ ++  L P+       KE   +D      L  +T++ L +L+ ++L+   +      + + +     S   H R RAL    +LL  + + +    +   P + +G L G   PR AD     RQ  +DCV     +QL  E   RD   D +  ++ ++K+ L   D  ILF   + + ++I KR+ P ++  LL ++FE L D +KN + A  VM N L + R   L E+V  I++ L    S L++     VL A +    +L++Q+    +++ +   LPLD     +   +A +  +  + L  L+E  SR +PF+E     L +   +  ++  +  +C ++       +++ +   + G   L ++Y +LF  +++  S ++   LP   ++ E++    A     + P +   +TL++ L  + S ++++ ++++ GW+ L            LAR++  +    +  ++  L+   +S YE  R+  T F  + ++    AN   L+D ++  L +R  D C  VRRL L G+ N+       V+ H   LL+A++ G+DD  +    +   AM GLA L+  +   D+R  L+ V +R+   ++ +    R ++ RLFG L ++  G   + FL ++   + PLL+HL+DP   V  AC+ AL+   P              +L   +L+   +  L+E   LHFGEF N   K       D +  ++   L YFKS +  + A++ L  G L+ + + ++   +   Q+   L  LLK    +VR R AEA+  L
Sbjct:    9 LASTLLDAITDKDPLVQEQVCSALCSLGEARPVETLRACEEYLRQHD--KLAHPYRAAVLRAMERVLSSRASELDK--DTASTIILLASSEMTKTKDLVWDWQQAASGVLVAVGRQFISKVMEELLRRLHPGTLPHCAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDTVRVAFCSALQRFSEGALEYLANLDRAPDPTVRKDAFATDIFSAYDVLFHQWLQSREAKLRLAVVEALGPMSHLLPSERLEEQLPKLLPGILALYKKHAETFYLSKSLGQILEAA--------------------------VSVGSRTLETQLDALLAALHSQICVPVESSSPLV-------MSNQKEVLRCFTVLACSSPDRLLAFLLPRLDTSNERTRVGTLQVVRHVINSAAAQMEDKKPFILS------------SMRLPLLDTNSKVKRAVVQVISAMAHHGYLEQPGGEAMIEYIVQQCALPPEQE--PEKPGPGSKDPKADSV------RAISVRTLYLVSTTVDRMSHVLWPYLLQFLTPVRFTGALTPLCRSLVHL------------AQKRQEAGADAF----LIQYDAHASLPSPYAVTGRLLVVSSSPYLGDGRGAAALRLLSVLHPNIHPLLGQHWETTVPLLLGYLDEHTEETLPQE--------EWEEKLLMFLRDTLAIISDNAWICQLSLELCRQLPCYDEAPQEKNFLYKCIGTTLGAASSKEVVRKHLQELLETARYQEEAEREGLACCFGICAISHLEDTLAQLEDFVRSEVFRKSIGILNIFKDR----SENEVEKVKSALILCYGHVAARAPRELVLAKVESDILRNICQHFS-TKDPALKLCLVQSVCMVSRAICSSTQAGSFHFTRKAELVAQMMEFIRAEPPDSLRTPIRKKAMLTCTYLVSVEPALDEQARADVIHGCLHSIMALLPE------PKE---EDGGCQKSLYLETLHALEDLLTSLLQRNMTPQGLQIMIEHLSPWIKSPRGHERARALGLSALLLRYFLEHLR--VSALVPFHNLGLLIGLFSPRCADLWPATRQEAVDCVYSLLYLQLGYEGFSRDYRDDVAERLL-SLKDGLVHPDPAILFHTCHSVGQIIAKRLPPDQLISLLLTMFEALGDPEKNCSRAATVMINCLLQERGGVLQEKVPEIVSVLR---SKLQEAQGEHVLPAAQHSVYLLATQHCAAVVSSLLGSPLPLDSHTCMLWRALAVEPRLAAQVLGLLLEKMSRDVPFKESRAFLLGRTPDRVATLLPLSATCALF-------EVMSTP--AAGPAVL-ELYPQLFVVLLLRVSCTVGVQLPRNLQAQERRGASPALATRNLEPCSSAVDTLRSMLLRSGSEDVVQRMDLEGGWELLRTSAGHEEGATRLARAMAEHAGPRLPLVLKTLACTHSSAYENQRVTTTAFL-AELLNSNVANDLMLLDSLLESLAARQKDTCASVRRLVLRGLANLASGCPDKVRTHGPQLLTAMIGGLDDGDNPHSPVALEAMLGLARLVHLVESWDLRSGLLHVAIRIRPFFDSEKMEFRTASIRLFGHLNKVCHGDCEDVFLDQVVGGLAPLLLHLQDPQATVASACRFALRMCGP--------------NLACEELSAAFQKHLQEGRALHFGEFLNTTCKHLMHHFPDLLGRLLTTCLFYFKSSWENVRAAAPLFTGFLVLHSEPRQQPQVDLDQLIAALQILLKDPAPEVRTRAAEALGRL 1628          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Human
Match: MROH1 (maestro heat like repeat family member 1 [Source:HGNC Symbol;Acc:HGNC:26958])

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 480/1755 (27.35%), Postives = 858/1755 (48.89%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI---------KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALK----ILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEERED--LSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNC-LPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLL 5332
            LA  L++ + D++   +E +  +L SLG   P   L     +L +    K++  +R ++L +M  +L  +  ++    D  S II     E+T +K+++ +WQ  A+ VLV +   +   +M  L+ +L P  LPH  V+H L +++V N + +V +L  +++ +L +L +AK D  R    ++  +F E  LEY+AN DRAPDP V   +F+  IFSA++V F  WL ++E+KLR AV++A+G M  ++     E  LPKL+ GI+  YKKH E+++++K+L Q+L++A                          +   S   E +    +  L  Q C+   +   L        + NQ EV RCFT +    PD+L++  L RL+   E+ ++  L ++RH+I+S   Q+  K+  I+S            S        ++ VK  +   I AM    YL + GG  +IE+IV+QCAL  + E   +K      D   + V      R +    L L S+T+  M  VLWPYL++ L PV  T A+  +C S+ +L             + + E+  ++     +I YD H ++P P  +  RL+V++  P   + RG   L+ + +L  N H  L   W+  +P L+ YL++     L  +        +WEE LL  +  ++  I+D  W  +    + +Q+  YD+ P+E+ FL+KC+GT L  ++ K  + K L  +  + R+ E  ER G A  FG+CA +HL+  LA+LE +  +E  +++ G+  +FKD+      + +E +++++IL  G+    A  ELV +++ES+++         KVL   ++  KD  +   +V+S+ +V+RA+  +    ++ F  + +LV+ ++ +I AE   +L   +R  AM T   L+ + P +       V++ C+ ++  L P+       KE   +D      L  +T++ L +L+ ++L+   +      + + +     S   H R RAL    +LL  + + +    +   P + +G L G   PR AD     RQ  +DCV     +QL  E   RD   D +  ++ ++K+ L   D  ILF   + + ++I KR+ P ++  LL ++FE L D +KN + A  VM N L + R   L E+V  I++ L    S L++     VL A +    +L++Q+    +++ +   LPLD     +   +A +  +  + L  L+E  SR +PF+E     L +   +  ++  +  +C ++       +++ +   + G   L ++Y +LF  +++  S ++   LP   ++ E++    A     + P +   +TL++ L  + S ++++ ++++ GW+ L            LAR++  +    +  ++  L+   +S YE  R+  T F  + ++    AN   L+D ++  L +R  D C  VRRL L G+ N+       V+ H   LL+A++ G+DD  +    +   AM GLA L+  +   D+R  L+ V +R+   ++ +    R ++ RLFG L ++  G   + FL ++   + PLL+HL+DP   V  AC+ AL+   P              +L   +L+   +  L+E   LHFGEF N   K       D +  ++   L YFKS +  + A++ L  G L+ + + ++   +   Q+   L  LLK    +VR R AEA+  L
Sbjct:    9 LASTLLDAITDKDPLVQEQVCSALCSLGEARPVETLRACEEYLRQHD--KLAHPYRAAVLRAMERVLSSRASELDK--DTASTIILLASSEMTKTKDLVWDWQQAASGVLVAVGRQFISKVMEELLRRLHPGTLPHCAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDTVRVAFCSALQRFSEGALEYLANLDRAPDPTVRKDAFATDIFSAYDVLFHQWLQSREAKLRLAVVEALGPMSHLLPSERLEEQLPKLLPGILALYKKHAETFYLSKSLGQILEAA--------------------------VSVGSRTLETQLDALLAALHSQICVPVESSSPLV-------MSNQKEVLRCFTVLACSSPDRLLAFLLPRLDTSNERTRVGTLQVVRHVINSAAAQMEDKKPFILS------------SMRLPLLDTNSKVKRAVVQVISAMAHHGYLEQPGGEAMIEYIVQQCALPPEQE--PEKPGPGSKDPKADSV------RAISVRTLYLVSTTVDRMSHVLWPYLLQFLTPVRFTGALTPLCRSLVHL------------AQKRQEAGADAF----LIQYDAHASLPSPYAVTGRLLVVSSSPYLGDGRGAAALRLLSVLHPNIHPLLGQHWETTVPLLLGYLDEHTEETLPQE--------EWEEKLLMFLRDTLAIISDNAWICQLSLELCRQLPCYDEAPQEKNFLYKCIGTTLGAASSKEVVRKHLQELLETARYQEEAEREGLACCFGICAISHLEDTLAQLEDFVRSEVFRKSIGILNIFKDR----SENEVEKVKSALILCYGHVAARAPRELVLAKVESDILRNICQHFSTKVLGIKVE-TKDPALKLCLVQSVCMVSRAICSSTQAGSFHFTRKAELVAQMMEFIRAEPPDSLRTPIRKKAMLTCTYLVSVEPALDEQARADVIHGCLHSIMALLPE------PKE---EDGGCQKSLYLETLHALEDLLTSLLQRNMTPQGLQIMIEHLSPWIKSPRGHERARALGLSALLLRYFLEHLR--VSALVPFHNLGLLIGLFSPRCADLWPATRQEAVDCVYSLLYLQLGYEGFSRDYRDDVAERLL-SLKDGLVHPDPAILFHTCHSVGQIIAKRLPPDQLISLLLTMFEALGDPEKNCSRAATVMINCLLQERGGVLQEKVPEIVSVLR---SKLQEAQGEHVLPAAQHSVYLLATQHCAAVVSSLLGSPLPLDSHTCMLWRALAVEPRLAAQVLGLLLEKMSRDVPFKESRAFLLGRTPDRVATLLPLSATCALF-------EVMSTP--AAGPAVL-ELYPQLFVVLLLRVSCTVGVQLPRNLQAQERRGASPALATRNLEPCSSAVDTLRSMLLRSGSEDVVQRMDLEGGWELLRTSAGHEEGATRLARAMAEHAGPRLPLVLKTLACTHSSAYENQRVTTTAFL-AELLNSNVANDLMLLDSLLESLAARQKDTCASVRRLVLRGLANLASGCPDKVRTHGPQLLTAMIGGLDDGDNPHSPVALEAMLGLARLVHLVESWDLRSGLLHVAIRIRPFFDSEKMEFRTASIRLFGHLNKVCHGDCEDVFLDQVVGGLAPLLLHLQDPQATVASACRFALRMCGP--------------NLACEELSAAFQKHLQEGRALHFGEFLNTTCKHLMHHFPDLLGRLLTTCLFYFKSSWENVRAAAPLFTGFLVLHSEPRQQPQVDLDQLIAALQILLKDPAPEVRTRAAEALGRL 1637          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Human
Match: MROH1 (maestro heat like repeat family member 1 [Source:HGNC Symbol;Acc:HGNC:26958])

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 480/1755 (27.35%), Postives = 858/1755 (48.89%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI---------KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALK----ILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEERED--LSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNC-LPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLL 5332
            LA  L++ + D++   +E +  +L SLG   P   L     +L +    K++  +R ++L +M  +L  +  ++    D  S II     E+T +K+++ +WQ  A+ VLV +   +   +M  L+ +L P  LPH  V+H L +++V N + +V +L  +++ +L +L +AK D  R    ++  +F E  LEY+AN DRAPDP V   +F+  IFSA++V F  WL ++E+KLR AV++A+G M  ++     E  LPKL+ GI+  YKKH E+++++K+L Q+L++A                          +   S   E +    +  L  Q C+   +   L        + NQ EV RCFT +    PD+L++  L RL+   E+ ++  L ++RH+I+S   Q+  K+  I+S            S        ++ VK  +   I AM    YL + GG  +IE+IV+QCAL  + E   +K      D   + V      R +    L L S+T+  M  VLWPYL++ L PV  T A+  +C S+ +L             + + E+  ++     +I YD H ++P P  +  RL+V++  P   + RG   L+ + +L  N H  L   W+  +P L+ YL++     L  +        +WEE LL  +  ++  I+D  W  +    + +Q+  YD+ P+E+ FL+KC+GT L  ++ K  + K L  +  + R+ E  ER G A  FG+CA +HL+  LA+LE +  +E  +++ G+  +FKD+      + +E +++++IL  G+    A  ELV +++ES+++         KVL   ++  KD  +   +V+S+ +V+RA+  +    ++ F  + +LV+ ++ +I AE   +L   +R  AM T   L+ + P +       V++ C+ ++  L P+       KE   +D      L  +T++ L +L+ ++L+   +      + + +     S   H R RAL    +LL  + + +    +   P + +G L G   PR AD     RQ  +DCV     +QL  E   RD   D +  ++ ++K+ L   D  ILF   + + ++I KR+ P ++  LL ++FE L D +KN + A  VM N L + R   L E+V  I++ L    S L++     VL A +    +L++Q+    +++ +   LPLD     +   +A +  +  + L  L+E  SR +PF+E     L +   +  ++  +  +C ++       +++ +   + G   L ++Y +LF  +++  S ++   LP   ++ E++    A     + P +   +TL++ L  + S ++++ ++++ GW+ L            LAR++  +    +  ++  L+   +S YE  R+  T F  + ++    AN   L+D ++  L +R  D C  VRRL L G+ N+       V+ H   LL+A++ G+DD  +    +   AM GLA L+  +   D+R  L+ V +R+   ++ +    R ++ RLFG L ++  G   + FL ++   + PLL+HL+DP   V  AC+ AL+   P              +L   +L+   +  L+E   LHFGEF N   K       D +  ++   L YFKS +  + A++ L  G L+ + + ++   +   Q+   L  LLK    +VR R AEA+  L
Sbjct:    9 LASTLLDAITDKDPLVQEQVCSALCSLGEARPVETLRACEEYLRQHD--KLAHPYRAAVLRAMERVLSSRASELDK--DTASTIILLASSEMTKTKDLVWDWQQAASGVLVAVGRQFISKVMEELLRRLHPGTLPHCAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDTVRVAFCSALQRFSEGALEYLANLDRAPDPTVRKDAFATDIFSAYDVLFHQWLQSREAKLRLAVVEALGPMSHLLPSERLEEQLPKLLPGILALYKKHAETFYLSKSLGQILEAA--------------------------VSVGSRTLETQLDALLAALHSQICVPVESSSPLV-------MSNQKEVLRCFTVLACSSPDRLLAFLLPRLDTSNERTRVGTLQVVRHVINSAAAQMEDKKPFILS------------SMRLPLLDTNSKVKRAVVQVISAMAHHGYLEQPGGEAMIEYIVQQCALPPEQE--PEKPGPGSKDPKADSV------RAISVRTLYLVSTTVDRMSHVLWPYLLQFLTPVRFTGALTPLCRSLVHL------------AQKRQEAGADAF----LIQYDAHASLPSPYAVTGRLLVVSSSPYLGDGRGAAALRLLSVLHPNIHPLLGQHWETTVPLLLGYLDEHTEETLPQE--------EWEEKLLMFLRDTLAIISDNAWICQLSLELCRQLPCYDEAPQEKNFLYKCIGTTLGAASSKEVVRKHLQELLETARYQEEAEREGLACCFGICAISHLEDTLAQLEDFVRSEVFRKSIGILNIFKDR----SENEVEKVKSALILCYGHVAARAPRELVLAKVESDILRNICQHFSTKVLGIKVE-TKDPALKLCLVQSVCMVSRAICSSTQAGSFHFTRKAELVAQMMEFIRAEPPDSLRTPIRKKAMLTCTYLVSVEPALDEQARADVIHGCLHSIMALLPE------PKE---EDGGCQKSLYLETLHALEDLLTSLLQRNMTPQGLQIMIEHLSPWIKSPRGHERARALGLSALLLRYFLEHLR--VSALVPFHNLGLLIGLFSPRCADLWPATRQEAVDCVYSLLYLQLGYEGFSRDYRDDVAERLL-SLKDGLVHPDPAILFHTCHSVGQIIAKRLPPDQLISLLLTMFEALGDPEKNCSRAATVMINCLLQERGGVLQEKVPEIVSVLR---SKLQEAQGEHVLPAAQHSVYLLATQHCAAVVSSLLGSPLPLDSHTCMLWRALAVEPRLAAQVLGLLLEKMSRDVPFKESRAFLLGRTPDRVATLLPLSATCALF-------EVMSTP--AAGPAVL-ELYPQLFVVLLLRVSCTVGVQLPRNLQAQERRGASPALATRNLEPCSSAVDTLRSMLLRSGSEDVVQRMDLEGGWELLRTSAGHEEGATRLARAMAEHAGPRLPLVLKTLACTHSSAYENQRVTTTAFL-AELLNSNVANDLMLLDSLLESLAARQKDTCASVRRLVLRGLANLASGCPDKVRTHGPQLLTAMIGGLDDGDNPHSPVALEAMLGLARLVHLVESWDLRSGLLHVAIRIRPFFDSEKMEFRTASIRLFGHLNKVCHGDCEDVFLDQVVGGLAPLLLHLQDPQATVASACRFALRMCGP--------------NLACEELSAAFQKHLQEGRALHFGEFLNTTCKHLMHHFPDLLGRLLTTCLFYFKSSWENVRAAAPLFTGFLVLHSEPRQQPQVDLDQLIAALQILLKDPAPEVRTRAAEALGRL 1637          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Human
Match: MROH2A (maestro heat like repeat family member 2A [Source:HGNC Symbol;Acc:HGNC:27936])

HSP 1 Score: 277.33 bits (708), Expect = 1.868e-74
Identity = 344/1616 (21.29%), Postives = 697/1616 (43.13%), Query Frame = 2
Query:  305 LSMNNILKQKVYDIHN-FNDLISK---IIKQVIDELTS--SKEI--LPEWQSK-----ANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMV-FIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLE-GPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCA--NEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI-KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMG-RDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFE--GLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISL-LKDNP--RMGVLRALKILSSQYLIECLNTAMAQTLPLD----EVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVW-LAAMNCLQILCSNKLSCGHICLTKM--YSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAIGIRPIT-------ICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFS-NSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSN-SNSLYTNKLNDFIET 5029
            L +  I  Q+  +I+N   D+I +   + +Q +  L +  SKE+  +PE +       A+D LV +S ++  L+M  L   L+P  L   FVI  L  +A  N ++ + Y+   +  + T+L LA     R  I ++   FCE +  Y+ + + +  P +T   F+  +F  +  F T WL     +++  V+ ++  M+  ++  ++    +   I  ++ +Y+   E   VT+ L Q+L+ +           T +   P      +  E                L +Q C  A A    +SQ       N  E+  CF  +   YP +L+     ++E   E  ++  L ++R I+S+ + ++        S    Y    +  ++ S T    + V+M + H I  +    Y   + G  L +++  Q  LST  +  N++ KF   D      +    +  +  + +K+ +S+++ M +  W  L+  ++  +  +A+  IC S+ NL                 E      D++  +      V++P PQ L++RL+VL   P     RGI +L  ++ L  +   ++  +W++ I  L+ YLE+             +D   WE+ L++ +  S++      W++   + +  QI+ +D    E+GFL++ LG  LA   + + ++  L  + + T +S + +  G  + FGLCA   + TVL  L  +     E++++  +    KD  HP      E +++++++       Y  P+L+ + ++S +  K++ + +   +D  +    ++S+  V +A+N  K   ++ F  +  L S +++ I+AE +  L + +R +AM  + +L  L P  +  E   +++I I +V +L           ++P +D  +   L    +++L +L++++L+         E+ +++    +SE E  RE+A+S +++ L   Y     V  + K L   GT+ G + P   D +   R  +++ ++    +          P     L      K  L+  D   +F A + I K++C   +  ++  L+Q L E  G  + Q + AS   + F    + R  +L ++VA IL+ +  ++ L + D+P  R  ++  + +L+  +    L + + Q LP++    EVW  +  N+     +L   +  L    S  I    + D                   +W LAA++ L  LC+      H+ + K+    KL   +     + +  L  + +       L+    +   P+        +  ++++      +S  +   ++ Q  WD L++   F+  ++LLAR +C+  +      +  L L   +S     RI  T     +   +    L     +++     +  D+ L V  LSL  +GN+   +   V+++   LL   L  +  R+   + +    M+ L  ++ +L E D+      +  +    ++ +S  +R  AF LFG LAR+      + F  E+    +PL++H +DP +   +AC   + Q +  +    +   S  S++   +K+  F  T
Sbjct:   88 LQVPEISTQRKVNIYNILQDIIQQEGELEEQCVQRLVAIASKEMREIPEMEGYMKAEVASDTLVALSRNHFSLVMYELQHHLKPLNLTDEFVIITLAKLANGNVFEFMPYMGITLATIFTMLRLANEAKIRQAICSAMETFCETVQFYLKHLEESVYPVMTEEEFALKVFPMYRYFVTVWLRHYNPEVKLGVIKSLKPMLGLLLPNDDLREQVYDYIPLLLAEYQGSLEVLFVTQVLRQILELSV----------TTNTPVPQMQLHTIFTE----------------LHVQVCNKAPAQHQYSSQ-------NLMEMVHCFVALARSYPKELMKFFFSQMETNKEAVRVGTLNLIRAIVSADEPRM--------SIRAIYLAIRVVKNTISDT---RSKVRMAILHIIGQLALCGYQERIKGWGL-KYLSVQLTLST-YKLTNRREKFYQRD------LEERMVHKVTMDTVKIITSSVSGMTTEFWVRLLCYIMETDYVEALTPICISLTNL----------------AEHQLHGQDVDVSVAGKSRQVDLPAPQKLLARLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWELEIALLVRYLEEHTEFT--------WDQKAWEDKLIQFLRNSLKKTRGSSWSLRLSKELNNQIASFDSPSLEKGFLYRALGFTLATGLEASKVEVLLLELLYKTDYSNDFDSEGVIMCFGLCARGQVKTVLNVLHDFEERIQESEQSWQISAWRKD--HPWRR---ETVKSALMVMYSCVASYCHPQLLLNLVDSPITAKIIHHYVSSCQDICLKMAFMKSVVQVTKAINNIKDLEDFHFAQKTTLTSIIVAVIKAEPTDNLVSPVRALAMEALSHLSKLKPFYSTEENSELMDISIHSVISL-----------QLPGEDNESIKTLYANALSSLEQLMESLLQRQLDPKGLQEMVQLLEKWILSEKEWEREKAVS-LHLYLMWIYVHSTAVCIHLK-LGQFGTMVGLIAPCTCDAHQRTRMASMNVLSSLLDLHASQTCSLWGPSKQKELE---KCKGDLQSTDVEKIFCASSRIAKVVCMEFSCDEVVSLIQKLCENTGAMNLQHDKASVTWIAF--FLQMRAKELEDKVAEILSAI--LVHLPVVDHPEVRRLLIDGILLLAHHHQETILTSLLRQPLPMESHLAEVWLAVSENVPFARTMLHSLMGRLQSRLSPRISATSKAD-------------------IWRLAAVDPLMTLCTI-----HLLIQKLDENDKLPDFLPDLIYTLLLQLGSSHRPEAAPPVLKMWKLVHTTPLPEEMNLQRVTIKSMQLLFKRVKSQHLAHTLDEQAVWDLLQDGGTFLEGVSLLAR-LCMQHVEGHRQRLAELVLRGMDSEVLSCRISSTAVCFMSGPVLYQEKLLKPAALLLEKGADQEEDEALRV--LSLRALGNMALGAPKKVKQYRKVLLEKCLGPL--REPVSNSVTAEGMEALTKILAELREGDVGSSFDAMSEQCRIFFDNESELLRLKAFILFGKLARVVGMSKKHFFKGEVKKAWIPLMLHSQDPCSNAAQACMATMFQCVHFWGWKSLEHPSGPSDTATDDKMTVFQTT 1573          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Human
Match: MROH2A (maestro heat like repeat family member 2A [Source:HGNC Symbol;Acc:HGNC:27936])

HSP 1 Score: 263.848 bits (673), Expect = 2.916e-70
Identity = 344/1632 (21.08%), Postives = 698/1632 (42.77%), Query Frame = 2
Query:  305 LSMNNILKQKVYDIHN-FNDLISK---IIKQVIDELTS--SKEI--LPEWQSK-----ANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMV-FIIERNNFEPILPKLITGIILQY--KKHTESY-HVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLE-GPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCA--NEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI-KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMG-RDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFE--GLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISL-LKDNP--RMGVLRALKILSSQYLIECLNTAMAQTLPLD----EVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVW-LAAMNCLQILCSNKLSCGHICLTKM--YSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAIGIRPIT------------ICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFS-NSNYEQHRILVTG--------FYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSN-SNSLYTNKLNDFIET 5029
            L +  I  Q+  +I+N   D+I +   + +Q +  L +  SKE+  +PE +       A+D LV +S ++  L+M  L   L+P  L   FVI  L  +A  N ++ + Y+   +  + T+L LA     R  I ++   FCE +  Y+ + + +  P +T   F+  +F  +  F T WL     +++  V+ ++  M+  ++  ++    +   I  ++ +Y  K H   + +  + L Q+L+ +           T +   P      +  E                L +Q C  A A    +SQ       N  E+  CF  +   YP +L+     ++E   E  ++  L ++R I+S+ + ++        S    Y    +  ++ S T    + V+M + H I  +    Y   + G  L +++  Q  LST  +  N++ KF   D      +    +  +  + +K+ +S+++ M +  W  L+  ++  +  +A+  IC S+ NL                 E      D++  +      V++P PQ L++RL+VL   P     RGI +L  ++ L  +   ++  +W++ I  L+ YLE+             +D   WE+ L++ +  S++      W++   + +  QI+ +D    E+GFL++ LG  LA   + + ++  L  + + T +S + +  G  + FGLCA   + TVL  L  +     E++++  +    KD  HP      E +++++++       Y  P+L+ + ++S +  K++ + +   +D  +    ++S+  V +A+N  K   ++ F  +  L S +++ I+AE +  L + +R +AM  + +L  L P  +  E   +++I I +V +L           ++P +D  +   L    +++L +L++++L+         E+ +++    +SE E  RE+A+S +++ L   Y     V  + K L   GT+ G + P   D +   R  +++ ++    +          P     L      K  L+  D   +F A + I K++C   +  ++  L+Q L E  G  + Q + AS   + F    + R  +L ++VA IL+ +  ++ L + D+P  R  ++  + +L+  +    L + + Q LP++    EVW  +  N+     +L   +  L    S  I    + D                   +W LAA++ L  LC+      H+ + K+    KL   +     + +  L  + +       L+    +   P+             +  ++++      +S  +   ++ Q  WD L++   F+  ++LLAR +C+  +      +  L L   +S     RI  T         F    +  +    L     +++     +  D+ L V  LSL  +GN+   +   V+++   LL   L  +  R+   + +    M+ L  ++ +L E D+      +  +    ++ +S  +R  AF LFG LAR+      + F  E+    +PL++H +DP +   +AC   + Q +  +    +   S  S++   +K+  F  T
Sbjct:   88 LQVPEISTQRKVNIYNILQDIIQQEGELEEQCVQRLVAIASKEMREIPEMEGYMKAEVASDTLVALSRNHFSLVMYELQHHLKPLNLTDEFVIITLAKLANGNVFEFMPYMGITLATIFTMLRLANEAKIRQAICSAMETFCETVQFYLKHLEESVYPVMTEEEFALKVFPMYRYFVTVWLRHYNPEVKLGVIKSLKPMLGLLLPNDDLREQVYDYIPLLLAEYQGKGHLPPFANPLQVLRQILELSV----------TTNTPVPQMQLHTIFTE----------------LHVQVCNKAPAQHQYSSQ-------NLMEMVHCFVALARSYPKELMKFFFSQMETNKEAVRVGTLNLIRAIVSADEPRM--------SIRAIYLAIRVVKNTISDT---RSKVRMAILHIIGQLALCGYQERIKGWGL-KYLSVQLTLST-YKLTNRREKFYQRD------LEERMVHKVTMDTVKIITSSVSGMTTEFWVRLLCYIMETDYVEALTPICISLTNL----------------AEHQLHGQDVDVSVAGKSRQVDLPAPQKLLARLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWELEIALLVRYLEEHTEFT--------WDQKAWEDKLIQFLRNSLKKTRGSSWSLRLSKELNNQIASFDSPSLEKGFLYRALGFTLATGLEASKVEVLLLELLYKTDYSNDFDSEGVIMCFGLCARGQVKTVLNVLHDFEERIQESEQSWQISAWRKD--HPWRR---ETVKSALMVMYSCVASYCHPQLLLNLVDSPITAKIIHHYVSSCQDICLKMAFMKSVVQVTKAINNIKDLEDFHFAQKTTLTSIIVAVIKAEPTDNLVSPVRALAMEALSHLSKLKPFYSTEENSELMDISIHSVISL-----------QLPGEDNESIKTLYANALSSLEQLMESLLQRQLDPKGLQEMVQLLEKWILSEKEWEREKAVS-LHLYLMWIYVHSTAVCIHLK-LGQFGTMVGLIAPCTCDAHQRTRMASMNVLSSLLDLHASQTCSLWGPSKQKELE---KCKGDLQSTDVEKIFCASSRIAKVVCMEFSCDEVVSLIQKLCENTGAMNLQHDKASVTWIAF--FLQMRAKELEDKVAEILSAI--LVHLPVVDHPEVRRLLIDGILLLAHHHQETILTSLLRQPLPMESHLAEVWLAVSENVPFARTMLHSLMGRLQSRLSPRISATSKAD-------------------IWRLAAVDPLMTLCTI-----HLLIQKLDENDKLPDFLPDLIYTLLLQLGSSHRPEAAPPVLKMWKLVHTTPLPEEMNLQRCSRGRVTIKSMQLLFKRVKSQHLAHTLDEQAVWDLLQDGGTFLEGVSLLAR-LCMQHVEGHRQRLAELVLRGMDSEVLSCRISSTAVCVEMRHRFMSGPV--LYQEKLLKPAALLLEKGADQEEDEALRV--LSLRALGNMALGAPKKVKQYRKVLLEKCLGPL--REPVSNSVTAEGMEALTKILAELREGDVGSSFDAMSEQCRIFFDNESELLRLKAFILFGKLARVVGMSKKHFFKGEVKKAWIPLMLHSQDPCSNAAQACMATMFQCVHFWGWKSLEHPSGPSDTATDDKMTVFQTT 1587          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Celegans
Match: hpo-27 (pep chromosome:WBcel235:I:5906662:5918229:1 gene:WBGene00016418.1 transcript:C34G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-27)

HSP 1 Score: 411.764 bits (1057), Expect = 1.766e-117
Identity = 417/1856 (22.47%), Postives = 808/1856 (43.53%), Query Frame = 2
Query:  152 YDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVI--------DELTSSKEILPEWQSKANDVLVTMS--THYCHLIMPPLVDKLQP--SVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILE------------YVANPDRAPDPNVTI---------VSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKK-HTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEG-PEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIV------LAGVPTHCNYRGIYILKAMQILVHNFHENLPSIW-DIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIEL--LRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNK-DKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICI---------------------------------------DNVFNLP----------PDGIPL-KKSKEI--PFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVN-NNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERL-----KKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEE----VASILTKLHDIISLLKDNPR-MGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTI--PFEEREDLSQKKGKCNSVKHIQY---------SCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSR----LGDKCLEVRRLSLIGIGNVGQCSDV-LVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNE-KVRARTAEAISLLHMY 5341
            Y   E  +  + +SL ++G  +P ++L+    +L ++   K+    R  +L        Q +    +  +++SK+ +Q+I         E+  +K+   EW   + +VLVT++  T +   ++  ++ K  P  +  PH +++  +  +AV+NP+ +V +L+ I+++ + LL   KTD  R   A +   FCEA+ E            Y+ +  R   PN             ++S    + ++V F+ W+ +K+ K R    + +G +  +I++      + K++T +I  Y+K + ES+ +T+ + + L++A                         + E   L   +E+I+N LF     CLD        S Q   +I+N +E  RCF      + D+++   L +++   + QK+ A+ +LRH++++  + +  KRS +   L+      L  + N+++ +V    K  +    +A+   +Y+   GG  +I F+VR     T+ E   KK++ +        V    QLR  C   L   ++T      +LWPYL+E +     T  VG +C  +  L S       E+E   +         ++ +  +D +  + G   + +RL        L G+ T        +++A+    H   E   + W + + P L       ++ +          I +W E  L  ++  +  + + DW  +   AMG+Q+ +Y +L  E+ FL +CLG  LA  T K F+   + L+F S  HS   ER G A G G  A +H+D +L +LE     E A++++G+FG  KD +      +IE+  LRA+++L  G+ +     + +  RL++ +I  L+N    +K + V+   M+E++ L+A AV+ +++   +KFE RN+L++    Y+  E+   L + LR +A +T   L+ L PP++  +++ +  +                                          N++  P          P+G P+ ++ + I    +D  + T+ MD TM+     ++ I++   +  T   + K++   +  + +H R RA+    ++L  YY+   +++  +      + +L G L PRL D   + R   +  +    ++   +  G   + D SL       E+       K +      A+  I ++I  R+   ++   L ++FE L D Q + +SA   +       R + LN E    V  ++ KL DI   ++ N   +  L A  +   Q + + L     Q LP     T+    ++ D+ +    L HL E+   ++  PFE  +       K  +V+   Y         +     A M  L ++ +  +   H   +   ++       G  + +   P   ++ EK +G+                 +KN L  T+S+ +IE++N    W    ++D F+  + +  RS+   + + +  +   +  ++NS  E  R L      +++I  +++      + ++   + R    L D  L +R+L + G+G + +CS   ++ R     + A + G+DD  D  D +   ++  L  L+       ++ IL  V L++  C+E+DS  +RA++F LFG L     G +   F   +++ IV LL+HL D   EV + C  ++ ++  L +      S N++     +L D  +          +  F  DF+ I A    D++N   + +  YFKS    +  ++  L GCL++ L      ++ +  +   L+ LLK   +  VR     AI+ LH +
Sbjct:   24 YQHQESVKNEVAESLKTIGSHQPNVLLTACHQYLLQNP--KLGAFKRAFVL--------QTISICVDNCEVVSKLDEQIIMLIINLATQEMNMTKDTDVEWAESSMEVLVTLAKNTRFVSHVIDAILQKFPPGQTTSPHRYIVLTMATIAVHNPFGLVPFLTDILSRTVPLLQHVKTDPLRCAWARAICSFCEAVRECETERPKEASEEYIGDHSR---PNSASGHCQEVSNRATYSDQTEAVYDVIFS-WIYSKDPKTRGEAAECVGELCLMIKQTRLVEDVKKIVTNMIPLYRKSYNESHMITQGICRFLEAAC------------------------VDETCPLEPYLEDILNALFPN--ACLDPDDTTVTLSTQ---AIKNHSEAFRCFDVAATRFADRIVYYLLHKMQNVADSQKLGAINVLRHLLNATGQHMEDKRSLLTMGLKK-----LLAAENTTSIRV----KRAIVQLCVALADHSYVDAEGGDYVIAFLVRNLVGPTEQESAAKKVEVD--------VAGLNQLRTQCAQALYTIANTCVCATKLLWPYLLEFICCERYTPVVGDLCKCLRTLVSR------EVEAGRK---------MDYVTGFD-NPKVAGRHAVFARLFTSFCNAPLNGLLTRRAREAGGLIQAVAPWFHPSMEGPAARWSEKLEPLLDELSTTVSSGDSAPAELRGRKIARWHEACLDWLSACVAVVPEGDWRQDLAAAMGKQLDMYKELSDEKSFLLRCLGVTLARITAKQFVIDHMMLMFKSASHSVLTERQGCARGVGSIATSHMDLILIELENVSKWEHARKSSGIFGFIKDTMPIRQYPDIEMIHLRATLMLCYGHVVMACSLDTITQRLQNTIIVFLRNYFANSKQETVVREAMLETMRLIATAVHPSRIGGEWKFEARNELLAYAKDYLNGETPEWLTSSLRLLACKTTAALVQLEPPLSPADIEDIGTVLTRQILPMQREKSGLKTLAFDIFDYASSSVFSTFSGSSSSHTNIYMTPPLTANSVAEGPNGTPIHQRHRGIGGKMEDDESATI-MDATMHQYGLALEQIVRMAPTTQTIMILLKILLPYYGKQADHERIRAVDMTVLVLRVYYECAEDISLGHASDFEPLSSLLGRLAPRLIDLLAHVRLQALSAIHWTLRLAY-MHKGHGRDADQSLFSYSGFVEKYLTSGDVKLEGQKEKLAIEAIAQIIEYRLPQSQMQIYLSAIFEMLTDRQSHVSSAAAQLLTYAVMARGATLNAEAEILVTKMVEKLADIHHCVQTNTDVLAALVAFAVHQQQAVCDVL---FKQPLPYSINITDAWECLSRDKLLFAVILDHLTELLGASLDQPFELMDSGGGVSAKVVNVEPCTYVAVLAEVVKNGEPESALMERLPLILTLLI---HFICSVSDTQFPVMQKEGSKNPLIITPDLRRAAEKPAGM-------------AVAAIKNLLNRTRSNMVIEDMNQARAWTDCLDKDSFIQAITVFIRSLVEQRPAWVSPLAKTMEEYANSESEPRR-LAAVIIAASLIRRSTSENGEFNEQLLVKCIRRLEDSLTDPSLRIRKLCVKGLGELSECSSTDVISRFVHMAVEAAMSGLDDHGDRKDTVAIESIMALNKLVQLTNNDQLKSILPLVLLKIRPCFEKDSHTLRAASFSLFGELGS-RVGENSEEFRGHLHTNIVSLLLHLNDDFEEVRQNCANSIYRLHGLLT------SPNASICIERELKDGKQPA-------SYNLFIKDFASILANSFPDRINQYALATSNYFKSSSARIRCNAAHLTGCLLDGLTAPLRATISRELVFTGLVALLKDSEDVNVRISATRAIANLHDF 1767          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Fly
Match: c11.1 (gene:FBgn0040236 transcript:FBtr0343368)

HSP 1 Score: 211.46 bits (537), Expect = 1.933e-54
Identity = 348/1679 (20.73%), Postives = 685/1679 (40.80%), Query Frame = 2
Query:  593 YLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTIC--MPYPDQLISNCLRRLEG-PEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLS--HTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIE---------TENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHIN--DEDWTVEFGEAMGQQISLYD-KLP----------KERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTR---------HSENDERM-GFAVGFGLCAAAHLDTVLAKL-ELYCANEAKRTTGLFG---LFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESN--VIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSY-IEAESSTTLYNDLRGIA--MRTIGNLIVLHPPITN--LELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVL-MDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSS---LNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDN---------PRM--GVLRALKILSSQYLIECLNTAMAQTLPLD----EVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCS--NKLSCGHI--CLTKMYSKLFTXXXXXXXXXXNCL-----------PFTGKSNEKKSGLEANLA-IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLA-RSICINKLSEIGN-----IITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLIN---AAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLAR-----LATGP--SYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDI--TLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAIS 5326
            ++  I+++    L   + D+ +   A +  +F EA+LE     +          + S  I  A++V F  WL+++E K+   +L A+ +M  ++ ++  +    +L+  I+  Y++  +   VT+ L  VL++                               +L      +  ++ + +    D   +      ++  +++   EV RCF  +    PY  +++   L  L    E++++ +LLIL H+++SC   + ++    I CL+                     +KM+L+   TI+A+  K+++ +    + + F+VR               +F+     H     +A L   CEN L + +ST+ ++  +L   L+  L+ ++ TD  G +   + +LF+      P IE         TE     +  ++  +  +     V +PG + + +R + L G    C  R   IL  ++      +  L  +W+  IP L+L + + +                + +LL   V ++ E +   DE++       +  Q+ LY  +LP           ERG L + +   L   T    I  ++DLI  + R         H++ ++R+   A   G  +  HL  ++ KL EL      K +TG F      KD     ++    LL   ++ A G  +  A P      L+ +  ++  L   +  +KD+ I   +++++  +   +   K +       R  ++ ++ +  IEA      ++DL  +   ++   + I +  P T   ++   +  I   N F           S+E   D+ ++F    +++++  LN L++ I++   S  T   I  ++       +  +R  A       L+ Y   +          N  G + G ++PR  D N   RQ++++ +    +I    E       DS+   L  I TIKE +   +   ++    DI K+I  RI+  +     ++L   L+D +++      V+     + + S+L           H I  L++D+         PR   GVL+AL  L+  +        ++Q LP D    E W  ++CN  +   +     + L+   S            Q+ G+  S+   Q      LA+     I C+    L C  I   L   ++ +F  ++   SS  N             P   +S + K G   N   I + P  I  ET + FLT  +  +I   + V     +L +  ++ +++ LL   +I + +  ++G+     ++ +LS +  S Y+  R+   G + S ++ +          ++     + L D    VR LS+ G+G VGQ  +   +R++ + + ALL G+DD     D LIN    +M GL+ ++  L  + +    V++ +R+       +  +R +A +LFG +        ++ P  S      ++ + + PLL+HL +    +  AC+  L+++  L              L   ++ +  E  L E+    L++  F  +F K  A++++D + D I   L   +S +PE+  S+ ++IG L   L E+   ++Q   +  ++  LLK +   VR R A A+ 
Sbjct:  209 HIKAILSRSQPHLVGIRQDHIKQAHAYAIGRFSEALLEESGKKEEE--------NCSTEISVAYDVLFNQWLHSREPKVCVEILQALSSMYPLLPKDRIQDQAARLVPQILALYRRSVDRNAVTQFLCSVLKT-------------------------------NLALNATVLDGIIDVLVTHLFDLVCV--YPDYEKPQTVKGHYEVLRCFHLLAGHQPYSTRIMDTLLIHLRNNSERERMKSLLILTHLLNSCAGNIENRIPATIECLKQL-------------ILSERGIKMKLTLLKTIVALAQKSHIRDK---EFVWFVVRHSC------------RFSKPSQEHGSQEEHANLVLSCENTLYMLASTVGTLDELLKRELLNYLILLDYTDICGNLAKCLASLFAKS----PHIEYDIAGDDAATEQATPESMGAAGEDRSVIKRGKVMVPGAETIYARCLALLG-NQQCIKRCSNILSFLRYYHPQVNPALEELWERKIPDLLLQINRESA---------------YRQLLHDFVLETNEFLGGLDENFAQRLASKLADQMYLYPMQLPHSEWHLPDLSAERGMLLQAVALTLLQVTDVACIHTKIDLIVTTARQERLDKHVKHADYEKRIEPCARALGYISRQHLGHLIKKLTELAQVGGRKHSTGFFSNLHFIKDTHKELENYKSNLL---VVKAFGRIMDEADPLQSIQHLDEDDTLLGFLIQQLAVHKDQTIMSAILQTLLSICNQLIATKEQLPAPLRHRKQIMETVFNIPIEAP-----FHDLPLLPTILKLGTDFIRIGGPDTEECVDGGVIFEIACRNFFGCAQQLKMKFDSQE--EDERNSFLAKHLNESLPQLNALVRAIVELDASPATLDLIIGILEGWTRDRNSEVRICASHVFNNTLDVYIKSMKIGCEAPSKFNQTGQMLGKIVPRCIDSNGTVRQVSVEILQKTLEIACIYETLTIASIDSTADWLKEIETIKEHIITDEPKQIYNLAGDIAKIIALRISSFQYLQFCKTLLHSLRDPEQSSTIGASVVLKFFIQQKGSEL----------FHAIPDLVRDSLLALRVCEVPRAKSGVLKALVALTKHHPKLVCAEMLSQPLPYDPNLVEYW-HLVCNDPELTGLTLDNFLQLLSGASL-----------QEGGQDASLSERQK-----LASGQPFAIFCALHEMLPCKDIKGQLETRFADMFCMLLTSLSSYTNLAAPNPINNASLSPNQTQSGKTKFGFVPNKELIKLNPCQIALETFQAFLTNLEMEQIASVLTVNT---QLASSADWHNYIELLTPMAIGLGQQLQLGSPQMRQLVNSLSKYVASPYDGQRVAAVGIF-SRLVPLKPTGELAASILLHLG--AALSDPNAVVRGLSIQGMGYVGQLGEKEAKRYSETAIGALLKGVDD--PVGDCLINIPLESMRGLSGILRALPSERVEPFHVSLAIRIRPFLGNYALEMREAAIQLFGDICEGKHDDGSSSPTSSMEALREQLIANLFPLLLHLSESEVAIASACRGTLQRVCRL--------------LTAPRVVEMAEQQLGEERGHQLNYSSFVLEFVKTIALELTDHIQDFIDSCLPQLRSQWPEVRGSAAIVIGILHNFLSER---NVQTETVASKIAVLLKDEQALVRMRAATALG 1736          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Fly
Match: c11.1 (gene:FBgn0040236 transcript:FBtr0071326)

HSP 1 Score: 211.46 bits (537), Expect = 1.933e-54
Identity = 348/1679 (20.73%), Postives = 685/1679 (40.80%), Query Frame = 2
Query:  593 YLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTIC--MPYPDQLISNCLRRLEG-PEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLS--HTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIE---------TENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHIN--DEDWTVEFGEAMGQQISLYD-KLP----------KERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTR---------HSENDERM-GFAVGFGLCAAAHLDTVLAKL-ELYCANEAKRTTGLFG---LFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESN--VIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSY-IEAESSTTLYNDLRGIA--MRTIGNLIVLHPPITN--LELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVL-MDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSS---LNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDN---------PRM--GVLRALKILSSQYLIECLNTAMAQTLPLD----EVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCS--NKLSCGHI--CLTKMYSKLFTXXXXXXXXXXNCL-----------PFTGKSNEKKSGLEANLA-IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLA-RSICINKLSEIGN-----IITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLIN---AAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLAR-----LATGP--SYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDI--TLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAIS 5326
            ++  I+++    L   + D+ +   A +  +F EA+LE     +          + S  I  A++V F  WL+++E K+   +L A+ +M  ++ ++  +    +L+  I+  Y++  +   VT+ L  VL++                               +L      +  ++ + +    D   +      ++  +++   EV RCF  +    PY  +++   L  L    E++++ +LLIL H+++SC   + ++    I CL+                     +KM+L+   TI+A+  K+++ +    + + F+VR               +F+     H     +A L   CEN L + +ST+ ++  +L   L+  L+ ++ TD  G +   + +LF+      P IE         TE     +  ++  +  +     V +PG + + +R + L G    C  R   IL  ++      +  L  +W+  IP L+L + + +                + +LL   V ++ E +   DE++       +  Q+ LY  +LP           ERG L + +   L   T    I  ++DLI  + R         H++ ++R+   A   G  +  HL  ++ KL EL      K +TG F      KD     ++    LL   ++ A G  +  A P      L+ +  ++  L   +  +KD+ I   +++++  +   +   K +       R  ++ ++ +  IEA      ++DL  +   ++   + I +  P T   ++   +  I   N F           S+E   D+ ++F    +++++  LN L++ I++   S  T   I  ++       +  +R  A       L+ Y   +          N  G + G ++PR  D N   RQ++++ +    +I    E       DS+   L  I TIKE +   +   ++    DI K+I  RI+  +     ++L   L+D +++      V+     + + S+L           H I  L++D+         PR   GVL+AL  L+  +        ++Q LP D    E W  ++CN  +   +     + L+   S            Q+ G+  S+   Q      LA+     I C+    L C  I   L   ++ +F  ++   SS  N             P   +S + K G   N   I + P  I  ET + FLT  +  +I   + V     +L +  ++ +++ LL   +I + +  ++G+     ++ +LS +  S Y+  R+   G + S ++ +          ++     + L D    VR LS+ G+G VGQ  +   +R++ + + ALL G+DD     D LIN    +M GL+ ++  L  + +    V++ +R+       +  +R +A +LFG +        ++ P  S      ++ + + PLL+HL +    +  AC+  L+++  L              L   ++ +  E  L E+    L++  F  +F K  A++++D + D I   L   +S +PE+  S+ ++IG L   L E+   ++Q   +  ++  LLK +   VR R A A+ 
Sbjct:  209 HIKAILSRSQPHLVGIRQDHIKQAHAYAIGRFSEALLEESGKKEEE--------NCSTEISVAYDVLFNQWLHSREPKVCVEILQALSSMYPLLPKDRIQDQAARLVPQILALYRRSVDRNAVTQFLCSVLKT-------------------------------NLALNATVLDGIIDVLVTHLFDLVCV--YPDYEKPQTVKGHYEVLRCFHLLAGHQPYSTRIMDTLLIHLRNNSERERMKSLLILTHLLNSCAGNIENRIPATIECLKQL-------------ILSERGIKMKLTLLKTIVALAQKSHIRDK---EFVWFVVRHSC------------RFSKPSQEHGSQEEHANLVLSCENTLYMLASTVGTLDELLKRELLNYLILLDYTDICGNLAKCLASLFAKS----PHIEYDIAGDDAATEQATPESMGAAGEDRSVIKRGKVMVPGAETIYARCLALLG-NQQCIKRCSNILSFLRYYHPQVNPALEELWERKIPDLLLQINRESA---------------YRQLLHDFVLETNEFLGGLDENFAQRLASKLADQMYLYPMQLPHSEWHLPDLSAERGMLLQAVALTLLQVTDVACIHTKIDLIVTTARQERLDKHVKHADYEKRIEPCARALGYISRQHLGHLIKKLTELAQVGGRKHSTGFFSNLHFIKDTHKELENYKSNLL---VVKAFGRIMDEADPLQSIQHLDEDDTLLGFLIQQLAVHKDQTIMSAILQTLLSICNQLIATKEQLPAPLRHRKQIMETVFNIPIEAP-----FHDLPLLPTILKLGTDFIRIGGPDTEECVDGGVIFEIACRNFFGCAQQLKMKFDSQE--EDERNSFLAKHLNESLPQLNALVRAIVELDASPATLDLIIGILEGWTRDRNSEVRICASHVFNNTLDVYIKSMKIGCEAPSKFNQTGQMLGKIVPRCIDSNGTVRQVSVEILQKTLEIACIYETLTIASIDSTADWLKEIETIKEHIITDEPKQIYNLAGDIAKIIALRISSFQYLQFCKTLLHSLRDPEQSSTIGASVVLKFFIQQKGSEL----------FHAIPDLVRDSLLALRVCEVPRAKSGVLKALVALTKHHPKLVCAEMLSQPLPYDPNLVEYW-HLVCNDPELTGLTLDNFLQLLSGASL-----------QEGGQDASLSERQK-----LASGQPFAIFCALHEMLPCKDIKGQLETRFADMFCMLLTSLSSYTNLAAPNPINNASLSPNQTQSGKTKFGFVPNKELIKLNPCQIALETFQAFLTNLEMEQIASVLTVNT---QLASSADWHNYIELLTPMAIGLGQQLQLGSPQMRQLVNSLSKYVASPYDGQRVAAVGIF-SRLVPLKPTGELAASILLHLG--AALSDPNAVVRGLSIQGMGYVGQLGEKEAKRYSETAIGALLKGVDD--PVGDCLINIPLESMRGLSGILRALPSERVEPFHVSLAIRIRPFLGNYALEMREAAIQLFGDICEGKHDDGSSSPTSSMEALREQLIANLFPLLLHLSESEVAIASACRGTLQRVCRL--------------LTAPRVVEMAEQQLGEERGHQLNYSSFVLEFVKTIALELTDHIQDFIDSCLPQLRSQWPEVRGSAAIVIGILHNFLSER---NVQTETVASKIAVLLKDEQALVRMRAATALG 1736          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Zebrafish
Match: BX088600.1 (maestro heat-like repeat family member 1 [Source:NCBI gene;Acc:794708])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 500/1762 (28.38%), Postives = 916/1762 (51.99%), Query Frame = 2
Query:  101 VKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLH-VNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKY--------NKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLL-KDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKG--KCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEA---NLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLH 5335
            ++ T+++ +   L++   D +   +E +++S+++LG ++P  +LS+   +L   K  K+ +GHRV +L ++  ++K ++ DI      I  +I+   DE+T SKE++P+WQ  A+++LV +   Y + IM  ++ K QP VLPH+FV+  L  ++ +N Y MV +L+ I+  ML +L + K DN +WV +++  +F E+ILEY+AN D+APDP V   +FS  IFSA+++ F +W+ ++E+KLR  V +A+G+M  ++  +  E  LPKL+  I+  YKK+TE Y ++K+L QVL+++                          +   S   E +    +L L  Q C         T       I+N NEV RCF+ +   +PD+L+   L+RLE   E+ ++ +L +LRH+I+S    +  K+  I++ ++    ++            SN VK ++   I AM    YL   GG  L+ FI++ CAL   T +K ++ +         + +TN  LR++C+N L L ++T+  +  VLWP L+  L P +  +A   +C S+  L +N  +           E NF       +ID++    ++P    L+ RL+V A  P      G   L  +  +  N H    ++W+  IPKL+ YLE+S  +          D  +W+E LL+L++K++  I+D  WT +      + +  Y+   +E+ FL++C+G IL     K  + KQL  I  +TRH++  ER G A+G GLCA++HLD  L KLE +  ++A ++ +G+FGL KDK    +  ++E +++++IL  G    +A  + + +R++S++++ +  N            KD  +   ++ S+ L+A+A++ +  K  + F  +++L+  +  +I+AE    +   +R + + T  NLI L PP+T  E   +L  C++ V+ LP    P K   E   D      VL   T N L+EL++ +L    S      ++K I +   S  +H RERA+ T   LL  Y D ++    N    + +G L G L PR  DPN   R+  IDC+     IQL+ E       D S+  +  ++E+L   D ++L+   +++TK+I KR+   ++  LL  LF+GL D+Q N + A  V+ N L + R + L + V  +L  LH+ + ++ ++  ++ + +++ IL++Q+L   +NT +A  LP D    E+   +  D ++  + +  ++E  +  +P+ ++++   + G  K  +   +  +C     A+  + +   +  +  H+ L K++S L   +          LP    SN   S  +A   N  I      +  E L+  L   Q   +++ ++ +  WDK+++  +  + + LL+R++  +    +  I+ +L     + YE  RI VT F+ S ++    A    ++D+++  ++ R+ D C  VR L++ G+GN+   S   V ++A  LL+A+  GM+++ D    +   AM G++ ++  L +K++  ++V + +++    E ++  +R ++  L G+L++  +G     F  +I++V+V LL+HL DP+  V++ACK A++   P+  + QIS      +++ N         L E+  LH+GEF ND +K         +N   +  + +FKS++ E+ AS+ + IG L+ NL ++  + +  G +   L+ LL+  +  VR + AEA+   H
Sbjct:    4 IEDTDIEQVTLALLDAANDRDPVVQEQVRKSILTLGNQKPDKVLSMCQDYL--LKHPKLVVGHRVVVLQTIELVVKSRIDDITYPK--IKSVIQLASDEMTRSKEVVPDWQQAASNILVAVGNKYINDIMEEILSKFQPGVLPHFFVVQTLANLSDSNVYGMVPFLNAIMGTMLPMLGMTKHDNMKWVFSSALCRFSESILEYLANLDKAPDPTVRKDTFSSEIFSAYDILFNSWIQSREAKLRLTVAEALGSMSHLMAHDKLEEQLPKLLPTILGLYKKNTEHYIISKSLCQVLEAS--------------------------VNMGSRVLETQIDGLLLALHQQVCSPVDFSNPPT-------IKNHNEVLRCFSILANTFPDRLMVFVLQRLENSNERNRMGSLAVLRHLINSSTSTMETKKLLILASIRQPLADH------------SNKVKKRVVQVISAMAHHGYLELDGGDLLVRFIIQHCALP-DTYYKGQRPQ-------DPEEVTNEALRSMCDNTLHLFTTTVGRLTDVLWPMLLCYLTPNQYANATTPLCKSLI-LLANKKRA--------TQEPNF-------MIDFNAQGSSLPSQYILLIRLLVNASFPFRYRGHGAPSLSLLNAISPNIHPKAETLWENEIPKLLSYLEESTEDS--------LDKKKWDESLLQLLSKTLATIDDSRWTNQLAVEATRYLPTYNNSLEEKSFLYRCVGVILQQCYNKELVRKQLQEILINTRHNDAVERTGVAMGIGLCASSHLDGTLEKLEEFGKSDAFRKASGIFGLLKDK----NDVDVEKMKSTLILCYGYVALHAPEDQLLTRIDSDILQNISKNFNTKVLGIKVETKDLTMKLSLIHSVGLIAKAISNSVRKQGFMFTRKHELMGVMTDFIKAEPPEVMRTPVRYLVLTTCANLINLDPPLTENENFDLLKTCLNGVYGLPTADTPDKGKDEEALDPQQR-EVLYSDTFNALHELLRNVLARDLSPDGLQAVFKHIESWLSSGQDHERERAVKTTAHLLQFYLDNLSV--KNLVTFHNLGALVGRLAPRCTDPNPEVRRAAIDCIYSLMYIQLRYEGFSLDYKDDSVEALLDVREKLSNPDHSVLYKTCSELTKIISKRLPQQQLSTLLFMLFDGLVDSQSNCSRASSVILNTLLKNRGAGLQDLVPEVLEVLHNRLQVIGEEQVKVAIGQSILILATQHLQTVVNTLVAYPLPYDSWSCEMWMALGADSSLALQIMEMIIEKLNVMVPYVDKKESMLRPGLTKVATSHPLAMTC-----ALREMMLNGQSADAVAHL-LPKLFSALLVRLGSSVGVQ---LPKDLNSNSIISDRKATNKNSVINFDVCGVAVEALRVLLARAQLDAVVKPLDQEGAWDKMKDPQQHTTGVTLLSRAMAKHAGPRLPAIVESLCPSLCNIYECQRITVTAFF-SELLNHHVATELMILDMLMNNMMERITDTCGTVRMLAVRGLGNIAVGSPEKVNKYAKELLAAMSSGMEEKDDPGKLITLEAMSGMSKILLYLDQKNVNLLVVYIFMKIKPFLENENDEIRCASIMLLGNLSKFGSGEPV--FKDQIHNVLVSLLLHLSDPNPHVVKACKYAMRICAPVVGSEQIS------AMFQNH--------LLEEKGLHYGEFINDLTKYLIQDFPGMLNFYHITVVQFFKSNWAEIRASAAMFIGFLLGNLPDEHFSHMNMGSVTKGLVMLLQDPDPLVRVKAAEAMGHFH 1651          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Zebrafish
Match: mroh1 (maestro heat-like repeat family member 1 [Source:ZFIN;Acc:ZDB-GENE-090806-2])

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 499/1754 (28.45%), Postives = 914/1754 (52.11%), Query Frame = 2
Query:  101 VKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLH-VNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLL-KDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKG--KCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEA---NLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLH 5335
            ++ T+++ +   L++   D +   +E +++S+++LG ++P  +LS+   +L   K  K+ +GHRV +L ++  ++K ++ DI      I  +I+   DE+T SKE++P+WQ  A+++LV +   Y + IM  ++ K QP VLPH+FV+  L  ++ +N Y MV +L+ I+  ML +L + K DN +WV +++  +F E+ILEY+AN D+APDP V   +FS  IFSA+++ F +W+ ++E+KLR  V +A+G+M  ++  +  E  LPKL+  I+  YKK+TE Y ++K+L QVL+++                          +   S   E +    +L L  Q C         T       I+N NEV RCF+ +   +PD+L+   L+RLE   E+ ++ +L +LRH+I+S    +  K+  I++ ++    ++            SN VK ++   I AM    YL   GG  L+ FI++ CAL   T +K ++ +         + +TN  LR++C+N L L ++T+  +  VLWP L+  L P +  +A   +C S+  L +N        +     E NF       +ID++    ++P    L+ RL+V A  P      G   L  +  +  + H    ++W+  IPKL+ YLE+S  +          D  +W+E LL+L++K++  I+D  WT +      + +  Y+   +E+ FL++C+G IL     K  + KQL  I  +TRH++  ER G A+G GLCA++HLD  L KLE +  ++A ++ +G+FGL KDK    +  ++E +++++IL  G    +A  + + +R++S++++ +  N    KD  +   ++ S+ L+A+A++ +  K  + F  +++L+  +  +I+AE    +   +R + + T  NLI L PP+T  E   +L  C++ V+ LP    P K   E   D      VL   T N L+EL++ +L    S      ++K I +   S  +H RERA+ T   LL  Y D ++    N    + +G L G L PR  DPN   R+  IDC+     IQL+ E       D S+  +  ++E+L   D ++L+   +++TK+I KR+   ++  LL  LF+GL D+Q N + A  V+ N L + R + L + V  +L  LH+ + ++ ++  ++ + +++ IL++Q+L   +NT +A  LP D    E+   +  D  +  + +  ++E  +  +P+ ++++   + G  K  +   +  +C     A+  + +   +  +  H+ L K++S L   +          LP    SN   S  +A   N  I      +  E L+  L   Q   +++ ++ +  WDK+++  +  + + LL+R++  +    +  I+ +L     + YE  RI VT F  S ++    A    ++D+++  ++ R+ D C  VR L++ G+GN+   S   V ++A  LL+A+  GM+++ D    +   AM G++ ++  L +K++  ++V + +++    E ++  +R ++  L G+L++  +G     F  +I++V+V LL+HL DP+  V++ACK A++   P+  + QIS      +++ N         L E+  LH+GEF ND +K         +N   +  + +FKS++ E+ AS+ + IG L+ NL ++  + +  G +   L+ LL+  +  VR + AEA+   H
Sbjct:    4 IEDTDIEQVTLALLDAANDRDPVVQEQVRKSILTLGNQKPDKVLSMCQDYL--LKHPKLVVGHRVVVLQTIELVVKSRIDDITYPK--IKSVIQLASDEMTRSKEVVPDWQQAASNILVAVGNKYINDIMEEILSKFQPGVLPHFFVVQTLANLSDSNVYGMVPFLNAIMGTMLPMLGMTKHDNMKWVFSSALCRFSESILEYLANLDKAPDPTVRKDTFSSEIFSAYDILFNSWIQSREAKLRLTVAEALGSMSHLMAHDKLEEQLPKLLPTILGLYKKNTEHYIISKSLCQVLEAS--------------------------VNMGSRVLETQIDGLLLALHQQVCSPVDFSNPPT-------IKNHNEVLRCFSILANTFPDRLMVFVLQRLENSNERNRMGSLAVLRHLINSSTSTMETKKLLILASIRQPLADH------------SNKVKKRVVQVISAMAHHGYLELDGGDLLVRFIIQHCALP-DTYYKGQRPQ-------DPEEVTNEALRSMCDNTLHLFTTTVGRLTDVLWPMLLCYLTPNQYANATTPLCKSLI-LLAN--------KKRATQEPNF-------MIDFNAQGSSLPSQYILLIRLLVNASFPFRYRGHGAPSLSLLNAISPSIHPKAETLWENEIPKLLSYLEESTEDS--------LDKKKWDETLLQLLSKTLATIDDSRWTNQLAVEATRYLPTYNNSLEEKSFLYRCVGVILQQCYNKELVRKQLQEILINTRHNDAVERTGVAMGIGLCASSHLDGTLEKLEEFGKSDAFRKASGIFGLLKDK----NDVDVEKMKSTLILCYGYVALHAPEDQLLTRIDSDILQNISKNFN-TKDLTMKLSLIHSVGLIAKAISNSVRKQGFMFTRKHELMGVMTDFIKAEPPEVMRTPVRYLVLTTCANLINLDPPLTENENFDLLKTCLNGVYGLPTADTPDKGKDEEALDPQQR-EVLYSDTFNALHELLRNVLARDLSPDGLQAVFKHIESWLSSGQDHERERAVKTTAHLLQFYLDNLSV--KNLVTFHNLGALVGRLAPRCTDPNPEVRRAAIDCIYSLMYIQLRYEGFSLDYKDDSVEALLDVREKLSNPDHSVLYKTCSELTKIISKRLPQQQLSTLLFMLFDGLVDSQSNCSRASSVILNTLLKNRGAGLQDLVPEMLEVLHNRLQVIGEEQVKVAIGQSILILATQHLQTVVNTLVAYPLPYDSWSCEMWMALGADSTLALQIMEMIIEKLNVMVPYVDKKESMLRPGLTKVATSHPLAMTC-----ALREMMLNGQSADAVAHL-LPKLFSALLVRLGSSVGVQ---LPKDLNSNSIISDRKATNKNSVINFDVCGVAVEALRVLLARAQLDAVVKPLDQEGAWDKMKDPQQHTTGVTLLSRAMAKHAGPRLPAIVESLCPSLCNIYECQRITVTAFL-SELLNHHVATELMILDMLMNNMMERITDTCGTVRMLAVRGLGNIAVGSPEKVNKYAKELLAAMSSGMEEKDDPGKLITLEAMSGMSKILLYLDQKNVNLLVVYIFMKIKPFLENENDEIRCASIMLLGNLSKFGSGEPV--FKDQIHNVLVSLLLHLSDPNPHVVKACKYAMRICAPVVGSEQIS------AMFQNH--------LLEEKGLHYGEFINDLTKYLIQDFPGMLNFYHITVVQFFKSNWAEIRASAAMFIGFLLGNLPDEHFSHMNMGSVTKGLVMLLQDPDPLVRVKAAEAMGHFH 1642          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Zebrafish
Match: mroh1 (maestro heat-like repeat family member 1 [Source:ZFIN;Acc:ZDB-GENE-090806-2])

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 499/1762 (28.32%), Postives = 914/1762 (51.87%), Query Frame = 2
Query:  101 VKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLH-VNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKY--------NKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLL-KDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKG--KCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEA---NLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLH 5335
            ++ T+++ +   L++   D +   +E +++S+++LG ++P  +LS+   +L   K  K+ +GHRV +L ++  ++K ++ DI      I  +I+   DE+T SKE++P+WQ  A+++LV +   Y + IM  ++ K QP VLPH+FV+  L  ++ +N Y MV +L+ I+  ML +L + K DN +WV +++  +F E+ILEY+AN D+APDP V   +FS  IFSA+++ F +W+ ++E+KLR  V +A+G+M  ++  +  E  LPKL+  I+  YKK+TE Y ++K+L QVL+++                          +   S   E +    +L L  Q C         T       I+N NEV RCF+ +   +PD+L+   L+RLE   E+ ++ +L +LRH+I+S    +  K+  I++ ++    ++            SN VK ++   I AM    YL   GG  L+ FI++ CAL   T +K ++ +         + +TN  LR++C+N L L ++T+  +  VLWP L+  L P +  +A   +C S+  L +N        +     E NF       +ID++    ++P    L+ RL+V A  P      G   L  +  +  + H    ++W+  IPKL+ YLE+S  +          D  +W+E LL+L++K++  I+D  WT +      + +  Y+   +E+ FL++C+G IL     K  + KQL  I  +TRH++  ER G A+G GLCA++HLD  L KLE +  ++A ++ +G+FGL KDK    +  ++E +++++IL  G    +A  + + +R++S++++ +  N            KD  +   ++ S+ L+A+A++ +  K  + F  +++L+  +  +I+AE    +   +R + + T  NLI L PP+T  E   +L  C++ V+ LP    P K   E   D      VL   T N L+EL++ +L    S      ++K I +   S  +H RERA+ T   LL  Y D ++    N    + +G L G L PR  DPN   R+  IDC+     IQL+ E       D S+  +  ++E+L   D ++L+   +++TK+I KR+   ++  LL  LF+GL D+Q N + A  V+ N L + R + L + V  +L  LH+ + ++ ++  ++ + +++ IL++Q+L   +NT +A  LP D    E+   +  D  +  + +  ++E  +  +P+ ++++   + G  K  +   +  +C     A+  + +   +  +  H+ L K++S L   +          LP    SN   S  +A   N  I      +  E L+  L   Q   +++ ++ +  WDK+++  +  + + LL+R++  +    +  I+ +L     + YE  RI VT F  S ++    A    ++D+++  ++ R+ D C  VR L++ G+GN+   S   V ++A  LL+A+  GM+++ D    +   AM G++ ++  L +K++  ++V + +++    E ++  +R ++  L G+L++  +G     F  +I++V+V LL+HL DP+  V++ACK A++   P+  + QIS      +++ N         L E+  LH+GEF ND +K         +N   +  + +FKS++ E+ AS+ + IG L+ NL ++  + +  G +   L+ LL+  +  VR + AEA+   H
Sbjct:    4 IEDTDIEQVTLALLDAANDRDPVVQEQVRKSILTLGNQKPDKVLSMCQDYL--LKHPKLVVGHRVVVLQTIELVVKSRIDDITYPK--IKSVIQLASDEMTRSKEVVPDWQQAASNILVAVGNKYINDIMEEILSKFQPGVLPHFFVVQTLANLSDSNVYGMVPFLNAIMGTMLPMLGMTKHDNMKWVFSSALCRFSESILEYLANLDKAPDPTVRKDTFSSEIFSAYDILFNSWIQSREAKLRLTVAEALGSMSHLMAHDKLEEQLPKLLPTILGLYKKNTEHYIISKSLCQVLEAS--------------------------VNMGSRVLETQIDGLLLALHQQVCSPVDFSNPPT-------IKNHNEVLRCFSILANTFPDRLMVFVLQRLENSNERNRMGSLAVLRHLINSSTSTMETKKLLILASIRQPLADH------------SNKVKKRVVQVISAMAHHGYLELDGGDLLVRFIIQHCALP-DTYYKGQRPQ-------DPEEVTNEALRSMCDNTLHLFTTTVGRLTDVLWPMLLCYLTPNQYANATTPLCKSLI-LLAN--------KKRATQEPNF-------MIDFNAQGSSLPSQYILLIRLLVNASFPFRYRGHGAPSLSLLNAISPSIHPKAETLWENEIPKLLSYLEESTEDS--------LDKKKWDETLLQLLSKTLATIDDSRWTNQLAVEATRYLPTYNNSLEEKSFLYRCVGVILQQCYNKELVRKQLQEILINTRHNDAVERTGVAMGIGLCASSHLDGTLEKLEEFGKSDAFRKASGIFGLLKDK----NDVDVEKMKSTLILCYGYVALHAPEDQLLTRIDSDILQNISKNFNTKVLGIKVETKDLTMKLSLIHSVGLIAKAISNSVRKQGFMFTRKHELMGVMTDFIKAEPPEVMRTPVRYLVLTTCANLINLDPPLTENENFDLLKTCLNGVYGLPTADTPDKGKDEEALDPQQR-EVLYSDTFNALHELLRNVLARDLSPDGLQAVFKHIESWLSSGQDHERERAVKTTAHLLQFYLDNLSV--KNLVTFHNLGALVGRLAPRCTDPNPEVRRAAIDCIYSLMYIQLRYEGFSLDYKDDSVEALLDVREKLSNPDHSVLYKTCSELTKIISKRLPQQQLSTLLFMLFDGLVDSQSNCSRASSVILNTLLKNRGAGLQDLVPEMLEVLHNRLQVIGEEQVKVAIGQSILILATQHLQTVVNTLVAYPLPYDSWSCEMWMALGADSTLALQIMEMIIEKLNVMVPYVDKKESMLRPGLTKVATSHPLAMTC-----ALREMMLNGQSADAVAHL-LPKLFSALLVRLGSSVGVQ---LPKDLNSNSIISDRKATNKNSVINFDVCGVAVEALRVLLARAQLDAVVKPLDQEGAWDKMKDPQQHTTGVTLLSRAMAKHAGPRLPAIVESLCPSLCNIYECQRITVTAFL-SELLNHHVATELMILDMLMNNMMERITDTCGTVRMLAVRGLGNIAVGSPEKVNKYAKELLAAMSSGMEEKDDPGKLITLEAMSGMSKILLYLDQKNVNLLVVYIFMKIKPFLENENDEIRCASIMLLGNLSKFGSGEPV--FKDQIHNVLVSLLLHLSDPNPHVVKACKYAMRICAPVVGSEQIS------AMFQNH--------LLEEKGLHYGEFINDLTKYLIQDFPGMLNFYHITVVQFFKSNWAEIRASAAMFIGFLLGNLPDEHFSHMNMGSVTKGLVMLLQDPDPLVRVKAAEAMGHFH 1651          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Zebrafish
Match: mroh1 (maestro heat-like repeat family member 1 [Source:ZFIN;Acc:ZDB-GENE-090806-2])

HSP 1 Score: 316.235 bits (809), Expect = 6.678e-93
Identity = 208/692 (30.06%), Postives = 363/692 (52.46%), Query Frame = 2
Query:  101 VKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLH-VNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKL 2170
            ++ T+++ +   L++   D +   +E +++S+++LG ++P  +LS+   +L   K  K+ +GHRV +L ++  ++K ++ DI      I  +I+   DE+T SKE++P+WQ  A+++LV +   Y + IM  ++ K QP VLPH+FV+  L  ++ +N Y MV +L+ I+  ML +L + K DN +WV +++  +F E+ILEY+AN D+APDP V   +FS  IFSA+++ F +W+ ++E+KLR  V +A+G+M  ++  +  E  LPKL+  I+  YKK+TE Y ++K+L QVL+++                          +   S   E +    +L L  Q C         T       I+N NEV RCF+ +   +PD+L+   L+RLE   E+ ++ +L +LRH+I+S    +  K+  I++ ++    ++            SN VK ++   I AM    YL   GG  L+ FI++ CAL   T +K ++ +         + +TN  LR++C+N L L ++T+  +  VLWP L+  L P +  +A   +C S+  L +N        +     E NF       +ID++    ++P    L+ RL+V A  P      G   L  +  +  + H    ++W+  IPKL+ Y        LE   ++  D  +W+E LL++
Sbjct:    4 IEDTDIEQVTLALLDAANDRDPVVQEQVRKSILTLGNQKPDKVLSMCQDYL--LKHPKLVVGHRVVVLQTIELVVKSRIDDITYPK--IKSVIQLASDEMTRSKEVVPDWQQAASNILVAVGNKYINDIMEEILSKFQPGVLPHFFVVQTLANLSDSNVYGMVPFLNAIMGTMLPMLGMTKHDNMKWVFSSALCRFSESILEYLANLDKAPDPTVRKDTFSSEIFSAYDILFNSWIQSREAKLRLTVAEALGSMSHLMAHDKLEEQLPKLLPTILGLYKKNTEHYIISKSLCQVLEAS--------------------------VNMGSRVLETQIDGLLLALHQQVCSPVDFSNPPT-------IKNHNEVLRCFSILANTFPDRLMVFVLQRLENSNERNRMGSLAVLRHLINSSTSTMETKKLLILASIRQPLADH------------SNKVKKRVVQVISAMAHHGYLELDGGDLLVRFIIQHCALP-DTYYKGQRPQ-------DPEEVTNEALRSMCDNTLHLFTTTVGRLTDVLWPMLLCYLTPNQYANATTPLCKSLI-LLAN--------KKRATQEPNF-------MIDFNAQGSSLPSQYILLIRLLVNASFPFRYRGHGAPSLSLLNAISPSIHPKAETLWENEIPKLLSY--------LEESTEDSLDKKKWDETLLQV 614          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Zebrafish
Match: mroh1 (maestro heat-like repeat family member 1 [Source:ZFIN;Acc:ZDB-GENE-090806-2])

HSP 1 Score: 255.758 bits (652), Expect = 3.894e-71
Identity = 196/748 (26.20%), Postives = 380/748 (50.80%), Query Frame = 2
Query: 3110 IYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLL-KDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKG--KCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEA---NLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLH 5335
            ++K I +   S  +H RERA+ T   LL  Y D ++    N    + +G L G L PR  DPN   R+  IDC+     IQL+ E       D S+  +  ++E+L   D ++L+   +++TK+I KR+   ++  LL  LF+GL D+Q N + A  V+ N L + R + L + V  +L  LH+ + ++ ++  ++ + +++ IL++Q+L   +NT +A  LP D    E+   +  D  +  + +  ++E  +  +P+ ++++   + G  K  +   +  +C     A+  + +   +  +  H+ L K++S L   +          LP    SN   S  +A   N  I      +  E L+  L   Q   +++ ++ +  WDK+++  +  + + LL+R++  +    +  I+ +L     + YE  RI VT F  S ++    A    ++D+++  ++ R+ D C  VR L++ G+GN+   S   V ++A  LL+A+  GM+++ D    +   AM G++ ++  L +K++  ++V + +++    E ++  +R ++  L G+L++  +G     F  +I++V+V LL+HL DP+  V++ACK A++   P+  + QIS      +++ N         L E+  LH+GEF ND +K         +N   +  + +FKS++ E+ AS+ + IG L+ NL ++  + +  G +   L+ LL+  +  VR + AEA+   H
Sbjct:   12 VFKHIESWLSSGQDHERERAVKTTAHLLQFYLDNLSV--KNLVTFHNLGALVGRLAPRCTDPNPEVRRAAIDCIYSLMYIQLRYEGFSLDYKDDSVEALLDVREKLSNPDHSVLYKTCSELTKIISKRLPQQQLSTLLFMLFDGLVDSQSNCSRASSVILNTLLKNRGAGLQDLVPEMLEVLHNRLQVIGEEQVKVAIGQSILILATQHLQTVVNTLVAYPLPYDSWSCEMWMALGADSTLALQIMEMIIEKLNVMVPYVDKKESMLRPGLTKVATSHPLAMTC-----ALREMMLNGQSADAVAHL-LPKLFSALLVRLGSSVGVQ---LPKDLNSNSIISDRKATNKNSVINFDVCGVAVEALRVLLARAQLDAVVKPLDQEGAWDKMKDPQQHTTGVTLLSRAMAKHAGPRLPAIVESLCPSLCNIYECQRITVTAFL-SELLNHHVATELMILDMLMNNMMERITDTCGTVRMLAVRGLGNIAVGSPEKVNKYAKELLAAMSSGMEEKDDPGKLITLEAMSGMSKILLYLDQKNVNLLVVYIFMKIKPFLENENDEIRCASIMLLGNLSKFGSGEPV--FKDQIHNVLVSLLLHLSDPNPHVVKACKYAMRICAPVVGSEQIS------AMFQNH--------LLEEKGLHYGEFINDLTKYLIQDFPGMLNFYHITVVQFFKSNWAEIRASAAMFIGFLLGNLPDEHFSHMNMGSVTKGLVMLLQDPDPLVRVKAAEAMGHFH 731          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Xenopus
Match: rusc2 (RUN and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-994115])

HSP 1 Score: 196.438 bits (498), Expect = 1.128e-49
Identity = 165/647 (25.50%), Postives = 306/647 (47.30%), Query Frame = 2
Query: 3407 PTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKD-NPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNC-LPFT-GKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNR--FLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLL 5332
            P   +  +K D  +L+    ++  +I KR+ P ++  LL   FEGL D   N + A  VM N L + R S L  +V  I+ ++ + +   ++ + R   L+ + IL+SQ+L   L++ ++  LP              D   LE+       +      F+          +C             LA+    +IL +   +     + ++Y +LF ++++  S  I   LP   G S ++K+   +  +  + P     E LK  L+   S E+   +  + GW+ +  E+     ++ L+ S+      ++  I+  L    +S YE+ RI  T F  + ++  ++     +I+ ++  + SRL D  + VR L++ G+GN+   +   V++H   LL+A++  MDDR+D +  +   AM  L +L+  + EKDIR +L+   +R+   ++ +   +R ++  LFG+L +  +G       F  ++ S +V LL+HL+DP  +V++ACK AL+   P               +    L D   + L+ +  LH+GEF N+  K       + ++ +I  ++ YFKS +P++ A++ L IG L+ ++QE +   +    +   LI LLK  +  VRAR +E I  L
Sbjct:  828 PPCWQGFQKPDPRVLYHTCFNVAMIIGKRLPPEQLISLLFITFEGLSDPDINCSRAASVMVNSLLKDRGSILLAKVPDIMARVEEQLQETQEAHVRKAALQTVYILASQHLEAVLSSLLSCPLPY--------AREGGDWGSLERGSGFFYSL------FQLIPGSMHPPTRCFPPP---------LASCAVCEILSAPDSAPA---VQELYPQLFVTLLLRISVMIGVQLPKNLGPSKDRKNS-SSPPSRDLDPCGSAVEALKFMLSRGGSEEVTCSLEAEGGWENMRKEETHHLGVSSLSSSMVQYAGPKLPVILKALQPALSSVYERQRITATAFL-AELLRSSNLGNLIVIEPLMDNMTSRLKDGAVTVRMLAVRGLGNMAAGAPDKVRKHGPQLLTAMINAMDDREDPEHIVTQEAMSSLCLLLPYVQEKDIRSLLIHTAIRVRPFFDHEREELRKASISLFGNLIKFCSGNGNGEEVFYEQMMSGLVALLLHLQDPRADVVKACKFALQMCAP--------------RMNNPSLADMFLSHLQPERGLHYGEFMNNVCKHLLQGTPELLSRLIQTNVSYFKSIWPDIRAAAPLFIGFLVLHMQEDQTKQVDLEHLVSSLIVLLKDPHPPVRARASETIGRL 1432          

HSP 2 Score: 176.792 bits (447), Expect = 1.101e-43
Identity = 136/494 (27.53%), Postives = 241/494 (48.79%), Query Frame = 2
Query: 1226 FTTICMPYPDQLISNCLRRLEG-PEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANST----KKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKV 2686
            F++    +PD L++  L +LE    K ++  L+I++ +I+S    +  K+  I++ ++    +             +N V+  +   I AM    YL + GG  L+E+++R C ++     + +        N   + +T   +R +  + L L S+T+  M ++LWPYL+E +VPV+ ++A+  IC S+  L             + Q ES      +E  +I+Y++H N+P P  L++RL+V A      + R    L+ + ++  N H  +   WD  IP L+       N   E   ++     +WE+ +LK +  +++ + D+ W  + G+ M QQ+  Y+ LP E+   +   GT LA       ++  + KQ  ++    R+ E  ER G AV FG+C+A HLD  L  L  +  ++  KR  G+F LFKD+       ++E +++S+IL  G    YA  ELV  R+E    ++L+N   Y   KV
Sbjct:  287 FSSPVSRFPDHLLAFLLPKLEANSPKVRVGTLVIMKQVINSAPTSMEVKKPLILAAVRQPLQDP------------TNRVRRAMVQLISAMAHHGYLEQPGGELLLEYLIRLCCVTPSPSSRQQ--------NSEPEEVTEENVRRISISTLYLISTTVDRMNNILWPYLLEFIVPVQFSNALTPICKSLVQL-----------GQKRQAES------VETFLINYNVHTNLPSPHALVARLLVAAAALEPGDGRSSAALRLLNVMQINIHPTVGRCWDQEIPLLL-------NCLEEHGAESLLQQNEWEDKMLKFLGVTLQAVADDKWISQLGQEMHQQLLSYNSLPLEKVSAWG--GTSLAAPPIHLYRECVLVKQPQVLLSPPRYQEESEREGLAVAFGICSARHLDEALDTLGDFLKSDIMKRNAGIFNLFKDRA----DGDLEKIKSSLILCYGYVTVYAPIELVLPRIE---CEILRNVFSYFHTKV 727          

HSP 3 Score: 150.214 bits (378), Expect = 1.399e-35
Identity = 83/229 (36.24%), Postives = 132/229 (57.64%), Query Frame = 2
Query:  155 DENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVI----DELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKL 829
            D++ E +E +  SL  +G   P  IL    S+L +    K+S  HR  +L +M  I+K      ++   L  +  K VI    +E+T SK+I+ EWQ  A++VLV +  H+ + +M  ++ K QP +LPH+F++  L  ++V N + MV +L+ I+  ML +L +AK D  + V   +   F E+I EY+AN D+APDP V   +FS  IF+A++V F  WL  +ESK+
Sbjct:    6 DKDPEVQEQIYSSLCFMGEAAPTEILESCDSYLRQHD--KLSYAHRTIILRAMETIVK------NSLKALTKETAKMVILLASNEMTKSKDIIFEWQQGASNVLVAIGRHFINNVMEEILVKFQPGILPHFFIMQTLANLSVANVFGMVPFLNSILGTMLPMLGMAKQDPMKAVFCVALQHFSESIQEYLANLDKAPDPTVRKDTFSNEIFNAYDVLFNTWLQNRESKV 226          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Xenopus
Match: rusc2 (RUN and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-994115])

HSP 1 Score: 179.874 bits (455), Expect = 1.157e-44
Identity = 155/603 (25.70%), Postives = 287/603 (47.60%), Query Frame = 2
Query: 3467 DITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKD-NPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHIC-----------LTKMYSKLFTXXXXXXXXXXNC-LPFT-GKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNR--FLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKE 5227
            D+ ++I KR+ P ++  LL   FEGL D   N + A  VM N L + R S L  +V  I+ ++ + +   ++ + R   L+ + IL+SQ+L   L++ ++  LP            +     L +C            P+ +R   S K    N +  I      W+     L      K SC  +C           + ++Y +LF ++++  S  I   LP   G S ++K+   +  +  + P     E LK  L+   S E+   +  + GW+ +  E+     ++ L+ S+      ++  I+  L    +S YE+ RI  T F  + ++  ++     +I+ ++  + SRL D  + VR L++ G+GN+   +   V++H   LL+A++  MDDR+D +  +   AM  L +L+  + EKDIR +L+   +R+   ++ +   +R ++  LFG+L +  +G       F  ++ S +V LL+HL+DP  +V++ACK AL+   P               +    L D   + L+ +  LH+GEF N+  K       + ++ +I  ++ YFKS +P++ A++ L IG L+ ++QE +
Sbjct:  797 DLFQIIGKRLPPEQLISLLFITFEGLSDPDINCSRAASVMVNSLLKDRGSILLAKVPDIMARVEEQLQETQEAHVRKAALQTVYILASQHLEAVLSSLLSCPLPYPGAALLPAAPPSVPIQFLGRC------------PYTDR---SAKPDWSNFL--ISRPWRDWI-----LSQYLEQKASCA-VCEILSAPDSAPAVQELYPQLFVTLLLRISVMIGVQLPKNLGPSKDRKNS-SSPPSRDLDPCGSAVEALKFMLSRGGSEEVTCSLEAEGGWENMRKEETHHLGVSSLSSSMVQYAGPKLPVILKALQPALSSVYERQRITATAFL-AELLRSSNLGNLIVIEPLMDNMTSRLKDGAVTVRMLAVRGLGNMAAGAPDKVRKHGPQLLTAMINAMDDREDPEHIVTQEAMSSLCLLLPYVQEKDIRSLLIHTAIRVRPFFDHEREELRKASISLFGNLIKFCSGNGNGEEVFYEQMMSGLVALLLHLQDPRADVVKACKFALQMCAP--------------RMNNPSLADMFLSHLQPERGLHYGEFMNNVCKHLLQGTPELLSRLIQTNVSYFKSIWPDIRAAAPLFIGFLVLHMQEDQ 1360          

HSP 2 Score: 153.295 bits (386), Expect = 1.603e-36
Identity = 86/239 (35.98%), Postives = 137/239 (57.32%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVI----DELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKL 829
            LA  L++   D++ E +E +  SL  +G   P  IL    S+L +    K+S  HR  +L +M  I+K      ++   L  +  K VI    +E+T SK+I+ EWQ  A++VLV +  H+ + +M  ++ K QP +LPH+F++  L  ++V N + MV +L+ I+  ML +L +AK D  + V   +   F E+I EY+AN D+APDP V   +FS  IF+A++V F  WL  +ESK+
Sbjct:    8 LAVTLMDASTDKDPEVQEQIYSSLCFMGEAAPTEILESCDSYLRQHD--KLSYAHRTIILRAMETIVK------NSLKALTKETAKMVILLASNEMTKSKDIIFEWQQGASNVLVAIGRHFINNVMEEILVKFQPGILPHFFIMQTLANLSVANVFGMVPFLNSILGTMLPMLGMAKQDPMKAVFCVALQHFSESIQEYLANLDKAPDPTVRKDTFSNEIFNAYDVLFNTWLQNRESKV 238          

HSP 3 Score: 145.591 bits (366), Expect = 3.993e-34
Identity = 127/490 (25.92%), Postives = 228/490 (46.53%), Query Frame = 2
Query: 1226 FTTICMPYPDQLISNCLRRLEG-PEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKV 2686
            F++    +PD L++  L +LE    K ++  L+I++ +I+S    +  K+  I++ ++    +             +N V+  +   I AM    YL + GG  L+E+++R C ++     ++     + ++N+          R +  + L L S+T+  M ++LWPYL+E +VPV+ ++A+  IC S+  L             + Q ES      +E  +I+Y++H N+P P  L++RL+V A      + R    L+ + ++  N H  +   WD  IP L+                  F +        + +  +++ + D+ W  + G+ M QQ+  Y+ LP E+   +   GT LA      +  ++  L+      SE     G AV FG+C+A HLD  L  L  +  ++  KR  G+F LFKD+       ++E +++S+IL  G    YA  ELV  R+E    ++L+N   Y   KV
Sbjct:  293 FSSPVSRFPDHLLAFLLPKLEANSPKVRVGTLVIMKQVINSAPTSMEVKKPLILAAVRQPLQDP------------TNRVRRAMVQLISAMAHHGYLEQPGGELLLEYLIRLCCVTPSPSVRD-----HFAENV----------RRISISTLYLISTTVDRMNNILWPYLLEFIVPVQFSNALTPICKSLVQL-----------GQKRQAES------VETFLINYNVHTNLPSPHALVARLLVAAAALEPGDGRSSAALRLLNVMQINIHPTVGRCWDQEIPLLL---------NCLEGTFLCFPV--------QFLGVTLQAVADDKWISQLGQEMHQQLLSYNSLPLEKVSAWG--GTSLAAPPIHLY--RECVLV------SERSNMAGLAVAFGICSARHLDEALDTLGDFLKSDIMKRNAGIFNLFKDRA----DGDLEKIKSSLILCYGYVTVYAPIELVLPRIEC---EILRNVFSYFHTKV 704          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Xenopus
Match: rusc2 (RUN and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-994115])

HSP 1 Score: 179.874 bits (455), Expect = 1.349e-44
Identity = 155/603 (25.70%), Postives = 287/603 (47.60%), Query Frame = 2
Query: 3467 DITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKD-NPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHIC-----------LTKMYSKLFTXXXXXXXXXXNC-LPFT-GKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNR--FLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKE 5227
            D+ ++I KR+ P ++  LL   FEGL D   N + A  VM N L + R S L  +V  I+ ++ + +   ++ + R   L+ + IL+SQ+L   L++ ++  LP            +     L +C            P+ +R   S K    N +  I      W+     L      K SC  +C           + ++Y +LF ++++  S  I   LP   G S ++K+   +  +  + P     E LK  L+   S E+   +  + GW+ +  E+     ++ L+ S+      ++  I+  L    +S YE+ RI  T F  + ++  ++     +I+ ++  + SRL D  + VR L++ G+GN+   +   V++H   LL+A++  MDDR+D +  +   AM  L +L+  + EKDIR +L+   +R+   ++ +   +R ++  LFG+L +  +G       F  ++ S +V LL+HL+DP  +V++ACK AL+   P               +    L D   + L+ +  LH+GEF N+  K       + ++ +I  ++ YFKS +P++ A++ L IG L+ ++QE +
Sbjct:  789 DLFQIIGKRLPPEQLISLLFITFEGLSDPDINCSRAASVMVNSLLKDRGSILLAKVPDIMARVEEQLQETQEAHVRKAALQTVYILASQHLEAVLSSLLSCPLPYPGAALLPAAPPSVPIQFLGRC------------PYTDR---SAKPDWSNFL--ISRPWRDWI-----LSQYLEQKASCA-VCEILSAPDSAPAVQELYPQLFVTLLLRISVMIGVQLPKNLGPSKDRKNS-SSPPSRDLDPCGSAVEALKFMLSRGGSEEVTCSLEAEGGWENMRKEETHHLGVSSLSSSMVQYAGPKLPVILKALQPALSSVYERQRITATAFL-AELLRSSNLGNLIVIEPLMDNMTSRLKDGAVTVRMLAVRGLGNMAAGAPDKVRKHGPQLLTAMINAMDDREDPEHIVTQEAMSSLCLLLPYVQEKDIRSLLIHTAIRVRPFFDHEREELRKASISLFGNLIKFCSGNGNGEEVFYEQMMSGLVALLLHLQDPRADVVKACKFALQMCAP--------------RMNNPSLADMFLSHLQPERGLHYGEFMNNVCKHLLQGTPELLSRLIQTNVSYFKSIWPDIRAAAPLFIGFLVLHMQEDQ 1352          

HSP 2 Score: 154.836 bits (390), Expect = 5.292e-37
Identity = 87/241 (36.10%), Postives = 138/241 (57.26%), Query Frame = 2
Query:  119 DILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVI----DELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKL 829
            D LA  L++   D++ E +E +  SL  +G   P  IL    S+L +    K+S  HR  +L +M  I+K      ++   L  +  K VI    +E+T SK+I+ EWQ  A++VLV +  H+ + +M  ++ K QP +LPH+F++  L  ++V N + MV +L+ I+  ML +L +AK D  + V   +   F E+I EY+AN D+APDP V   +FS  IF+A++V F  WL  +ESK+
Sbjct:    3 DSLAVTLMDASTDKDPEVQEQIYSSLCFMGEAAPTEILESCDSYLRQHD--KLSYAHRTIILRAMETIVK------NSLKALTKETAKMVILLASNEMTKSKDIIFEWQQGASNVLVAIGRHFINNVMEEILVKFQPGILPHFFIMQTLANLSVANVFGMVPFLNSILGTMLPMLGMAKQDPMKAVFCVALQHFSESIQEYLANLDKAPDPTVRKDTFSNEIFNAYDVLFNTWLQNRESKV 235          

HSP 3 Score: 145.591 bits (366), Expect = 3.681e-34
Identity = 162/677 (23.93%), Postives = 298/677 (44.02%), Query Frame = 2
Query: 1226 FTTICMPYPDQLISNCLRRLEG-PEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVI-----NRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMN---NLNELIKTILKTYFSDL--TFTEIYKVIRTRFVSEHE-HIRERALSTVYILLNSYYDEI 3214
            F++    +PD L++  L +LE    K ++  L+I++ +I+S    +  K+  I++ ++    +             +N V+  +   I AM    YL + GG  L+E+++R C ++     ++     + ++N+          R +  + L L S+T+  M ++LWPYL+E +VPV+ ++A+  IC S+  L             + Q ES      +E  +I+Y++H N+P P  L++RL+V A      + R    L+ + ++  N H  +   WD  IP L+                  F +        + +  +++ + D+ W  + G+ M QQ+  Y+ LP E+   +   GT LA      +  ++  L+      SE     G AV FG+C+A HLD  L  L  +  ++  KR  G+F LFKD+       ++E +++S+IL  G    YA  ELV  R+E    ++L+N   Y   KV       R +   + L     +  + + +   E+   L+   L  +    S   +    G     IG+   L  P+         ++  D +F +    +P ++   + F    TF  L D  +N     + ++ ++LK   S L     +I   +  +     E H+R+ AL TVYIL + + + +
Sbjct:  290 FSSPVSRFPDHLLAFLLPKLEANSPKVRVGTLVIMKQVINSAPTSMEVKKPLILAAVRQPLQDP------------TNRVRRAMVQLISAMAHHGYLEQPGGELLLEYLIRLCCVTPSPSVRD-----HFAENV----------RRISISTLYLISTTVDRMNNILWPYLLEFIVPVQFSNALTPICKSLVQL-----------GQKRQAES------VETFLINYNVHTNLPSPHALVARLLVAAAALEPGDGRSSAALRLLNVMQINIHPTVGRCWDQEIPLLL---------NCLEGTFLCFPV--------QFLGVTLQAVADDKWISQLGQEMHQQLLSYNSLPLEKVSAWG--GTSLAAPPIHLY--RECVLV------SERSNMAGLAVAFGICSARHLDEALDTLGDFLKSDIMKRNAGIFNLFKDRA----DGDLEKIKSSLILCYGYVTVYAPIELVLPRIEC---EILRNVFSYFHTKVSGTGYKGRSLGAPLVLGPWIKSNKEHERDRAMEVSAALLECYLHKLNVNVSGCTWGVPVGGGTAGIGH--CLSCPLYGPFPHPAPHLLFD-LFQIIGKRLPPEQLISLLFI---TFEGLSDPDINCSRAASVMVNSLLKDRGSILLAKVPDIMARVEEQLQETQEAHVRKAALQTVYILASQHLEAV 882          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Xenopus
Match: rusc2 (RUN and SH3 domain containing 2 [Source:Xenbase;Acc:XB-GENE-994115])

HSP 1 Score: 175.637 bits (444), Expect = 2.321e-43
Identity = 152/592 (25.68%), Postives = 284/592 (47.97%), Query Frame = 2
Query: 3467 DITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKD-NPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNC-LPFT-GKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNR--FLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKE 5227
            D+ ++I KR+ P ++  LL   FEGL D   N + A  VM N L + R S L  +V  I+ ++ + +   ++ + R   L+ + IL+SQ+L   L++ ++  LP       +L         L    V         +P               S+  +  SC V      C +IL +   +     + ++Y +LF ++++  S  I   LP   G S ++K+   +  +  + P     E LK  L+   S E+   +  + GW+ +  E+     ++ L+ S+      ++  I+  L    +S YE+ RI  T F  + ++  ++     +I+ ++  + SRL D  + VR L++ G+GN+   +   V++H   LL+A++  MDDR+D +  +   AM  L +L+  + EKDIR +L+   +R+   ++ +   +R ++  LFG+L +  +G       F  ++ S +V LL+HL+DP  +V++ACK AL+   P               +    L D   + L+ +  LH+GEF N+  K       + ++ +I  ++ YFKS +P++ A++ L IG L+ ++QE +
Sbjct:  778 DLFQIIGKRLPPEQLISLLFITFEGLSDPDINCSRAASVMVNSLLKDRGSILLAKVPDIMARVEEQLQETQEAHVRKAALQTVYILASQHLEAVLSSLLSCPLPYASTSGSLLPLPVSTSGSLLPLPV---STSGSLLPL--------PVSTSGSLLPLPASCAV------C-EILSAPDSAPA---VQELYPQLFVTLLLRISVMIGVQLPKNLGPSKDRKNS-SSPPSRDLDPCGSAVEALKFMLSRGGSEEVTCSLEAEGGWENMRKEETHHLGVSSLSSSMVQYAGPKLPVILKALQPALSSVYERQRITATAFL-AELLRSSNLGNLIVIEPLMDNMTSRLKDGAVTVRMLAVRGLGNMAAGAPDKVRKHGPQLLTAMINAMDDREDPEHIVTQEAMSSLCLLLPYVQEKDIRSLLIHTAIRVRPFFDHEREELRKASISLFGNLIKFCSGNGNGEEVFYEQMMSGLVALLLHLQDPRADVVKACKFALQMCAP--------------RMNNPSLADMFLSHLQPERGLHYGEFMNNVCKHLLQGTPELLSRLIQTNVSYFKSIWPDIRAAAPLFIGFLVLHMQEDQ 1332          

HSP 2 Score: 145.976 bits (367), Expect = 2.747e-34
Identity = 127/493 (25.76%), Postives = 231/493 (46.86%), Query Frame = 2
Query: 1226 FTTICMPYPDQLISNCLRRLEG-PEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELL---LKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKV 2686
            F++    +PD L++  L +LE    K ++  L+I++ +I+S    +  K+  I++ ++    +             +N V+  +   I AM    YL + GG  L+E+++R C ++     ++     + ++N+          R +  + L L S+T+  M ++LWPYL+E +VPV+ ++A+  IC S+  L             + Q ES      +E  +I+Y++H N+P P  L++RL+V A      + R    L+ + ++  N H  +   WD  IP L+                   + ++    L   ++ +  +++ + D+ W  + G+ M QQ+  Y+ LP E+   +   GT LA       + ++  L+      SE     G AV FG+C+A HLD  L  L  +  ++  KR  G+F LFKD+       ++E +++S+IL  G    YA  ELV  R+E    ++L+N   Y   KV
Sbjct:  275 FSSPVSRFPDHLLAFLLPKLEANSPKVRVGTLVIMKQVINSAPTSMEVKKPLILAAVRQPLQDP------------TNRVRRAMVQLISAMAHHGYLEQPGGELLLEYLIRLCCVTPSPSVRD-----HFAENV----------RRISISTLYLISTTVDRMNNILWPYLLEFIVPVQFSNALTPICKSLVQL-----------GQKRQAES------VETFLINYNVHTNLPSPHALVARLLVAAAALEPGDGRSSAALRLLNVMQINIHPTVGRCWDQEIPLLL-------------------NCLEGTVFLCFPVQFLGVTLQAVADDKWISQLGQEMHQQLLSYNSLPLEKVSAWG--GTSLA--APPIHLYRECVLV------SERSNMAGLAVAFGICSARHLDEALDTLGDFLKSDIMKRNAGIFNLFKDRA----DGDLEKIKSSLILCYGYVTVYAPIELVLPRIEC---EILRNVFSYFHTKV 687          

HSP 3 Score: 144.821 bits (364), Expect = 6.466e-34
Identity = 85/242 (35.12%), Postives = 134/242 (55.37%), Query Frame = 2
Query:  116 LDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVI----DELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKL 829
            L  LA  L++   D++ E +E +  SL  +G   P  IL    S+L +    K+S  HR  +L +M  I+K      ++   L  +  K VI    +E+T SK     WQ  A++VLV +  H+ + +M  ++ K QP +LPH+F++  L  ++V N + MV +L+ I+  ML +L +AK D  + V   +   F E+I EY+AN D+APDP V   +FS  IF+A++V F  WL  +ESK+
Sbjct:    6 LSGLAVTLMDASTDKDPEVQEQIYSSLCFMGEAAPTEILESCDSYLRQHD--KLSYAHRTIILRAMETIVK------NSLKALTKETAKMVILLASNEMTKSK-----WQQGASNVLVAIGRHFINNVMEEILVKFQPGILPHFFIMQTLANLSVANVFGMVPFLNSILGTMLPMLGMAKQDPMKAVFCVALQHFSESIQEYLANLDKAPDPTVRKDTFSNEIFNAYDVLFNTWLQNRESKV 234          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Mouse
Match: Mroh1 (maestro heat-like repeat family member 1 [Source:MGI Symbol;Acc:MGI:2442558])

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 476/1755 (27.12%), Postives = 846/1755 (48.21%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI---------KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALK----ILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEERED--LSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNC-LPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLL 5332
            L+  L++ + D++   +E +  +L SLG  +P   L     +L +    K++  +R  +L +M  +L   ++D+    D    +I     E+T +KE+  +WQ  A  VLV +   + + +M  ++ + QP +LPH  V+H L  ++V+N +DMV +L  I++ ML +LS+AK D  + V   +   F E+ILEY+AN D+APDP V   +F   IF A++V F +WL ++++KLR AV+ A+G M  ++     E  LPKL+  ++  YKKH E++ ++K+L Q+L++A                          +  +S   E++    ++ L  Q C+   +   L        + +Q EV RCFT +    PD+L++  L RL+   E+ ++  L ILRHII+S   Q+  K+  I+S            S        ++ VK  +   I AM    YL + GG  ++E+IV+QCAL  +   K      +L+ +          +R +    L L S+T+  M SVLWPYL+E L PV  T A+  +C S+ +L          ++ +     +F       +I Y+ + N+P P  + +RL+V++  P   + RG   L+ ++++  N H  L   W+  +P L+ YL++               + +WEE LL  +  ++  ++D  W  +  + M +Q+  Y   P+E+ FL+KC+GT L  ++ K  + K L  +  + R+ E  E+ G A  FG+CA  HL+  LA+LE +  ++  +++TG+F +FKD+        +E +++ +IL  G+    A  ELV +R+ES+++         KVL   ++  KD  +   +V+S+ +V++A+  +    ++ F  + +LV+ ++ +I AE    L   +R  AM     L+ L P +       V++ C+ +V  LPP         E    D      L   T+  L +L+  +L+   +      + + +     S   H R RAL     LL  + + +  + +   P + +G L G   PR AD     RQ  + CV     +QL  E   RD   D +  ++ T+++ L   D  ILF   + I ++I KR+   ++  LL ++FE L D  KN + A  VM N L + R + L E+V  I++ L    + L+D     VL A +    +L+SQ+    +++ +   LP D     +   +A +  +  + L  L+E  S+ +PF+E     L     +  ++  +  +C ++       ++L +   S G + L ++Y +LF ++++  S ++   LP   ++ E++S   A  A  + P +   + L+  L  + S +++  + ++ GW+ L+        +A LA S+       +  +   L+   NS YE  R+  T F    ++     N   L++ ++  L +RL D    VRRL L G+ N+   S   V+ H   LL+A++ G+DD  +    +   AM GL+ L+  +   D+R +L+   +R+   ++ +    R ++ RLFG L +   G   + FL ++   +VPLL+HL DP   V  ACK AL   +P               L   +L       L+E  ++HFGEF N   K       D +  ++  +L YFKS + ++ A++ +  G L+ + + ++ T +   Q+ + L  LLK     VR + AE +  L
Sbjct:    9 LSFTLLDSITDKDPMVQEQVCSALCSLGDAQPDETLHACEEYLRQHD--KLAHPYRTKILRAMETVLSSHIHDLDK--DTAGAVILLATSEMTRTKELDCDWQQAAGSVLVAVGKRFTNQVMEEVLSRFQPGMLPHSSVLHTLANLSVSNAFDMVPFLPSILSTMLPMLSMAKQDALKVVFCGALQHFSESILEYLANLDQAPDPTVRKDTFGADIFGAYDVLFHHWLQSRDAKLRLAVVAALGPMSHLLPSERLEEQLPKLLPAVLGLYKKHAEAFQISKSLGQILEAA--------------------------VNVSSRTLEVQLDALLVALHAQICVPVESSSPLV-------MNSQKEVLRCFTVLACCSPDRLLAFLLPRLDTSNERLRVGTLQILRHIINSAAAQMEAKQPFILS------------SMRLPLLDTNDKVKRAVVQVISAMAHHGYLEQPGGEVMVEYIVQQCALPAEEPEKPGPDGEDLAAD---------SVRAVSIRTLYLVSTTVDRMNSVLWPYLLEFLTPVRFTAALTPLCRSLVHL---------ALKRQEAGADDF-------LIQYNANANLPSPFAMTTRLLVVSSNPYLGDGRGAASLRLLKVMHQNIHPFLGQRWETTMPMLLEYLDEHTEES--------LSLKEWEEKLLMFLRDTLAVVSDNIWICQLSQEMCKQLPSYSGTPQEKNFLYKCIGTTLGAASSKEVVRKHLRELLETARYQEEAEQEGLACCFGICAITHLEDTLAQLEDFVRSDVFRKSTGIFSIFKDR----SEHEVERMKSCLILCYGHVAAQAPRELVLARVESDILRSMFQCFNTKVLGIKVE-TKDPALKLCLVQSLCMVSQAMCSSAQASSFHFLRKTELVTQMMEFIRAEPPDCLRTPIRKKAMLACTYLVNLEPALEEQTQADVVHSCLHSVMALPP---------EAEGGDGVGREPLYLDTVCALEDLLTRLLRQNMTPQGLQIMVEHLSPWIKSPRGHERARALGLGACLLEFFQEHL--LVSTLVPFHNLGLLVGLFAPRCADTWTTTRQKAVGCVYSLLYLQLGYEGFSRDHRDDVAERLL-TLQDGLVNADPTILFHTCHSIAQVIAKRLPSDQLISLLLTVFESLGDPDKNCSRAATVMINCLLKERGNVLLEKVPEIVSVLR---AKLRDTQEEHVLPAAQHSVYLLASQHCEAVVSSLLGSPLPFDSHTCALWRALAVEPGLTAQVLELLLEKMSKDVPFKESRAFLLGSTADRVATLLPLAATCALY-------EVLSAP--SSGTVVL-ELYPQLFAALLLRVSCTVGVQLPRNLQAKERRSTSPARAARNLDPCSSAVDALQALLLRSGSQDMLRCVELERGWELLKTSAGHEDGVAQLASSMAKYAGPRLPPVTKALACTQNSVYEIQRVTSTAFLAE-LLSSNVVNDLMLLEPLLDNLTARLKDSSASVRRLVLRGLANMASGSPDKVRAHGPQLLTAMVSGLDDGDEPHSPVALEAMVGLSRLLDLVEPWDLRLVLLHTTIRIRPFFDSEKVEFRTASIRLFGHLNKACHGDCEDVFLEQVVGGLVPLLLHLRDPQVPVASACKFALCMCVP--------------HLECAELAAAFYKYLQEGRSVHFGEFLNSTCKHLMHHFPDLLGRLVSTNLFYFKSSWDDVRAAAPMFTGFLVLHAEPEQKTQVDLEQLIVALQLLLKDPVPGVREKAAETLGRL 1636          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Mouse
Match: Mroh1 (maestro heat-like repeat family member 1 [Source:MGI Symbol;Acc:MGI:2442558])

HSP 1 Score: 491.5 bits (1264), Expect = 1.417e-149
Identity = 331/1173 (28.22%), Postives = 577/1173 (49.19%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEV 3634
            L+  L++ + D++   +E +  +L SLG  +P   L     +L +    K++  +R  +L +M  +L   ++D+    D    +I     E+T +KE+  +WQ  A  VLV +   + + +M  ++ + QP +LPH  V+H L  ++V+N +DMV +L  I++ ML +LS+AK D  + V   +   F E+ILEY+AN D+APDP V   +F   IF A++V F +WL ++++KLR AV+ A+G M  ++     E  LPKL+  ++  YKKH E++ ++K+L Q+L++A                          +  +S   E++    ++ L  Q C+   +   L        + +Q EV RCFT +    PD+L++  L RL+   E+ ++  L ILRHII+S   Q+  K+  I+S            S        ++ VK  +   I AM    YL + GG  ++E+IV+QCAL  +   K      +L+ +          +R +    L L S+T+  M SVLWPYL+E L PV  T A+  +C S+ +L          ++ +     +F       +I Y+ + N+P P  + +RL+V++  P   + RG   L+ ++++  N H  L   W+  +P L+ YL++               + +WEE LL  +  ++  ++D  W  +  + M +Q+  Y   P+E+ FL+KC+GT L  ++ K  + K L  +  + R+ E  E+ G A  FG+CA  HL+  LA+LE +  ++  +++TG+F +FKD+        +E +++ +IL  G+    A  ELV +R+ES++++ +       KD  +   +V+S+ +V++A+  +    ++ F  + +LV+ ++ +I AE    L   +R  AM     L+ L P +       V++ C+ +V  LPP         E    D      L   T+  L +L+  +L+   +      + + +     S   H R RAL     LL  + + +  + +   P + +G L G   PR AD     RQ  + CV     +QL  E   RD   D +  ++ T+++ L   D  ILF   + I ++I KR+   ++  LL ++FE L D  KN + A  VM N L + R + L E+V
Sbjct:    9 LSFTLLDSITDKDPMVQEQVCSALCSLGDAQPDETLHACEEYLRQHD--KLAHPYRTKILRAMETVLSSHIHDLDK--DTAGAVILLATSEMTRTKELDCDWQQAAGSVLVAVGKRFTNQVMEEVLSRFQPGMLPHSSVLHTLANLSVSNAFDMVPFLPSILSTMLPMLSMAKQDALKVVFCGALQHFSESILEYLANLDQAPDPTVRKDTFGADIFGAYDVLFHHWLQSRDAKLRLAVVAALGPMSHLLPSERLEEQLPKLLPAVLGLYKKHAEAFQISKSLGQILEAA--------------------------VNVSSRTLEVQLDALLVALHAQICVPVESSSPLV-------MNSQKEVLRCFTVLACCSPDRLLAFLLPRLDTSNERLRVGTLQILRHIINSAAAQMEAKQPFILS------------SMRLPLLDTNDKVKRAVVQVISAMAHHGYLEQPGGEVMVEYIVQQCALPAEEPEKPGPDGEDLAAD---------SVRAVSIRTLYLVSTTVDRMNSVLWPYLLEFLTPVRFTAALTPLCRSLVHL---------ALKRQEAGADDF-------LIQYNANANLPSPFAMTTRLLVVSSNPYLGDGRGAASLRLLKVMHQNIHPFLGQRWETTMPMLLEYLDEHTEES--------LSLKEWEEKLLMFLRDTLAVVSDNIWICQLSQEMCKQLPSYSGTPQEKNFLYKCIGTTLGAASSKEVVRKHLRELLETARYQEEAEQEGLACCFGICAITHLEDTLAQLEDFVRSDVFRKSTGIFSIFKDR----SEHEVERMKSCLILCYGHVAAQAPRELVLARVESDILRSMFQCFN-TKDPALKLCLVQSLCMVSQAMCSSAQASSFHFLRKTELVTQMMEFIRAEPPDCLRTPIRKKAMLACTYLVNLEPALEEQTQADVVHSCLHSVMALPP---------EAEGGDGVGREPLYLDTVCALEDLLTRLLRQNMTPQGLQIMVEHLSPWIKSPRGHERARALGLGACLLEFFQEHL--LVSTLVPFHNLGLLVGLFAPRCADTWTTTRQKAVGCVYSLLYLQLGYEGFSRDHRDDVAERLL-TLQDGLVNADPTILFHTCHSIAQVIAKRLPSDQLISLLLTVFESLGDPDKNCSRAATVMINCLLKERGNVLLEKV 1082          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Mouse
Match: Mroh1 (maestro heat-like repeat family member 1 [Source:MGI Symbol;Acc:MGI:2442558])

HSP 1 Score: 491.5 bits (1264), Expect = 1.417e-149
Identity = 331/1173 (28.22%), Postives = 577/1173 (49.19%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEV 3634
            L+  L++ + D++   +E +  +L SLG  +P   L     +L +    K++  +R  +L +M  +L   ++D+    D    +I     E+T +KE+  +WQ  A  VLV +   + + +M  ++ + QP +LPH  V+H L  ++V+N +DMV +L  I++ ML +LS+AK D  + V   +   F E+ILEY+AN D+APDP V   +F   IF A++V F +WL ++++KLR AV+ A+G M  ++     E  LPKL+  ++  YKKH E++ ++K+L Q+L++A                          +  +S   E++    ++ L  Q C+   +   L        + +Q EV RCFT +    PD+L++  L RL+   E+ ++  L ILRHII+S   Q+  K+  I+S            S        ++ VK  +   I AM    YL + GG  ++E+IV+QCAL  +   K      +L+ +          +R +    L L S+T+  M SVLWPYL+E L PV  T A+  +C S+ +L          ++ +     +F       +I Y+ + N+P P  + +RL+V++  P   + RG   L+ ++++  N H  L   W+  +P L+ YL++               + +WEE LL  +  ++  ++D  W  +  + M +Q+  Y   P+E+ FL+KC+GT L  ++ K  + K L  +  + R+ E  E+ G A  FG+CA  HL+  LA+LE +  ++  +++TG+F +FKD+        +E +++ +IL  G+    A  ELV +R+ES++++ +       KD  +   +V+S+ +V++A+  +    ++ F  + +LV+ ++ +I AE    L   +R  AM     L+ L P +       V++ C+ +V  LPP         E    D      L   T+  L +L+  +L+   +      + + +     S   H R RAL     LL  + + +  + +   P + +G L G   PR AD     RQ  + CV     +QL  E   RD   D +  ++ T+++ L   D  ILF   + I ++I KR+   ++  LL ++FE L D  KN + A  VM N L + R + L E+V
Sbjct:    9 LSFTLLDSITDKDPMVQEQVCSALCSLGDAQPDETLHACEEYLRQHD--KLAHPYRTKILRAMETVLSSHIHDLDK--DTAGAVILLATSEMTRTKELDCDWQQAAGSVLVAVGKRFTNQVMEEVLSRFQPGMLPHSSVLHTLANLSVSNAFDMVPFLPSILSTMLPMLSMAKQDALKVVFCGALQHFSESILEYLANLDQAPDPTVRKDTFGADIFGAYDVLFHHWLQSRDAKLRLAVVAALGPMSHLLPSERLEEQLPKLLPAVLGLYKKHAEAFQISKSLGQILEAA--------------------------VNVSSRTLEVQLDALLVALHAQICVPVESSSPLV-------MNSQKEVLRCFTVLACCSPDRLLAFLLPRLDTSNERLRVGTLQILRHIINSAAAQMEAKQPFILS------------SMRLPLLDTNDKVKRAVVQVISAMAHHGYLEQPGGEVMVEYIVQQCALPAEEPEKPGPDGEDLAAD---------SVRAVSIRTLYLVSTTVDRMNSVLWPYLLEFLTPVRFTAALTPLCRSLVHL---------ALKRQEAGADDF-------LIQYNANANLPSPFAMTTRLLVVSSNPYLGDGRGAASLRLLKVMHQNIHPFLGQRWETTMPMLLEYLDEHTEES--------LSLKEWEEKLLMFLRDTLAVVSDNIWICQLSQEMCKQLPSYSGTPQEKNFLYKCIGTTLGAASSKEVVRKHLRELLETARYQEEAEQEGLACCFGICAITHLEDTLAQLEDFVRSDVFRKSTGIFSIFKDR----SEHEVERMKSCLILCYGHVAAQAPRELVLARVESDILRSMFQCFN-TKDPALKLCLVQSLCMVSQAMCSSAQASSFHFLRKTELVTQMMEFIRAEPPDCLRTPIRKKAMLACTYLVNLEPALEEQTQADVVHSCLHSVMALPP---------EAEGGDGVGREPLYLDTVCALEDLLTRLLRQNMTPQGLQIMVEHLSPWIKSPRGHERARALGLGACLLEFFQEHL--LVSTLVPFHNLGLLVGLFAPRCADTWTTTRQKAVGCVYSLLYLQLGYEGFSRDHRDDVAERLL-TLQDGLVNADPTILFHTCHSIAQVIAKRLPSDQLISLLLTVFESLGDPDKNCSRAATVMINCLLKERGNVLLEKV 1082          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Mouse
Match: Mroh2a (maestro heat-like repeat family member 2A [Source:MGI Symbol;Acc:MGI:3705228])

HSP 1 Score: 275.018 bits (702), Expect = 5.877e-74
Identity = 364/1732 (21.02%), Postives = 742/1732 (42.84%), Query Frame = 2
Query:  182 MQQSLISLGIKE-----PKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKV-YDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMV-FIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLE-GPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCA--NEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI-KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNC--IGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE---MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFE--GLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISL-LKDNP--RMGVLRALKILSSQYLIECLNTAMAQTLPLD----EVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVW-LAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSG---LEANLAIGIRPIT-------ICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQH--RILVTGFYGSTIIG--IASAXXXXXXXXXXXXXXSRL-------------GDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENL 5215
            M+++L S+ I E     P ++++ ++  L   +  +IS   ++++   M  I++Q+   + H    L++   KQ+ D +T +++   E    A++ LV +S ++  L+M  L   L+P  L   FVI  L  +A  N ++ + Y+   +  + T+L LA     R VI ++   FCE +  Y+ + + +  P +T   F+  +F  +  F T WL  ++ +++  V+ ++  M+  ++  ++    +   I  ++ +++   E+  VT+ L Q+L+++           T +   P     P+  E                L +Q C  A A      QQ+ +S +N  E+  CF  +   YP +L+     ++E   E  ++  L ++R ++S+ D +        I+    Y    +  ++ S T    + V+M +   I  +    +  ++ G  L +++  Q  LST  +  N++  F   D      +    +  +  + +K+ +S+I+ M +  W  L+  ++  + T+A+  IC S+ NL             ENQ        D E  I     HV++P PQ L++RL+VL   P     RGI +L  ++ L  +   ++  +W+  IP L+ Y        LE   +  ++   WE++L++ +  S++      W++   + +  QI  +D    E+GFL++ LG  L    +   ++  L  + + T +S + +R G  + FGLCA   + TVL  L+ +     E++++  +    KD  HP      E +++++++       Y  P+++ + ++S +  K++ +     +D  +    ++S+  V  A+   +   +++F  ++ L   ++  I+AE    L + +R +AM  +  L  + P  +  E   +++I I  V +L P G           +D  +   L   TM++L +L++ +L+         +   ++    +SE E  RE+A++    L+  Y   I        PL     G L G + P   D +   R  +I+ ++    + +       G   E +     +   KE L+  D N + +A + + K++C   N  ++  L+Q L E  G  D Q + A+   +   +  + R  +L ++VA IL  +  ++ L + D+P  R  ++  + +L+  +    L + + Q LP++    EVW  +  N+     +L   L  L    +  I    + D                   +W LAA++ L  LC+ +L    +     +  LF  ++      +      G S+  ++    L+    +   P+        I  ++++  +       + + +  Q+ W  LEN   F+  ++L+AR +C+  +                NY Q    +++TG  GS I+   I+S  +         L   +L              DK   ++ LSL  +GN+   +   V+++   LL   L  +  +       +   M+ L  ++ +L E DI      +  +  + ++ +S  +R  AF LFG L ++      + F  E+    V LL+H +DP   V +AC   + Q +  +    +  S   +       ND I     E +T+    F  +   + A +    +   ++ + V+ K++   +  ++  L G +M+ L
Sbjct:   55 MRKTLASVIITEKATTDPCVVMNALIRCL---QMPEISTQRKMNIYNIMQEIIQQEGEMEEHCIQRLVAIASKQMRD-ITEAEDF--ETAEVASETLVALSRNHFSLVMYELQHHLKPLNLTDEFVIVTLAKLANGNVFEFMPYMGITLATIFTMLRLANEAKMRQVICSAMETFCETVQFYLRHLEDSLYPVMTEDQFAVKLFPMYRYFVTVWLRHQDLEVKLGVIKSLRPMLSLLLPNDDLREQVYDYIPLLLAEFQGGLEALFVTQVLRQILEASV----------TTNTPIPPMLLHPIFTE----------------LHVQVCSKAPA------QQQFSS-QNLMEIVHCFIALARSYPKELMKFFFSQVEMSKEAVRVGTLALIRAVVSADDPK--------INIKTIYLAIRVVKNTLSDT---RSKVRMAILRIIGQLVLSGFQEKIKGWGL-KYVSVQLTLST-YKLTNRRECFYQRD------LEEKMVHKVTMDTVKIITSSISGMTNEFWVRLLCYIMETDYTEALTPICISLTNL------------AENQ----IHGKDTEAGIAGKSKHVDLPAPQKLLARLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWEQEIPLLVQY--------LEEHTEFTWNQKTWEDMLIQFLRNSLKKTRGTSWSLRLSKELNNQIETFDSPSLEKGFLYRALGFTLGMGLEADRVEVLLLELLYKTDYSNDFDREGVILCFGLCARGQVKTVLNVLQDFEERIQESEQSWQIGAWRKD--HPWRR---ETVKSALMVMYSCVSSYCHPQMLLTHVDSPITSKIIHHYSSSCQDISLKMAFMKSVVQVTNAIKSIQDPEDFQFAHKSALTGLIVVIIKAEPPDHLVSPVRSMAMDALSQLSTMKPFYSPEESTELMDISIHTVISLQPPG-----------EDNESVKTLYANTMSSLKQLMEGLLQRQLDPKGLQDTVHLLEKWILSEKEWEREKAMALHLHLMQIYVQSIGVC----IPLKLGQFGVLVGLIAPCTCDAHRRTRLASINVLSSLLDLHVSQTCSLWGTSKEQE-----LQKCKEDLQDTDMNKISSASSRVAKVVCPEFNCDEVVSLIQKLCENIGAMDLQHDRAAVTWI--GIFLQMRVKELEDKVAEILGAI--LVHLPVVDHPEVRRHLIEGILLLAHYHQETVLTSLLRQPLPMESHLTEVWLAVAENVPFARTMLHGLLGRLQSRFTAKINATSKAD-------------------IWRLAAVDPLMTLCTIQLLMEKMDQDDKFPDLFPDLLYTFLLQL------GSSHGPEAASPVLKTWRLVHTGPLPQEMTLQRITIKSMQLLVKRINREPLEQALEEQSVWSLLENGGTFLEGVSLMAR-LCMQNM---------------ENYMQRLAELVLTGM-GSEILSCCISSTAICVEFMSDPVLHQEKLLRPVVLMLEKGAGQDKDETLQVLSLRALGNMALGAPRKVKQYRKLLLEKCLGSLQGQ--VSSSAMAEGMEALTKVLAELREGDIGSSFEAISKQCRAFFDNESELLRLKAFVLFGKLTKVVGISKKHFFKGEVKRGWVSLLLHCQDPCPSVAQACVATMFQCVHFWGWKSLESSFGHS-------NDSI----NEQMTV----FQTNMCSVLAQKKPAVLCGFLLETTVFMKNNLSRIRIAACNLAGIIMKQL 1616          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Mouse
Match: Mroh2a (maestro heat-like repeat family member 2A [Source:MGI Symbol;Acc:MGI:3705228])

HSP 1 Score: 265.774 bits (678), Expect = 4.305e-71
Identity = 366/1735 (21.10%), Postives = 742/1735 (42.77%), Query Frame = 2
Query:  182 MQQSLISLGIKE-----PKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKV-YDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMV-FIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLE-GPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCA--NEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI-KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNC--IGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE---MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFE--GLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISL-LKDNP--RMGVLRALKILSSQYLIECLNTAMAQTLPLD----EVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVW-LAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAI---GIRPITICCETLKNFLTTTQSHEII----------EEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQH--RILVTGFYGSTIIG--IASAXXXXXXXXXXXXXXSRL-------------GDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENL 5215
            M+++L S+ I E     P ++++ ++  L   +  +IS   ++++   M  I++Q+   + H    L++   KQ+ D +T +++   E    A++ LV +S ++  L+M  L   L+P  L   FVI  L  +A  N ++ + Y+   +  + T+L LA     R VI ++   FCE +  Y+ + + +  P +T   F+  +F  +  F T WL  ++ +++  V+ ++  M+  ++  ++    +   I  ++ +++  T  + +  +L QVL+    Q +++S   T +   P     P+  E                L +Q C  A A      QQ+ +S +N  E+  CF  +   YP +L+     ++E   E  ++  L ++R ++S+ D +        I+    Y    +  ++ S T    + V+M +   I  +    +  ++ G  L +++  Q  LST  +  N++  F   D      +    +  +  + +K+ +S+I+ M +  W  L+  ++  + T+A+  IC S+ NL             ENQ        D E  I     HV++P PQ L++RL+VL   P     RGI +L  ++ L  +   ++  +W+  IP L+ YLE+             ++   WE++L++ +  S++      W++   + +  QI  +D    E+GFL++ LG  L    +   ++  L  + + T +S + +R G  + FGLCA   + TVL  L+ +     E++++  +    KD  HP      E +++++++       Y  P+++ + ++S +  K++ +     +D  +    ++S+  V  A+   +   +++F  ++ L   ++  I+AE    L + +R +AM  +  L  + P  +  E   +++I I  V +L P G           +D  +   L   TM++L +L++ +L+         +   ++    +SE E  RE+A++    L+  Y   I        PL     G L G + P   D +   R  +I+ ++    + +       G   E +     +   KE L+  D N + +A + + K++C   N  ++  L+Q L E  G  D Q + A+   +   +  + R  +L ++VA IL  +  ++ L + D+P  R  ++  + +L+  +    L + + Q LP++    EVW  +  N+     +L   L  L    +  I    + D                   +W LAA++ L  LC+ +L    +     +  LF  ++      +     +    E  S +     +   G  P  +  +       T +S +++          + +  Q+ W  LEN   F+  ++L+AR +C+  +                NY Q    +++TG  GS I+   I+S  +         L   +L              DK   ++ LSL  +GN+   +   V+++   LL   L  +  +       +   M+ L  ++ +L E DI      +  +  + ++ +S  +R  AF LFG L ++      + F  E+    V LL+H +DP   V +AC   + Q +  +    +  S   +       ND I     E +T+    F  +   + A +    +   ++ + V+ K++   +  ++  L G +M+ L
Sbjct:   55 MRKTLASVIITEKATTDPCVVMNALIRCL---QMPEISTQRKMNIYNIMQEIIQQEGEMEEHCIQRLVAIASKQMRD-ITEAEDF--ETAEVASETLVALSRNHFSLVMYELQHHLKPLNLTDEFVIVTLAKLANGNVFEFMPYMGITLATIFTMLRLANEAKMRQVICSAMETFCETVQFYLRHLEDSLYPVMTEDQFAVKLFPMYRYFVTVWLRHQDLEVKLGVIKSLRPMLSLLLPNDDLREQVYDYIPLLLAEFQG-TGHWPLFPSLLQVLR----QILEASV--TTNTPIPPMLLHPIFTE----------------LHVQVCSKAPA------QQQFSS-QNLMEIVHCFIALARSYPKELMKFFFSQVEMSKEAVRVGTLALIRAVVSADDPK--------INIKTIYLAIRVVKNTLSDT---RSKVRMAILRIIGQLVLSGFQEKIKGWGL-KYVSVQLTLST-YKLTNRRECFYQRD------LEEKMVHKVTMDTVKIITSSISGMTNEFWVRLLCYIMETDYTEALTPICISLTNL------------AENQ----IHGKDTEAGIAGKSKHVDLPAPQKLLARLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWEQEIPLLVQYLEEHTEFT--------WNQKTWEDMLIQFLRNSLKKTRGTSWSLRLSKELNNQIETFDSPSLEKGFLYRALGFTLGMGLEADRVEVLLLELLYKTDYSNDFDREGVILCFGLCARGQVKTVLNVLQDFEERIQESEQSWQIGAWRKD--HPWRR---ETVKSALMVMYSCVSSYCHPQMLLTHVDSPITSKIIHHYSSSCQDISLKMAFMKSVVQVTNAIKSIQDPEDFQFAHKSALTGLIVVIIKAEPPDHLVSPVRSMAMDALSQLSTMKPFYSPEESTELMDISIHTVISLQPPG-----------EDNESVKTLYANTMSSLKQLMEGLLQRQLDPKGLQDTVHLLEKWILSEKEWEREKAMALHLHLMQIYVQSIGVC----IPLKLGQFGVLVGLIAPCTCDAHRRTRLASINVLSSLLDLHVSQTCSLWGTSKEQE-----LQKCKEDLQDTDMNKISSASSRVAKVVCPEFNCDEVVSLIQKLCENIGAMDLQHDRAAVTWI--GIFLQMRVKELEDKVAEILGAI--LVHLPVVDHPEVRRHLIEGILLLAHYHQETVLTSLLRQPLPMESHLTEVWLAVAENVPFARTMLHGLLGRLQSRFTAKINATSKAD-------------------IWRLAAVDPLMTLCTIQLLMEKMDQDDKFPDLFPDLLYTFLLQLG----SSHGPEAASPVLKTWRLVHTGPLPQEMTLQRCSRSRITIKSMQLLVKRINREPLEQALEEQSVWSLLENGGTFLEGVSLMAR-LCMQNM---------------ENYMQRLAELVLTGM-GSEILSCCISSTAICVEFMSDPVLHQEKLLRPVVLMLEKGAGQDKDETLQVLSLRALGNMALGAPRKVKQYRKLLLEKCLGSLQGQ--VSSSAMAEGMEALTKVLAELREGDIGSSFEAISKQCRAFFDNESELLRLKAFVLFGKLTKVVGISKKHFFKGEVKRGWVSLLLHCQDPCPSVAQACVATMFQCVHFWGWKSLESSFGHS-------NDSI----NEQMTV----FQTNMCSVLAQKKPAVLCGFLLETTVFMKNNLSRIRIAACNLAGIIMKQL 1624          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. UniProt/SwissProt
Match: sp|Q8NDA8|MROH1_HUMAN (Maestro heat-like repeat-containing protein family member 1 OS=Homo sapiens OX=9606 GN=MROH1 PE=2 SV=3)

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 480/1755 (27.35%), Postives = 858/1755 (48.89%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI---------KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALK----ILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEERED--LSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNC-LPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLL 5332
            LA  L++ + D++   +E +  +L SLG   P   L     +L +    K++  +R ++L +M  +L  +  ++    D  S II     E+T +K+++ +WQ  A+ VLV +   +   +M  L+ +L P  LPH  V+H L +++V N + +V +L  +++ +L +L +AK D  R    ++  +F E  LEY+AN DRAPDP V   +F+  IFSA++V F  WL ++E+KLR AV++A+G M  ++     E  LPKL+ GI+  YKKH E+++++K+L Q+L++A                          +   S   E +    +  L  Q C+   +   L        + NQ EV RCFT +    PD+L++  L RL+   E+ ++  L ++RH+I+S   Q+  K+  I+S            S        ++ VK  +   I AM    YL + GG  +IE+IV+QCAL  + E   +K      D   + V      R +    L L S+T+  M  VLWPYL++ L PV  T A+  +C S+ +L             + + E+  ++     +I YD H ++P P  +  RL+V++  P   + RG   L+ + +L  N H  L   W+  +P L+ YL++     L  +        +WEE LL  +  ++  I+D  W  +    + +Q+  YD+ P+E+ FL+KC+GT L  ++ K  + K L  +  + R+ E  ER G A  FG+CA +HL+  LA+LE +  +E  +++ G+  +FKD+      + +E +++++IL  G+    A  ELV +++ES+++         KVL   ++  KD  +   +V+S+ +V+RA+  +    ++ F  + +LV+ ++ +I AE   +L   +R  AM T   L+ + P +       V++ C+ ++  L P+       KE   +D      L  +T++ L +L+ ++L+   +      + + +     S   H R RAL    +LL  + + +    +   P + +G L G   PR AD     RQ  +DCV     +QL  E   RD   D +  ++ ++K+ L   D  ILF   + + ++I KR+ P ++  LL ++FE L D +KN + A  VM N L + R   L E+V  I++ L    S L++     VL A +    +L++Q+    +++ +   LPLD     +   +A +  +  + L  L+E  SR +PF+E     L +   +  ++  +  +C ++       +++ +   + G   L ++Y +LF  +++  S ++   LP   ++ E++    A     + P +   +TL++ L  + S ++++ ++++ GW+ L            LAR++  +    +  ++  L+   +S YE  R+  T F  + ++    AN   L+D ++  L +R  D C  VRRL L G+ N+       V+ H   LL+A++ G+DD  +    +   AM GLA L+  +   D+R  L+ V +R+   ++ +    R ++ RLFG L ++  G   + FL ++   + PLL+HL+DP   V  AC+ AL+   P              +L   +L+   +  L+E   LHFGEF N   K       D +  ++   L YFKS +  + A++ L  G L+ + + ++   +   Q+   L  LLK    +VR R AEA+  L
Sbjct:    9 LASTLLDAITDKDPLVQEQVCSALCSLGEARPVETLRACEEYLRQHD--KLAHPYRAAVLRAMERVLSSRASELDK--DTASTIILLASSEMTKTKDLVWDWQQAASGVLVAVGRQFISKVMEELLRRLHPGTLPHCAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDTVRVAFCSALQRFSEGALEYLANLDRAPDPTVRKDAFATDIFSAYDVLFHQWLQSREAKLRLAVVEALGPMSHLLPSERLEEQLPKLLPGILALYKKHAETFYLSKSLGQILEAA--------------------------VSVGSRTLETQLDALLAALHSQICVPVESSSPLV-------MSNQKEVLRCFTVLACSSPDRLLAFLLPRLDTSNERTRVGTLQVVRHVINSAAAQMEDKKPFILS------------SMRLPLLDTNSKVKRAVVQVISAMAHHGYLEQPGGEAMIEYIVQQCALPPEQE--PEKPGPGSKDPKADSV------RAISVRTLYLVSTTVDRMSHVLWPYLLQFLTPVRFTGALTPLCRSLVHL------------AQKRQEAGADAF----LIQYDAHASLPSPYAVTGRLLVVSSSPYLGDGRGAAALRLLSVLHPNIHPLLGQHWETTVPLLLGYLDEHTEETLPQE--------EWEEKLLMFLRDTLAIISDNAWICQLSLELCRQLPCYDEAPQEKNFLYKCIGTTLGAASSKEVVRKHLQELLETARYQEEAEREGLACCFGICAISHLEDTLAQLEDFVRSEVFRKSIGILNIFKDR----SENEVEKVKSALILCYGHVAARAPRELVLAKVESDILRNICQHFSTKVLGIKVE-TKDPALKLCLVQSVCMVSRAICSSTQAGSFHFTRKAELVAQMMEFIRAEPPDSLRTPIRKKAMLTCTYLVSVEPALDEQARADVIHGCLHSIMALLPE------PKE---EDGGCQKSLYLETLHALEDLLTSLLQRNMTPQGLQIMIEHLSPWIKSPRGHERARALGLSALLLRYFLEHLR--VSALVPFHNLGLLIGLFSPRCADLWPATRQEAVDCVYSLLYLQLGYEGFSRDYRDDVAERLL-SLKDGLVHPDPAILFHTCHSVGQIIAKRLPPDQLISLLLTMFEALGDPEKNCSRAATVMINCLLQERGGVLQEKVPEIVSVLR---SKLQEAQGEHVLPAAQHSVYLLATQHCAAVVSSLLGSPLPLDSHTCMLWRALAVEPRLAAQVLGLLLEKMSRDVPFKESRAFLLGRTPDRVATLLPLSATCALF-------EVMSTP--AAGPAVL-ELYPQLFVVLLLRVSCTVGVQLPRNLQAQERRGASPALATRNLEPCSSAVDTLRSMLLRSGSEDVVQRMDLEGGWELLRTSAGHEEGATRLARAMAEHAGPRLPLVLKTLACTHSSAYENQRVTTTAFL-AELLNSNVANDLMLLDSLLESLAARQKDTCASVRRLVLRGLANLASGCPDKVRTHGPQLLTAMIGGLDDGDNPHSPVALEAMLGLARLVHLVESWDLRSGLLHVAIRIRPFFDSEKMEFRTASIRLFGHLNKVCHGDCEDVFLDQVVGGLAPLLLHLQDPQATVASACRFALRMCGP--------------NLACEELSAAFQKHLQEGRALHFGEFLNTTCKHLMHHFPDLLGRLLTTCLFYFKSSWENVRAAAPLFTGFLVLHSEPRQQPQVDLDQLIAALQILLKDPAPEVRTRAAEALGRL 1637          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. UniProt/SwissProt
Match: sp|Q54F23|MROH1_DICDI (Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1)

HSP 1 Score: 579.711 bits (1493), Expect = 1.140e-175
Identity = 484/1767 (27.39%), Postives = 855/1767 (48.39%), Query Frame = 2
Query:  116 LDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLIS-KIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGPE-KQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKN-------KKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQ-RVLNICIDNVFN--LPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSY--YDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMG----RDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVA----SILTKLHDIISLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHE-IIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQE--KEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 5341
            LD +  +L++ + D +E  R  +  SL  +G ++P  +L +   ++NK++  KI   HRV +L S+  IL+Q     +   D +S  +I   I E+T  KE++P+WQ  A+ +LV++   Y   IM  L+ + +P  LPHYFV+  LG    +NP   V  +  I++++L +L   K DNF+WV A +   F +AI++YVAN D APD ++T+ SFS   + A E+ F+ WL T   K+R   ++A+G++  I+     E  + KL+ G++   KK  +   VT +L  +L+      +    +    P    T   PL+                       C+       +       S +  NEV RCF  I   Y D LIS   +RLE  + + +  +L I+RHI++  D +L  K+  I+S ++          +  S F     +K  L+  IIAM    YL   GGL L+EFIV+  +    +E          KK++   + +LH   +T+++LR +C+N+L L ++T+  + S+LWPYL E ++P + T A+  +  S+  +          +  ++ D  ++        ID+D  +N+P P  +++R  VL   P   N  GI IL+ M+ +    H ++  +WD+ +PKLI YLE   + E        ++  QWEEL+L+L++++I++  D++WTV  G +M +QI  Y K P  +  L+K +G I+   + K F+  +++++F S  ++ + E  G A+G G C A+H D VL K+  Y  N   + +G FG    K  P    N       I+L+ G +  YA+  L  SR+E +VI+ ++ +I   K        ++ IDL+ +A++ NK    + F+ R++L+  L+SY+     +T  N ++         L+ L P I+ LEL+ +++N+ + + FN  + P       S E  + + ++        + ++N L+ TIL    +      +   +     S+  HIRER+L  +  L+  +  Y   ++     K  + IGT    LIPR  DP IN R+  ++ + +   I   L+      R  +    L+ + +I++ +   + N  F+ V +I+ +I K I+  +I   L+   +GL+D Q    +   ++ N L +TR  +L E V      +LT +  I S    N   G L +L+ L++ +LI  L+  +   +P      +    IA D+ ++   L+HLM++ +    +EE+ D   K       + I     + LAA   L  +   +L+     +   Y +L +++++   +  N LP   +        +A+ AI + P      T + F   T+  E ++ EI  +  + +LE        + +L+  +  +    I  I   L  +  SN+ +HRI+       T   I       LI  +I  LL+ L D    V+ +SL G+ N+         R+A +++ AL   +DD+   D+ +    M GL+ +     E  +  ILV +C R+   +E+ + ++RA++F+LFGSL R  +G + + F  +I+S +  L++HL D    V  +CK  L Q+  L        S ++   + NK   F+     ++   ++ EF  DFSK+  +   ++VN  +M  + +FKS +  L  ++   IG ++ NL E  +  T++    +   L+ LL  K+  VR + AE++ LLH Y
Sbjct:   12 LDNIVTSLLQSLSDSDESVRSTVVNSLYEIGFRQPNFVLQVACDYINKNQ--KIDQTHRVKILNSILQILEQTR---NQLTDALSLNLIAMSISEMTRDKEVVPDWQQVASSLLVSLGLRYPSQIMDELLKRFEPGTLPHYFVMKTLGDFISSNPIPTVPKIREILSRILPVLGTIKHDNFKWVFAAALGHFADAIVQYVANIDTAPDKSLTLYSFSSEFYPALELMFSKWLGTNHEKVRLVTIEAVGSICSILSVEQLESQIQKLVVGVLSMLKKEKDLLPVTHSLCCILEVCVKNDLKLQVNELLIPI--MTTLHPLV-----------------------CI-------VPDYSNPASTKTYNEVLRCFEVIGRGYSDVLISFLNQRLENRDLRSRAGSLSIIRHIVTRLDVELADKKPLILSAIKPLI------QTEPSLF-----IKKYLAQIIIAMAPYGYLEMEGGLTLLEFIVKGSSWYQDSEIGKAQPTQPPKKIE---NPDLH---VTDSELRLICDNILNLITTTMPQLESILWPYLFEFILPEQYTAAIPVVTKSLTYI---------ALSKKSVDSDDY-------YIDFDKEINLPKPTQIIARYFVLLTAPLRRNQLGIRILENMKAIGPILHPSICDMWDVTLPKLISYLEDHTDIET-------WNKNQWEELVLRLLSETIKNAADDEWTVALGNSMSEQIDHYKKDPILKRSLYKQMGLIMQKCSHKEFVKSKIEVMFTSVDYTNSLENEGCAIGLGYCGASHFDIVLEKINFYIKNSMVKKSGFFG----KKGPKGIKN------CILLSLGYSATYAQSALFSSRVEVHVIQPIKPSILQLKKVPKKLSSIKMIDLIGKALHPNK-ASTFIFKQRDELMKLLISYMSTPPPST-NNQVKIDGTNACSTLVNLEPMIS-LELEVQIINLSL-SFFNQQVSPANATNTDSDE--YKEVNSL-------ITSVNNLLSTILYNQTTIACLNRLIGYLDPLSRSKDAHIRERSLFCILYLVKKFIEYSTDSDSMPTDKLFDSIGTTLSVLIPRCTDPEINVRRYAVESIQLILYIGFMLKNATPDNRRVKPSEVLHPLTSIRDSITTTEVNEQFSLVFEISVIISKMISLEEIPKFLEGSIKGLQDLQAFSTNGSCIIINGLIKTRGEELIEYVPILVKGLLTAMEGITSETTMN---GTLVSLRSLANHHLIPVLSVLLEYPMPHSVHVIKSFQIIAKDKNLISPTLIHLMDLLNNKPVYEEKPDPKNKN------RIIPQPFAIALAATCSLGEIF--QLTEVEEVVKYFYHQLISTLVLRAGTCNNSLPCLIEVASTNPKAKAS-AISLIPSQQMLVTFRQFFKCTKEEETLLAEIESKGSFSQLETPFYHQGIIEILS-VVSSHHPDLIQGIFQYLLPYQRSNHLEHRIVTISV---TTELINHCKDKELIQRLINTLLNSLVDPL--VKLISLKGLSNIVSAGVEQTNRYAPTVIDALSTSIDDQ---DETMAMECMLGLSKIFEVADEGRVAPILVNICNRIRPAFEKPNDSIRAASFQLFGSLWRFGSGSACDPFYEQIHSSLPSLIMHLNDDVQSVKNSCKKTLFQLSTLMR------SQDAMDYFNNKSKGFV----GDNDQPNYEEFLLDFSKLLIINYPERVNYFVMTVIEFFKSTWVNLRGNAATFIGFILGNLTEDKRTQTNINSTILTKSLVGLLAEKSPAVRKKAAESLGLLHHY 1647          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. UniProt/SwissProt
Match: sp|A7E2Y6|MROH1_BOVIN (Maestro heat-like repeat-containing protein family member 1 OS=Bos taurus OX=9913 GN=MROH1 PE=2 SV=1)

HSP 1 Score: 561.992 bits (1447), Expect = 3.700e-169
Identity = 447/1723 (25.94%), Postives = 820/1723 (47.59%), Query Frame = 2
Query:  125 LAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI---------KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNL---PPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLK-LEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALK----ILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEERED--LSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTG-KSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKE 5227
            L+  L++ V D++ + +E +  +L   G  +P  +LS     L   +  K++  +R  +L +M  ++   + ++    D    II    +E+T  KE++ +WQ  A+ VLV +   +   +M  L+ K QP +LPH   +H L +++V+N + +V +L+ I++ ML +L  AK D+ + V   +  +F E+ILEY+AN D+APDP V   +F+  IF A+++ F  WL +  +KLR AV++A+G M  ++     E  LPKL+  ++  YKKHTE+ HV+K+L Q+L++A                  +     L I   SL            L  Q C+   +   L        + NQ EV RCFT +    PD+L++  L +L+   E+ ++  L +LRH+I++   Q+  K+  I+S            S        +N VK  +   + AM    YL + GG  ++E+IV+QCAL  + E +  KL  +      ++ +    +R +  + L L S+T+  M  VLWPYL+E LVP+  T A+  +C S+ +L             + + E+   +     +I Y+ +V++P P  + +RL+ ++  P   + RG   L+ + +L  + H  L   W   IP L+ +L++ +   L           +WEE LL  +  S+  ++D  W       M +Q+  Y+  P E+ FL+KC+GT L  ++ K  + K L  +  + R+ E  E  G A  FG+CA +HLD  LA+L+ +  ++  +++ G+F LFK++      S    +R+++IL  G+    A  EL+ +R+E+++          KVL   ++  +D  +   +V+S+ +  +A+  +    ++    + +LV+ ++ +I AE   +L   +   AM     L+ L P +       +++ C+  V  +   P +G   ++    P         L   T+  L +L+ ++L    + L    + + +     S   H R RA+     LL  +   +    +   P + +G L G   PR AD     R+  + C+     +QL  +   RD + D +  ++ ++K+ L   D  ILF   + I ++I KR+ P  + +LL +LFE L D  KN + A  VM N L + R + L E+V  I++ L    S L++     +L+A +     L++ +    ++  +   LP D     +   +A +  +  + L  L+E  S+ + FEE +   LS    +  ++        + LAA   L  + S   S   +   ++Y +LF ++++  S ++   P    ++ E++S      +  + P +   + L+  L    + ++++ + +  GW  L         +  LA ++       +  ++  L    +S YE  R+  T F  + ++     N   L++ ++  L++R  D    VRRL L G+ N+   S   VQ H+  LL+A++ G+DD  D    +   AM GLA L+  +   D+  +L+ + +R+   ++ +   +R+ +  LFG L +   G   + FL ++   +VPLL+HL DP   V+ AC+ AL+   P              +L   +L    +  L+E   LHFGEF N   K       D +  ++  SL Y+KS + ++ A++ +L G L+ +++ ++
Sbjct:    9 LSAILLDAVTDKDPQMQEQVCGALCDFGESKPAEVLSACEEHLRLHE--KLAHPYRTIILRAMEIVVSNHISELDK--DTARAIILLASNEMTKVKELVSDWQQAASSVLVAVGRRFISSVMEELLSKFQPGLLPHPCTVHTLASLSVSNVFGVVPFLTSILSTMLPMLGAAKHDSMKVVFCCALQRFSESILEYLANLDQAPDPTVRKDAFASDIFGAYDILFHQWLQSGGAKLRLAVVEALGPMSHLLPSEKLEEQLPKLLPRVLAFYKKHTETVHVSKSLGQILEAAV-----------------SVGSRTLDIHLNSLLAA---------LHAQICVPVESSSPLV-------MSNQKEVLRCFTVLACCSPDRLLAFLLPKLDTSNERTRVGTLQVLRHVINAAAAQMEVKKPVILS------------SMKLPLLDTNNKVKRAVVQVVSAMAHHGYLEQPGGKAMVEYIVQQCALPPEAEIQ--KLGAD------SEALAADSVRAISVSTLYLVSTTVDRMGEVLWPYLLEFLVPIRFTRALSPLCRSLVHL------------AQKRQEAGAHAP----LIQYNGNVHLPSPYAITTRLLAVSSHPYVGDGRGAASLRLLNVLHQDIHPALGQRWVTAIPLLLEHLDEYSEETLSQK--------EWEEKLLVFLRDSLAVVSDNTWVCHLTLEMCKQLPNYNGTPLEKNFLYKCVGTTLGAASSKV-VRKHLRELLETARYQEEREHEGLACCFGICAISHLDDTLAQLDDFVKSDVLRKSAGIFNLFKNR----SESEANKVRSALILCYGHVAAGAPRELLLARVEADLFWNMSECFSTKVLGIKVE-TQDPALRLSLVQSVCMATQAICSSAHSSSFHLSRKAELVAQMVEFIRAEPPDSLKTPIWKKAMLACTYLVTLEPALEEQVQADLIHSCLHRVMAVLPEPEEGDSPQEVSAAPTVGGDPQESLYLDTVQVLKDLLTSLLLWNMTPLGLQVMLEHLSPWIKSPRGHERVRAVGLSACLLQFFLQHLQ--ISALVPFHNLGLLIGLFSPRCADLWPATRREAVSCIHSLLYLQLTCVGFSRDYQDDVAEQLL-SLKDGLVHPDPAILFHTCHSIAQLIAKRLPPDHLINLLLTLFESLGDPDKNCSRAASVMINCLLKERGNMLQEKVPEIVSVLR---SKLQETQEEHILQAAQHSVFALATHHCASVVSNLLGSPLPFDSHTCTLWRALALEPGLAAQVLGLLLEKISKDVLFEESQAFLLSSTPDRVATL--------LPLAATCALHEVASAPASGPAV--LELYPQLFVALLLRVSCTVGVQPPRQLQAKERRSASSGLASRSLEPCSSAVDALQAVLVRGGNEDVVQCMELDGGWQLLRTSAGHEEGVTRLASAMAKFAGPRLPLVMKLLFTTQSSMYEVQRVTSTAFL-AELLSSNVVNDLMLLESLLYNLMARQKDTSARVRRLVLHGLANITLGSPDKVQTHSPQLLTAMIGGLDDGDDPHSLVALEAMVGLARLMDLVDAWDLHAVLLHIAVRIRPFFDSERMELRSVSIGLFGHLNKACRGDCKDVFLEQVVGGLVPLLLHLRDPHAPVVTACRFALRMCGP--------------NLECEELAAVFQRHLQEGHDLHFGEFLNTTCKHLMRHFPDLLGRLLSTSLFYYKSSWEDVRAAAPMLTGFLVLHMEAEQ 1613          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. UniProt/SwissProt
Match: sp|A6NES4|MRO2A_HUMAN (Maestro heat-like repeat-containing protein family member 2A OS=Homo sapiens OX=9606 GN=MROH2A PE=4 SV=4)

HSP 1 Score: 277.33 bits (708), Expect = 8.969e-74
Identity = 344/1616 (21.29%), Postives = 697/1616 (43.13%), Query Frame = 2
Query:  305 LSMNNILKQKVYDIHN-FNDLISK---IIKQVIDELTS--SKEI--LPEWQSK-----ANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMV-FIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLE-GPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCA--NEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI-KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMG-RDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFE--GLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISL-LKDNP--RMGVLRALKILSSQYLIECLNTAMAQTLPLD----EVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVW-LAAMNCLQILCSNKLSCGHICLTKM--YSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAIGIRPIT-------ICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFS-NSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSN-SNSLYTNKLNDFIET 5029
            L +  I  Q+  +I+N   D+I +   + +Q +  L +  SKE+  +PE +       A+D LV +S ++  L+M  L   L+P  L   FVI  L  +A  N ++ + Y+   +  + T+L LA     R  I ++   FCE +  Y+ + + +  P +T   F+  +F  +  F T WL     +++  V+ ++  M+  ++  ++    +   I  ++ +Y+   E   VT+ L Q+L+ +           T +   P      +  E                L +Q C  A A    +SQ       N  E+  CF  +   YP +L+     ++E   E  ++  L ++R I+S+ + ++        S    Y    +  ++ S T    + V+M + H I  +    Y   + G  L +++  Q  LST  +  N++ KF   D      +    +  +  + +K+ +S+++ M +  W  L+  ++  +  +A+  IC S+ NL                 E      D++  +      V++P PQ L++RL+VL   P     RGI +L  ++ L  +   ++  +W++ I  L+ YLE+             +D   WE+ L++ +  S++      W++   + +  QI+ +D    E+GFL++ LG  LA   + + ++  L  + + T +S + +  G  + FGLCA   + TVL  L  +     E++++  +    KD  HP      E +++++++       Y  P+L+ + ++S +  K++ + +   +D  +    ++S+  V +A+N  K   ++ F  +  L S +++ I+AE +  L + +R +AM  + +L  L P  +  E   +++I I +V +L           ++P +D  +   L    +++L +L++++L+         E+ +++    +SE E  RE+A+S +++ L   Y     V  + K L   GT+ G + P   D +   R  +++ ++    +          P     L      K  L+  D   +F A + I K++C   +  ++  L+Q L E  G  + Q + AS   + F    + R  +L ++VA IL+ +  ++ L + D+P  R  ++  + +L+  +    L + + Q LP++    EVW  +  N+     +L   +  L    S  I    + D                   +W LAA++ L  LC+      H+ + K+    KL   +     + +  L  + +       L+    +   P+        +  ++++      +S  +   ++ Q  WD L++   F+  ++LLAR +C+  +      +  L L   +S     RI  T     +   +    L     +++     +  D+ L V  LSL  +GN+   +   V+++   LL   L  +  R+   + +    M+ L  ++ +L E D+      +  +    ++ +S  +R  AF LFG LAR+      + F  E+    +PL++H +DP +   +AC   + Q +  +    +   S  S++   +K+  F  T
Sbjct:   88 LQVPEISTQRKVNIYNILQDIIQQEGELEEQCVQRLVAIASKEMREIPEMEGYMKAEVASDTLVALSRNHFSLVMYELQHHLKPLNLTDEFVIITLAKLANGNVFEFMPYMGITLATIFTMLRLANEAKIRQAICSAMETFCETVQFYLKHLEESVYPVMTEEEFALKVFPMYRYFVTVWLRHYNPEVKLGVIKSLKPMLGLLLPNDDLREQVYDYIPLLLAEYQGSLEVLFVTQVLRQILELSV----------TTNTPVPQMQLHTIFTE----------------LHVQVCNKAPAQHQYSSQ-------NLMEMVHCFVALARSYPKELMKFFFSQMETNKEAVRVGTLNLIRAIVSADEPRM--------SIRAIYLAIRVVKNTISDT---RSKVRMAILHIIGQLALCGYQERIKGWGL-KYLSVQLTLST-YKLTNRREKFYQRD------LEERMVHKVTMDTVKIITSSVSGMTTEFWVRLLCYIMETDYVEALTPICISLTNL----------------AEHQLHGQDVDVSVAGKSRQVDLPAPQKLLARLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWELEIALLVRYLEEHTEFT--------WDQKAWEDKLIQFLRNSLKKTRGSSWSLRLSKELNNQIASFDSPSLEKGFLYRALGFTLATGLEASKVEVLLLELLYKTDYSNDFDSEGVIMCFGLCARGQVKTVLNVLHDFEERIQESEQSWQISAWRKD--HPWRR---ETVKSALMVMYSCVASYCHPQLLLNLVDSPITAKIIHHYVSSCQDICLKMAFMKSVVQVTKAINNIKDLEDFHFAQKTTLTSIIVAVIKAEPTDNLVSPVRALAMEALSHLSKLKPFYSTEENSELMDISIHSVISL-----------QLPGEDNESIKTLYANALSSLEQLMESLLQRQLDPKGLQEMVQLLEKWILSEKEWEREKAVS-LHLYLMWIYVHSTAVCIHLK-LGQFGTMVGLIAPCTCDAHQRTRMASMNVLSSLLDLHASQTCSLWGPSKQKELE---KCKGDLQSTDVEKIFCASSRIAKVVCMEFSCDEVVSLIQKLCENTGAMNLQHDKASVTWIAF--FLQMRAKELEDKVAEILSAI--LVHLPVVDHPEVRRLLIDGILLLAHHHQETILTSLLRQPLPMESHLAEVWLAVSENVPFARTMLHSLMGRLQSRLSPRISATSKAD-------------------IWRLAAVDPLMTLCTI-----HLLIQKLDENDKLPDFLPDLIYTLLLQLGSSHRPEAAPPVLKMWKLVHTTPLPEEMNLQRVTIKSMQLLFKRVKSQHLAHTLDEQAVWDLLQDGGTFLEGVSLLAR-LCMQHVEGHRQRLAELVLRGMDSEVLSCRISSTAVCFMSGPVLYQEKLLKPAALLLEKGADQEEDEALRV--LSLRALGNMALGAPKKVKQYRKVLLEKCLGPL--REPVSNSVTAEGMEALTKILAELREGDVGSSFDAMSEQCRIFFDNESELLRLKAFILFGKLARVVGMSKKHFFKGEVKKAWIPLMLHSQDPCSNAAQACMATMFQCVHFWGWKSLEHPSGPSDTATDDKMTVFQTT 1573          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. UniProt/SwissProt
Match: sp|D3Z750|MRO2A_MOUSE (Maestro heat-like repeat-containing protein family member 2A OS=Mus musculus OX=10090 GN=Mroh2a PE=1 SV=2)

HSP 1 Score: 265.774 bits (678), Expect = 3.011e-70
Identity = 366/1735 (21.10%), Postives = 742/1735 (42.77%), Query Frame = 2
Query:  182 MQQSLISLGIKE-----PKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKV-YDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMV-FIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLE-GPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC-IIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCA--NEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVI-KVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNC--IGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE---MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFE--GLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISL-LKDNP--RMGVLRALKILSSQYLIECLNTAMAQTLPLD----EVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVW-LAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAI---GIRPITICCETLKNFLTTTQSHEII----------EEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQH--RILVTGFYGSTIIG--IASAXXXXXXXXXXXXXXSRL-------------GDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENL 5215
            M+++L S+ I E     P ++++ ++  L   +  +IS   ++++   M  I++Q+   + H    L++   KQ+ D +T +++   E    A++ LV +S ++  L+M  L   L+P  L   FVI  L  +A  N ++ + Y+   +  + T+L LA     R VI ++   FCE +  Y+ + + +  P +T   F+  +F  +  F T WL  ++ +++  V+ ++  M+  ++  ++    +   I  ++ +++  T  + +  +L QVL+    Q +++S   T +   P     P+  E                L +Q C  A A      QQ+ +S +N  E+  CF  +   YP +L+     ++E   E  ++  L ++R ++S+ D +        I+    Y    +  ++ S T    + V+M +   I  +    +  ++ G  L +++  Q  LST  +  N++  F   D      +    +  +  + +K+ +S+I+ M +  W  L+  ++  + T+A+  IC S+ NL             ENQ        D E  I     HV++P PQ L++RL+VL   P     RGI +L  ++ L  +   ++  +W+  IP L+ YLE+             ++   WE++L++ +  S++      W++   + +  QI  +D    E+GFL++ LG  L    +   ++  L  + + T +S + +R G  + FGLCA   + TVL  L+ +     E++++  +    KD  HP      E +++++++       Y  P+++ + ++S +  K++ +     +D  +    ++S+  V  A+   +   +++F  ++ L   ++  I+AE    L + +R +AM  +  L  + P  +  E   +++I I  V +L P G           +D  +   L   TM++L +L++ +L+         +   ++    +SE E  RE+A++    L+  Y   I        PL     G L G + P   D +   R  +I+ ++    + +       G   E +     +   KE L+  D N + +A + + K++C   N  ++  L+Q L E  G  D Q + A+   +   +  + R  +L ++VA IL  +  ++ L + D+P  R  ++  + +L+  +    L + + Q LP++    EVW  +  N+     +L   L  L    +  I    + D                   +W LAA++ L  LC+ +L    +     +  LF  ++      +     +    E  S +     +   G  P  +  +       T +S +++          + +  Q+ W  LEN   F+  ++L+AR +C+  +                NY Q    +++TG  GS I+   I+S  +         L   +L              DK   ++ LSL  +GN+   +   V+++   LL   L  +  +       +   M+ L  ++ +L E DI      +  +  + ++ +S  +R  AF LFG L ++      + F  E+    V LL+H +DP   V +AC   + Q +  +    +  S   +       ND I     E +T+    F  +   + A +    +   ++ + V+ K++   +  ++  L G +M+ L
Sbjct:   55 MRKTLASVIITEKATTDPCVVMNALIRCL---QMPEISTQRKMNIYNIMQEIIQQEGEMEEHCIQRLVAIASKQMRD-ITEAEDF--ETAEVASETLVALSRNHFSLVMYELQHHLKPLNLTDEFVIVTLAKLANGNVFEFMPYMGITLATIFTMLRLANEAKMRQVICSAMETFCETVQFYLRHLEDSLYPVMTEDQFAVKLFPMYRYFVTVWLRHQDLEVKLGVIKSLRPMLSLLLPNDDLREQVYDYIPLLLAEFQG-TGHWPLFPSLLQVLR----QILEASV--TTNTPIPPMLLHPIFTE----------------LHVQVCSKAPA------QQQFSS-QNLMEIVHCFIALARSYPKELMKFFFSQVEMSKEAVRVGTLALIRAVVSADDPK--------INIKTIYLAIRVVKNTLSDT---RSKVRMAILRIIGQLVLSGFQEKIKGWGL-KYVSVQLTLST-YKLTNRRECFYQRD------LEEKMVHKVTMDTVKIITSSISGMTNEFWVRLLCYIMETDYTEALTPICISLTNL------------AENQ----IHGKDTEAGIAGKSKHVDLPAPQKLLARLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWEQEIPLLVQYLEEHTEFT--------WNQKTWEDMLIQFLRNSLKKTRGTSWSLRLSKELNNQIETFDSPSLEKGFLYRALGFTLGMGLEADRVEVLLLELLYKTDYSNDFDREGVILCFGLCARGQVKTVLNVLQDFEERIQESEQSWQIGAWRKD--HPWRR---ETVKSALMVMYSCVSSYCHPQMLLTHVDSPITSKIIHHYSSSCQDISLKMAFMKSVVQVTNAIKSIQDPEDFQFAHKSALTGLIVVIIKAEPPDHLVSPVRSMAMDALSQLSTMKPFYSPEESTELMDISIHTVISLQPPG-----------EDNESVKTLYANTMSSLKQLMEGLLQRQLDPKGLQDTVHLLEKWILSEKEWEREKAMALHLHLMQIYVQSIGVC----IPLKLGQFGVLVGLIAPCTCDAHRRTRLASINVLSSLLDLHVSQTCSLWGTSKEQE-----LQKCKEDLQDTDMNKISSASSRVAKVVCPEFNCDEVVSLIQKLCENIGAMDLQHDRAAVTWI--GIFLQMRVKELEDKVAEILGAI--LVHLPVVDHPEVRRHLIEGILLLAHYHQETVLTSLLRQPLPMESHLTEVWLAVAENVPFARTMLHGLLGRLQSRFTAKINATSKAD-------------------IWRLAAVDPLMTLCTIQLLMEKMDQDDKFPDLFPDLLYTFLLQLG----SSHGPEAASPVLKTWRLVHTGPLPQEMTLQRCSRSRITIKSMQLLVKRINREPLEQALEEQSVWSLLENGGTFLEGVSLMAR-LCMQNM---------------ENYMQRLAELVLTGM-GSEILSCCISSTAICVEFMSDPVLHQEKLLRPVVLMLEKGAGQDKDETLQVLSLRALGNMALGAPRKVKQYRKLLLEKCLGSLQGQ--VSSSAMAEGMEALTKVLAELREGDIGSSFEAISKQCRAFFDNESELLRLKAFVLFGKLTKVVGISKKHFFKGEVKRGWVSLLLHCQDPCPSVAQACVATMFQCVHFWGWKSLESSFGHS-------NDSI----NEQMTV----FQTNMCSVLAQKKPAVLCGFLLETTVFMKNNLSRIRIAACNLAGIIMKQL 1624          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. TrEMBL
Match: A0A1S3I4S6 (maestro heat-like repeat-containing protein family member 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106160713 PE=4 SV=1)

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 600/1765 (33.99%), Postives = 1007/1765 (57.05%), Query Frame = 2
Query:   86 EDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHT-ESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPL-NCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLK-DNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLA--------IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 5341
            E  +   G ++D +   +++  YD+NE+T+E++  +L+ LG K+P L+LS   ++L K    K++ GHRV +L ++  ILK+ + ++     L + +I Q  +ELT SKE++PEWQ+ A+ VLV +   YC L+M  LV K QP V+PH+FV+  +  +A  N + +V +L+ ++  ML LL +AK DN +WV +++  +F EAIL+YV N ++APDPNV   +F+  I+SA+++ F  WL +KE+KLR A++DA+GNM  I+ R N E  LP+LI+GI+  YKKH  ES+H+T+ L  VL +A                           EC  L   ++ ++N LF Q     D +  G         SI+N NEV RCF+ I   + D+L+   L +LE   E+ KI+ L+I + +I++  + + +K++ I+S L+        N +N       N VK  ++  + AM    +L E GG  +++F++RQC+L   T+ ++   ++          ++N  LR +CENVL L ++TI  +  VLWPYL+E L+PV+ TDA+G IC ++  L S         + EN DE        + +ID++   N+P P  +++RLIVLAG PT+   RG+++L+AMQ L  N +E L  +WD +IPKL+ YLE + + +        ++   WE+L LK+++KS++ +NDEDW  E G  MG+QI LY   P+E+ F+FKC+G I+  STKK F++K L ++F+S  H+   ER G A+ FG  A++HLD+VL KLE    NE AK+++G  G  K+K   SD +++E ++A+ +L  G    YA   L+ SR+E+ +++ +  +  + KD ++ + ++ +++L+ +A++ + L   +    R +L+  +  Y++AE +  L ++ R +AM     L+ L P +++ EL  ++    D VF LP DG   KK KE P D      VL++ T+  L++L+K IL    S      I+K +    +S HEH R RA+ T + LL  Y ++      +G P+   +  L G LIPR  D  ++ RQL+I+ V    KIQL+ E       D  ++ +PT+K+R+KK D N+LF+ +ND++K++ K++  G++  L+  L +GL D+Q + +S   V  N LF++R  +L+E+V+ ++ +LHD ++L+     R G LRA++ L++ +LI  +   +   LP DE   +    +A D  +      H++E+ SR++P+EE+   + K+        I+ +C + LAA + L ++   + +   +   + Y++LF S++I   S ++  P   K ++ K   ++           + + P  +C E  K  L  ++S  ++E+++ +N W+ L+N++ F   +  LARS+C ++   +  +++ L+    S Y+  RI    F  + +I    A    L+++++  LL RL D   +VR + + G+GNV       VQ+ +T++LSA++ GMDD+ D DD +   AM+GL+ L+ ++ E  IR IL+ + L++  C+E+D   VRA+AF LFG+L++   GPS   FL +I++  V LL+HL DP  +V ++CK AL+ + PL  +  I              N   +  L ED  LH+GEF ND SKI    + D+VN  +M  + +FKS +PE+  ++ +  G LM NL + + T + K  +C  LI LLK  +  VR++ AEA+S L+ Y
Sbjct:    8 EGGVRATGGQVDEMVMAMIDSAYDKNEDTQEMIGSALLELGRKQPALVLSSCYTYLKKHS--KLNHGHRVVILNAIEKILKETLDELKE--SLAADLIAQASEELTESKEVVPEWQTAASGVLVAVGKKYCTLVMENLVAKFQPGVMPHFFVVQTMANLATANSFGIVPFLNVVLGTMLPLLGMAKHDNMKWVFSSALGKFSEAILDYVVNIEKAPDPNVKKEAFAGEIYSAYDILFNVWLQSKEAKLRLAIVDALGNMAHIMSRENLEEQLPRLISGILNLYKKHAAESFHITQGLCMVLDAAVQG------------------------ECTILEPHLDLVLNNLFTQACSLPDFNVPG---------SIKNHNEVLRCFSVIATAFSDRLVGYLLTKLETSNERTKIATLIIFKQLINTGGEAMENKKALIVSGLKGLA----LNETN-------NKVKKVIAQVVSAMAHHGHLEEEGGQLMVDFVIRQCSLPDDTKTRSNDPEY----------VSNWALRKMCENVLHLITTTIEGIDVVLWPYLLEFLLPVQHTDAMGVICKNVAFLASQ--------KRENNDE--------DYMIDFEDKANVPKPTAMIARLIVLAGRPTNGGNRGLHVLQAMQGLSPNLNEGLVELWDTVIPKLVQYLEGAEDEK--------WNQKNWEDLALKMLSKSLDEVNDEDWIEELGAVMGEQIPLYTNYPEEKNFIFKCIGIIMRKSTKKEFVNKHLTVLFNSVNHTHQVEREGVAIAFGFAASSHLDSVLTKLESVAKNEMAKKSSGFLGFLKEKATSSD-TDLEKIKATTMLCYGFVTLYAPATLIVSRIEATIMRSITPHFSHVKDNMVKQNLIRTVELIGKALHPDHLMQTHSLTNRGELLGHMQGYMKAEGTAHLPSETRALAMNACATLVKLDPILSDAELFDLIKTSTDCVFPLPLDGTTGKKGKEDP-DQQLEHEVLLESTLEALDDLLKEILLKNLSPAGLESIFKHLVPWMLSIHEHERLRAIRTTHTLLQCYLEKFEFGMGSGSPVFTTLQLLLGRLIPRCTDSEVDIRQLSIETVQTTLKIQLRYEGNPPGHKDQMVDALPTLKDRVKKNDPNLLFSVINDLSKVLAKKVPSGQLQGLVDLLMQGLLDSQSHSSSGACVALNSLFKSRGGELHEQVSRLIRELHDKLALITYPQTRTGTLRAIRTLATHHLISVVTALLNFRLPYDEHIVDCWKTLAQDAQLTNSIFSHILELLSRSLPYEEKASNNDKEDP------IRTACQLPLAATSALHVIFQVEETEAQVL--QNYNRLFVSLLIEICSMLDVQPPKEKKDDTKEETKSPRGKKGAQPKEVKLVPSNMCVEAFKGLLERSKSEGVMEDLDAENTWENLQNKETFTEAVTTLARSVCTHQGECVAKLVSCLTPVFTSLYDPQRIGAVAFC-AELIQQRCAGDLTLVELLMNSLLGRLVDSNHKVRMVCIRGLGNVSSVGSEQVQKFSTTVLSAMMAGMDDKDDIDDDITLEAMEGLSKLLEQINESHIRAILINISLKIRPCFEKDKEAVRAAAFTLFGNLSKFGDGPSRAPFLEQIHTNFVSLLLHLNDPEEQVQKSCKFALRLLGPLMGSTAI--------------NGMFQKHLLEDARLHYGEFMNDLSKIIIKDIPDKVNFYVMGCVSFFKSQWPEIKCNAAMFAGFLMGNLSKDKHTLVSKEHVCGALILLLKDSSPSVRSKAAEAMSWLYDY 1665          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. TrEMBL
Match: A0A1S3HHU5 (maestro heat-like repeat-containing protein family member 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106155010 PE=4 SV=1)

HSP 1 Score: 1031.55 bits (2666), Expect = 0.000e+0
Identity = 602/1765 (34.11%), Postives = 1008/1765 (57.11%), Query Frame = 2
Query:   86 EDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHT-ESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPL-NCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLK-DNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLA--------IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 5341
            E  +   G ++D +   +++  YD+NE+T+E++  +L+ LG K+P L+LS   ++L K    K++ GHRV +L ++  ILK+ + ++     L + +I Q  +ELT SKE++PEWQ+ A+ VLV +   YC L+M  LV K QP V+PH+FV+  +  +A  N + +V +L+ ++  ML LL +AK DN +WV +++  +F EAIL+YV N ++APDPNV   +F+  I+SA+++ F  WL +KE+KLR A++DA+GNM  I+ R N E  LP+LI+GI+  YKKH  ES+H+T+ L  VL +A                           EC  L   ++ ++N LF Q     D +  G         SI+N NEV RCF+ I   + D+L+   L +LE   E+ KI+ L+I + +I++  + + +K++ I+S L+        N +N       N VK  ++  + AM    +L E GG  +++F++RQC+L   T+ ++       +D  H   ++N  LR +CENVL L ++TI  +  VLWPYL+E L+PV+ TDA+G IC ++  L S         + EN DE        + +ID++   N+P P  +++RLIVLAG PT+   RG+++L+AMQ L  N +E L  +WD +IPKL+ YLE + + +        ++   WE+L LK+++KS++ +NDEDW  E G  MG+QI LY   P+E+ F+FKC+G I+  STKK F++K L ++F+S  H+   ER G A+ FG  A++HLD+VL KLE    NE AK+++G  G  K+K   SD +++E ++A+ +L  G    YA   L+ SR+E+ +++ +  +  + KD ++ + ++ +++L+ +A++ + L   +    R +L+  +  Y++AE +  L ++ R +AM     L+ L P +++ EL  ++    D VF LP DG   KK KE P D      VL++ T+  L++L+K IL    S      I+K +    +S HEH R RA+ T + LL  Y ++      +G P+   +  L G LIPR  D  ++ RQL+I+ V    KIQL+ E       D  ++ +PT+K+R+KK D N+LF+ +ND++K++ K++  G++  L+  L +GL D+Q + +S   V  N LF++R  +L+E+V+ ++ +LHD ++L+     R G LRA++ L++ +LI  +   +   LP DE   +    +A D  +      H++E+ SR++P+EE+   + K+        I+ +C + LAA + L ++   + +   +   + Y++LF S++I   S ++  P   K ++ K   ++           + + P  +C E  K  L  ++S  ++E+++ +N W+ L+N++ F   +  LARS+C ++   +  +++ L+    S Y+  RI    F  + +I    A    L+++++  LL RL D   +VR + + G+GNV       VQ+ +T++LSA++ GMDD+ D DD +   AM+GL+ L+ ++ E  IR IL+ + L++  C+E+D   VRA+AF LFG+L++   GPS   FL +I++  V LL+HL DP  +V ++CK AL+ + PL  +  I              N   +  L ED  LH+GEF ND SKI    + D+VN  +M  + +FKS +PE+  ++ +  G LM NL + + T + K  +C  LI LLK  +  VR++ AEA+S L+ Y
Sbjct:    8 EGGVRATGGQVDEMVMAMIDSAYDKNEDTQEMIGSALLELGRKQPALVLSSCYTYLKKHS--KLNHGHRVVILNAIEKILKETLDELKE--SLAADLIAQASEELTESKEVVPEWQTAASGVLVAVGKKYCTLVMENLVAKFQPGVMPHFFVVQTMANLATANSFGIVPFLNVVLGTMLPLLGMAKHDNMKWVFSSALGKFSEAILDYVVNIEKAPDPNVKKEAFAGEIYSAYDILFNVWLQSKEAKLRLAIVDALGNMAHIMSRENLEEQLPRLISGILNLYKKHAAESFHITQGLCMVLDAAVQG------------------------ECTILEPHLDLVLNNLFTQACSLPDFNVPG---------SIKNHNEVLRCFSVIATAFSDRLVGYLLTKLETSNERTKIATLIIFKQLINTGGEAMENKKALIVSGLKGLA----LNETN-------NKVKKVIAQVVSAMAHHGHLEEEGGQLMVDFVIRQCSLPDDTKTRS-------NDPEH---VSNWALRKMCENVLHLITTTIEGIDVVLWPYLLEFLLPVQHTDAMGVICKNVAFLASQ--------KRENNDE--------DYMIDFEDKANVPKPTAMIARLIVLAGRPTNGGNRGLHVLQAMQGLSPNLNEGLVELWDTVIPKLVQYLEGAEDEK--------WNQKNWEDLALKMLSKSLDEVNDEDWIEELGAVMGEQIPLYTNYPEEKNFIFKCIGIIMRKSTKKEFVNKHLTVLFNSVNHTHQVEREGVAIAFGFAASSHLDSVLTKLESVAKNEMAKKSSGFLGFLKEKATSSD-ADLEKIKATTMLCYGFVTLYAPATLIVSRIEATIMRSITPHFSHVKDNMVKQNLIRTVELIGKALHPDHLMQTHSLTNRGELLGHMQGYMKAEGTAHLPSETRALAMNACATLVKLDPILSDAELFDLIKTSTDCVFPLPLDGTTGKKGKEDP-DQQLEHEVLLESTLEALDDLLKEILLKNLSPAGLESIFKHLVPWMLSIHEHERLRAIRTTHNLLQCYLEKFEFGMGSGSPVFTTLQLLLGRLIPRCTDSEVDIRQLSIETVQTTLKIQLRYEGNPPGHKDQMVDALPTLKDRVKKNDPNLLFSVINDLSKVLAKKVPSGQLQGLVDLLMQGLLDSQSHSSSGACVALNSLFKSRGGELHEQVSRLIRELHDKLALITYPQTRTGTLRAIRTLATHHLISVVTALLNFRLPYDEHIVDCWKTLAQDAQLTNSIFSHILELLSRSLPYEEKASNNDKEDP------IRTACQLPLAATSALHVIFQVEETEAQVL--QNYNRLFVSLLIEICSMLDVQPPKEKKDDTKEETKSPRGKKGAQPKEVKLVPSNMCVEAFKGLLERSKSEGVMEDLDAENTWENLQNKETFTEAVTTLARSVCTHQGECVAKLVSCLTPVFTSLYDPQRIGAVAFC-AELIQQRCAGDLTLVELLMNSLLGRLVDSNHKVRMVCIRGLGNVSSVGSEQVQKFSTTVLSAMMAGMDDKDDIDDDITLEAMEGLSKLLEQINESHIRAILINISLKIRPCFEKDKEAVRAAAFTLFGNLSKFGDGPSRAPFLEQIHTNFVSLLLHLNDPEEQVQKSCKFALRLLGPLMGSTAI--------------NGMFQKHLLEDARLHYGEFMNDLSKIIIKDIPDKVNFYVMGCVSFFKSQWPEIKCNAAMFAGFLMGNLSKDKHTLVSKEHVCGALILLLKDSSPSVRSKAAEAMSWLYDY 1665          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. TrEMBL
Match: A0A1S3I3J3 (maestro heat-like repeat-containing protein family member 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106160713 PE=4 SV=1)

HSP 1 Score: 1025.77 bits (2651), Expect = 0.000e+0
Identity = 601/1778 (33.80%), Postives = 1008/1778 (56.69%), Query Frame = 2
Query:   86 EDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHT-ESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDL-------------VSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPL-NCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLK-DNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLA--------IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 5341
            E  +   G ++D +   +++  YD+NE+T+E++  +L+ LG K+P L+LS   ++L K    K++ GHRV +L ++  ILK+ + ++     L + +I Q  +ELT SKE++PEWQ+ A+ VLV +   YC L+M  LV K QP V+PH+FV+  +  +A  N + +V +L+ ++  ML LL +AK DN +WV +++  +F EAIL+YV N ++APDPNV   +F+  I+SA+++ F  WL +KE+KLR A++DA+GNM  I+ R N E  LP+LI+GI+  YKKH  ES+H+T+ L  VL +A                           EC  L   ++ ++N LF Q     D +  G         SI+N NEV RCF+ I   + D+L+   L +LE   E+ KI+ L+I + +I++  + + +K++ I+S L+        N +N       N VK  ++  + AM    +L E GG  +++F++RQC+L   T+ ++   ++          ++N  LR +CENVL L ++TI  +  VLWPYL+E L+PV+ TDA+G IC ++  L S         + EN DE        + +ID++   N+P P  +++RLIVLAG PT+   RG+++L+AMQ L  N +E L  +WD +IPKL+ YLE + + +        ++   WE+L LK+++KS++ +NDEDW  E G  MG+QI LY   P+E+ F+FKC+G I+  STKK F++K L ++F+S  H+   ER G A+ FG  A++HLD+VL KLE    NE AK+++G  G  K+K   SD +++E ++A+ +L  G    YA   L+ SR+E+ +++ +  +  + KD ++ + ++ +++L+ +A++ + L   +    R +L             ++ L  Y++AE +  L ++ R +AM     L+ L P +++ EL  ++    D VF LP DG   KK KE P D      VL++ T+  L++L+K IL    S      I+K +    +S HEH R RA+ T + LL  Y ++      +G P+   +  L G LIPR  D  ++ RQL+I+ V    KIQL+ E       D  ++ +PT+K+R+KK D N+LF+ +ND++K++ K++  G++  L+  L +GL D+Q + +S   V  N LF++R  +L+E+V+ ++ +LHD ++L+     R G LRA++ L++ +LI  +   +   LP DE   +    +A D  +      H++E+ SR++P+EE+   + K+        I+ +C + LAA + L ++   + +   +   + Y++LF S++I   S ++  P   K ++ K   ++           + + P  +C E  K  L  ++S  ++E+++ +N W+ L+N++ F   +  LARS+C ++   +  +++ L+    S Y+  RI    F  + +I    A    L+++++  LL RL D   +VR + + G+GNV       VQ+ +T++LSA++ GMDD+ D DD +   AM+GL+ L+ ++ E  IR IL+ + L++  C+E+D   VRA+AF LFG+L++   GPS   FL +I++  V LL+HL DP  +V ++CK AL+ + PL  +  I              N   +  L ED  LH+GEF ND SKI    + D+VN  +M  + +FKS +PE+  ++ +  G LM NL + + T + K  +C  LI LLK  +  VR++ AEA+S L+ Y
Sbjct:    8 EGGVRATGGQVDEMVMAMIDSAYDKNEDTQEMIGSALLELGRKQPALVLSSCYTYLKKHS--KLNHGHRVVILNAIEKILKETLDELKE--SLAADLIAQASEELTESKEVVPEWQTAASGVLVAVGKKYCTLVMENLVAKFQPGVMPHFFVVQTMANLATANSFGIVPFLNVVLGTMLPLLGMAKHDNMKWVFSSALGKFSEAILDYVVNIEKAPDPNVKKEAFAGEIYSAYDILFNVWLQSKEAKLRLAIVDALGNMAHIMSRENLEEQLPRLISGILNLYKKHAAESFHITQGLCMVLDAAVQG------------------------ECTILEPHLDLVLNNLFTQACSLPDFNVPG---------SIKNHNEVLRCFSVIATAFSDRLVGYLLTKLETSNERTKIATLIIFKQLINTGGEAMENKKALIVSGLKGLA----LNETN-------NKVKKVIAQVVSAMAHHGHLEEEGGQLMVDFVIRQCSLPDDTKTRSNDPEY----------VSNWALRKMCENVLHLITTTIEGIDVVLWPYLLEFLLPVQHTDAMGVICKNVAFLASQ--------KRENNDE--------DYMIDFEDKANVPKPTAMIARLIVLAGRPTNGGNRGLHVLQAMQGLSPNLNEGLVELWDTVIPKLVQYLEGAEDEK--------WNQKNWEDLALKMLSKSLDEVNDEDWIEELGAVMGEQIPLYTNYPEEKNFIFKCIGIIMRKSTKKEFVNKHLTVLFNSVNHTHQVEREGVAIAFGFAASSHLDSVLTKLESVAKNEMAKKSSGFLGFLKEKATSSD-TDLEKIKATTMLCYGFVTLYAPATLIVSRIEATIMRSITPHFSHVKDNMVKQNLIRTVELIGKALHPDHLMQTHSLTNRGELLGHMQDLFGNVWRLADLQGYMKAEGTAHLPSETRALAMNACATLVKLDPILSDAELFDLIKTSTDCVFPLPLDGTTGKKGKEDP-DQQLEHEVLLESTLEALDDLLKEILLKNLSPAGLESIFKHLVPWMLSIHEHERLRAIRTTHTLLQCYLEKFEFGMGSGSPVFTTLQLLLGRLIPRCTDSEVDIRQLSIETVQTTLKIQLRYEGNPPGHKDQMVDALPTLKDRVKKNDPNLLFSVINDLSKVLAKKVPSGQLQGLVDLLMQGLLDSQSHSSSGACVALNSLFKSRGGELHEQVSRLIRELHDKLALITYPQTRTGTLRAIRTLATHHLISVVTALLNFRLPYDEHIVDCWKTLAQDAQLTNSIFSHILELLSRSLPYEEKASNNDKEDP------IRTACQLPLAATSALHVIFQVEETEAQVL--QNYNRLFVSLLIEICSMLDVQPPKEKKDDTKEETKSPRGKKGAQPKEVKLVPSNMCVEAFKGLLERSKSEGVMEDLDAENTWENLQNKETFTEAVTTLARSVCTHQGECVAKLVSCLTPVFTSLYDPQRIGAVAFC-AELIQQRCAGDLTLVELLMNSLLGRLVDSNHKVRMVCIRGLGNVSSVGSEQVQKFSTTVLSAMMAGMDDKDDIDDDITLEAMEGLSKLLEQINESHIRAILINISLKIRPCFEKDKEAVRAAAFTLFGNLSKFGDGPSRAPFLEQIHTNFVSLLLHLNDPEEQVQKSCKFALRLLGPLMGSTAI--------------NGMFQKHLLEDARLHYGEFMNDLSKIIIKDIPDKVNFYVMGCVSFFKSQWPEIKCNAAMFAGFLMGNLSKDKHTLVSKEHVCGALILLLKDSSPSVRSKAAEAMSWLYDY 1678          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. TrEMBL
Match: A0A1S3HJ86 (maestro heat-like repeat-containing protein family member 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106155010 PE=4 SV=1)

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 603/1778 (33.91%), Postives = 1009/1778 (56.75%), Query Frame = 2
Query:   86 EDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHT-ESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDL-------------VSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPL-NCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLK-DNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLA--------IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 5341
            E  +   G ++D +   +++  YD+NE+T+E++  +L+ LG K+P L+LS   ++L K    K++ GHRV +L ++  ILK+ + ++     L + +I Q  +ELT SKE++PEWQ+ A+ VLV +   YC L+M  LV K QP V+PH+FV+  +  +A  N + +V +L+ ++  ML LL +AK DN +WV +++  +F EAIL+YV N ++APDPNV   +F+  I+SA+++ F  WL +KE+KLR A++DA+GNM  I+ R N E  LP+LI+GI+  YKKH  ES+H+T+ L  VL +A                           EC  L   ++ ++N LF Q     D +  G         SI+N NEV RCF+ I   + D+L+   L +LE   E+ KI+ L+I + +I++  + + +K++ I+S L+        N +N       N VK  ++  + AM    +L E GG  +++F++RQC+L   T+ ++       +D  H   ++N  LR +CENVL L ++TI  +  VLWPYL+E L+PV+ TDA+G IC ++  L S         + EN DE        + +ID++   N+P P  +++RLIVLAG PT+   RG+++L+AMQ L  N +E L  +WD +IPKL+ YLE + + +        ++   WE+L LK+++KS++ +NDEDW  E G  MG+QI LY   P+E+ F+FKC+G I+  STKK F++K L ++F+S  H+   ER G A+ FG  A++HLD+VL KLE    NE AK+++G  G  K+K   SD +++E ++A+ +L  G    YA   L+ SR+E+ +++ +  +  + KD ++ + ++ +++L+ +A++ + L   +    R +L             ++ L  Y++AE +  L ++ R +AM     L+ L P +++ EL  ++    D VF LP DG   KK KE P D      VL++ T+  L++L+K IL    S      I+K +    +S HEH R RA+ T + LL  Y ++      +G P+   +  L G LIPR  D  ++ RQL+I+ V    KIQL+ E       D  ++ +PT+K+R+KK D N+LF+ +ND++K++ K++  G++  L+  L +GL D+Q + +S   V  N LF++R  +L+E+V+ ++ +LHD ++L+     R G LRA++ L++ +LI  +   +   LP DE   +    +A D  +      H++E+ SR++P+EE+   + K+        I+ +C + LAA + L ++   + +   +   + Y++LF S++I   S ++  P   K ++ K   ++           + + P  +C E  K  L  ++S  ++E+++ +N W+ L+N++ F   +  LARS+C ++   +  +++ L+    S Y+  RI    F  + +I    A    L+++++  LL RL D   +VR + + G+GNV       VQ+ +T++LSA++ GMDD+ D DD +   AM+GL+ L+ ++ E  IR IL+ + L++  C+E+D   VRA+AF LFG+L++   GPS   FL +I++  V LL+HL DP  +V ++CK AL+ + PL  +  I              N   +  L ED  LH+GEF ND SKI    + D+VN  +M  + +FKS +PE+  ++ +  G LM NL + + T + K  +C  LI LLK  +  VR++ AEA+S L+ Y
Sbjct:    8 EGGVRATGGQVDEMVMAMIDSAYDKNEDTQEMIGSALLELGRKQPALVLSSCYTYLKKHS--KLNHGHRVVILNAIEKILKETLDELKE--SLAADLIAQASEELTESKEVVPEWQTAASGVLVAVGKKYCTLVMENLVAKFQPGVMPHFFVVQTMANLATANSFGIVPFLNVVLGTMLPLLGMAKHDNMKWVFSSALGKFSEAILDYVVNIEKAPDPNVKKEAFAGEIYSAYDILFNVWLQSKEAKLRLAIVDALGNMAHIMSRENLEEQLPRLISGILNLYKKHAAESFHITQGLCMVLDAAVQG------------------------ECTILEPHLDLVLNNLFTQACSLPDFNVPG---------SIKNHNEVLRCFSVIATAFSDRLVGYLLTKLETSNERTKIATLIIFKQLINTGGEAMENKKALIVSGLKGLA----LNETN-------NKVKKVIAQVVSAMAHHGHLEEEGGQLMVDFVIRQCSLPDDTKTRS-------NDPEH---VSNWALRKMCENVLHLITTTIEGIDVVLWPYLLEFLLPVQHTDAMGVICKNVAFLASQ--------KRENNDE--------DYMIDFEDKANVPKPTAMIARLIVLAGRPTNGGNRGLHVLQAMQGLSPNLNEGLVELWDTVIPKLVQYLEGAEDEK--------WNQKNWEDLALKMLSKSLDEVNDEDWIEELGAVMGEQIPLYTNYPEEKNFIFKCIGIIMRKSTKKEFVNKHLTVLFNSVNHTHQVEREGVAIAFGFAASSHLDSVLTKLESVAKNEMAKKSSGFLGFLKEKATSSD-ADLEKIKATTMLCYGFVTLYAPATLIVSRIEATIMRSITPHFSHVKDNMVKQNLIRTVELIGKALHPDHLMQTHSLTNRGELLGHMQDLFGNVWRLADLQGYMKAEGTAHLPSETRALAMNACATLVKLDPILSDAELFDLIKTSTDCVFPLPLDGTTGKKGKEDP-DQQLEHEVLLESTLEALDDLLKEILLKNLSPAGLESIFKHLVPWMLSIHEHERLRAIRTTHNLLQCYLEKFEFGMGSGSPVFTTLQLLLGRLIPRCTDSEVDIRQLSIETVQTTLKIQLRYEGNPPGHKDQMVDALPTLKDRVKKNDPNLLFSVINDLSKVLAKKVPSGQLQGLVDLLMQGLLDSQSHSSSGACVALNSLFKSRGGELHEQVSRLIRELHDKLALITYPQTRTGTLRAIRTLATHHLISVVTALLNFRLPYDEHIVDCWKTLAQDAQLTNSIFSHILELLSRSLPYEEKASNNDKEDP------IRTACQLPLAATSALHVIFQVEETEAQVL--QNYNRLFVSLLIEICSMLDVQPPKEKKDDTKEETKSPRGKKGAQPKEVKLVPSNMCVEAFKGLLERSKSEGVMEDLDAENTWENLQNKETFTEAVTTLARSVCTHQGECVAKLVSCLTPVFTSLYDPQRIGAVAFC-AELIQQRCAGDLTLVELLMNSLLGRLVDSNHKVRMVCIRGLGNVSSVGSEQVQKFSTTVLSAMMAGMDDKDDIDDDITLEAMEGLSKLLEQINESHIRAILINISLKIRPCFEKDKEAVRAAAFTLFGNLSKFGDGPSRAPFLEQIHTNFVSLLLHLNDPEEQVQKSCKFALRLLGPLMGSTAI--------------NGMFQKHLLEDARLHYGEFMNDLSKIIIKDIPDKVNFYVMGCVSFFKSQWPEIKCNAAMFAGFLMGNLSKDKHTLVSKEHVCGALILLLKDSSPSVRSKAAEAMSWLYDY 1678          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. TrEMBL
Match: A0A210QHK2 (Maestro heat-like repeat-containing protein family member 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14496 PE=4 SV=1)

HSP 1 Score: 954.51 bits (2466), Expect = 0.000e+0
Identity = 594/1778 (33.41%), Postives = 960/1778 (53.99%), Query Frame = 2
Query:   83 EEDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDA--SAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLK-DNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGL--------------EANLAIGIRPITICCET----LKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLS--EIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 5341
            +ED+I   G ++D L   L++  YD ++E +E +  +L  +G ++P L+LS   ++L K    K+   HRV LL  M  I+K+K+ DI     L   ++KQ   ELT SKE++P+WQ+ A+ VLV +   YC  +M  ++ + QP  LPH+FV+  +G +A  N Y MV +L+ ++  ML +L +AK DN RWV + + S+FCEA++EY AN D+APD +VT   FSQ + SAF+V F +WL +KE KLR  +++A+G+M  ++ +   +  LP+++ GI+  YK+H E  H+T  L                                   C+ L+        VL   L+Q L      I N       NSI+N NEV RCF  +   +  +L    L +LE   EK KI  L I +H+I++  + +  K+  ++S L+            S   + +N +K   +  +IAM   NYL   GG +++EFIV+QC+L      K              + +TN QL+ +C+NVL+L ++T+  M  VLWPYL+EL+VP + T+A G +C  + +L +   +       EN D+           IDY+   N+P P  +++RL+VLAG PT+   RG+++L  M+ LV N  ENL  +WD +IPKLI +LE +   +        F    WE+L LKL++KS++ + +EDWT E GE  G QISLY+   +E+ FL+KCLG ++  S KK F++K LDLIF + RHS+  ER G A+  G CAA+HLD VL KLE    NE ++++ GLF   KD+      ++IE  +A+++L  G    ++ P L+ SR+E+ +++ +Q      KD  + + ++ ++DL+ +A++ + LK  Y F  R + ++ L SY++AES+T++ N+ R +AM++   L+ L P ++  E+  ++    D +F LP +G+  KK KE  +D      VL+  T   +++LI  IL    +      ++K +   F    +H R R+L T+ +      + ++  + + K      T+   L+PR  DPN   RQL +DC+ V  K+  +++       D  ++ + T+KERL+K D  +LF+ +ND+ K+I K++   ++   ++ L EGL D Q + +S   V+ N + + R  ++ ++V +I++ LH+ +  ++    R G LR ++ L+S +L   + + +   LP D    EI   ++ D  I    + HL+E   RT+P+EER D   +  K  +V  +  +C     AM  +  +   +       + K Y +LF ++++   SS+   P   KS   +  L               A LA     I  C ++     K+FL  T++ +I E +  +  W KLE+ED +      L R I  + ++      I+  L+   +S YE  R+    F+ + +I    A+ D L+++++  LL RL D    VR L + G+GNV       VQR++T++LSA++ GMDD++D DD +   AM GL+ ++ ++ E  IR IL+ V LR+  C+E++   VRA ++ LFG+L+R   GPS   FL +I+S +V LL+HL DP  EVI+ACK AL+Q+ PL       +S + NS +           L ED  LH+GEF ND SK+      D+VN   M  + +FKS +PE+ +++ L IG L+ NL   +   + K  IC  LI LLK    +VRA+ AEAISLL+ Y
Sbjct:    7 DEDMIRSTGGQVDDLTMALIDAAYDRDDECQEQICNALFDMGRQKPALVLSSCYAYLKKHS--KLVKEHRVVLLQCMERIIKEKLGDIDT--GLAIDVVKQAALELTLSKEVVPDWQTAASGVLVAIGAKYCDEVMDEMLQRFQPGQLPHFFVVQTIGNLAQANVYRMVPHLTAVLGTMLPMLGMAKHDNMRWVFSAALSKFCEAVIEYCANIDKAPDQSVTKDRFSQEVASAFDVLFNSWLQSKEIKLRLTIVEALGHMTHLMAKEKLDEQLPRILQGILGLYKRHPEPLHITTGL-----------------------------------CSVLDAVCVEDNTVLEPHLEQLLGTLFPQIFNTPDYNNPNSIKNHNEVLRCFAILARSFSGKLTGILLAKLENNNEKTKIGILTIFKHLINAATESMADKQEVVVSGLK------------SMVLEQNNKIKKIFAQVVIAMAHHNYLELEGGQQMMEFIVKQCSLPNDPPGKRSP---------DPEYVTNKQLKLMCDNVLQLLTTTVEDMEQVLWPYLLELIVPEQYTEAAGVLCKCLSHLSNKKRE-------ENADDYE---------IDYETQANVPKPPVMIARLMVLAGRPTNGRDRGVHVLMTMKGLVPNLDENLVDLWDTVIPKLIQFLEDATREDT-------FSQQNWEDLFLKLLSKSLDVMENEDWTAELGETFGNQISLYNNYSEEKNFLYKCLGVVMRKSNKKDFVNKHLDLIFSTIRHSDQTEREGCAIAMGFCAASHLDAVLTKLESVAKNEMSQKSGGLFSFMKDR----SEADIERTKATLMLCYGFVALFSPPTLIVSRMEATILRGIQPYFANVKDMGVKQNLIRTVDLIGKALHPDHLKSQYNFSNRGEFLNHLQSYMKAESTTSITNETRALAMKSCATLVKLDPKLSEAEIFDLIKTATDCLFVLPKEGLSPKKGKEEAYDQMLEAEVLLQSTTEAMHDLICVILSKELTPNGLDCVFKHMMKWFFELDDHRRVRSLETLLMAEEYILENMDPSSEDIKGFENECTVLARLVPRCTDPNTQVRQLAVDCIQVVLKMASRIDGNPADYKDPMIDALSTLKERLEKGDPTVLFSVINDLAKVIAKKLPADQLRTFMEVLQEGLLDPQSHSSSGACVVLNGMMKARGGEVLKQVGNIVSSLHEKLGQIEFAQTRTGTLRTIRTLTSYHLSSVMQSLLNFPLPYDANVVEIWQILSQDAQIASSMIDHLLETLQRTLPYEERTD-GDRTIKNATVAPLAVTC-----AMKVIFDVEETEEQ-----VNKNYHRLFAALVLRMGSSVGVKPLKQKSKTLRQKLFPQDREEKPKDKKRAAALAASSPKIPTCSQSAVAAFKSFLERTKTKDIQEGLEEEECWGKLEDEDNYTEAFTTLTRLIVTSTVAGPHTSQIVACLTSSLSSLYETQRVTTAAFF-AELINQKCADDDTLVELVMNSLLGRLVDSSHVVRMLCIRGLGNVSSMGQDQVQRYSTTVLSAMMAGMDDKEDPDDDITIQAMSGLSRVLPEIDESHIRAILINVALRIRPCFEKEKEGVRAQSYILFGNLSRFGDGPSKAPFLEQIHSNLVSLLLHLNDPKKEVIKACKGALRQLGPLM------ESEDVNSKFQKH--------LLEDGNLHYGEFMNDLSKVLIQDFPDKVNFYAMGCVAFFKSSWPEIKSNAALFIGFLLVNLPNGKHGLISKEHICSALIMLLKDSTPEVRAKAAEAISLLYEY 1671          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Cavefish
Match: mroh1 (maestro heat like repeat family member 1 [Source:NCBI gene;Acc:103030136])

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 513/1762 (29.11%), Postives = 919/1762 (52.16%), Query Frame = 2
Query:  101 VKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELN---SIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDL-HVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLL-KDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKG--KCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHI--CLTKMYSKLFTXXXXXXXXXXNC-LPFTGKSN-----EKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLH 5335
            ++ T+++ +   L++   D++   +E +++S+++LG ++P  +LS+   +L   K  K+  GHRV +L ++  ++K K+ DI      I  II    DE+T SKE+  EWQ  A+++LV +   Y + IM  ++ K QP VLPH+FV+  L +++ +N Y MV +LS I+  ML +L +AK DN +WV +++  +F E+ILEY+AN D+APDP V   +FS  I++A+++ F +WL ++E KLR  V +A+G+M  ++  +  E  LPKL+  ++  YKK+ E Y V+K+L QVL ++    V+  S                                VL  Q+   L A     + S  + N   +I+N NEV RCFT +   +PD+L+   L+RLE   E+ ++ +L +LRH+I+S    +  K+  I++ ++    ++            SN VK ++   I AM    YL   GG  L+ FI++ CAL   T ++ ++           + +TN  LR++C+N L L ++T+  +  VLWP L+  L P + ++A   +C S+  L +N  +           E NF       IID+     N+P    LM RL+V +  P  C   G   L  +  +V N H    ++W   IP+L+ +LE+S             D   WEE LL+ ++K++  I+D  W+ +      + +  Y+   +E+ FL+KC+G  L   T K  + KQL  +  S RH++  ER+G A+G GLCA++HLD  L KLE +  ++A K+ +G+FGL KDK    +   +E +++++IL  G     +  + + +RL++++++ +  +    KD  +   +++S+ L+A+A+N    K  Y F  + +L+  ++ +I+AE +  L   +R + M T  NLI L PP+T  E   +L  CI+ V+ LP    P +K K+    D      L   T + L+EL++ +L    S      ++K I     S  +H RERA+ T   LL  Y D ++    N    + +G L G L PR  DPN   R+  IDC+ V   IQL+ E       D S+  + T++E+L   D ++L+ + +++TK+I KR+   +++ L+  LFEGL D+Q N + A  V+ N L + R + L + V  +L  LH+ + ++ ++  ++ V +++ IL++Q+L   + T ++  LP D    E+   +  D  +  + +  ++E  +   PF ++++   K G  K  + + +  +C +    MN            GH    +  ++ +LF+++++   SS+   LP    SN      K SG    +A+      +  E L+  L       +++ ++  + WDK+++  +  + + LL+R++  +    +  I+ +L    N+ YE  RI VT F+ S ++         ++D+++  ++ R+ D C  VR L++ G+GNV   S   V ++A  LL+A+  GM+++ D    +   AM GL+ ++  L +K++  ++V + +++    E ++  +R ++  L G+L++  +G     F  +I++V+V LL+HL DP+ +V++ACK  ++   P+  + QI+      +++ N L+        E+  LH+GEF ND  K         +N   +  + +FKS++ E+ AS+ + IG L+ NL E+  + +  G +   L+ LL+  +  VRA+ AEA+   H
Sbjct:    4 IEETDVEQVTLALLDAANDKDAVVQEQVRKSILTLGNQQPDKVLSMCQDYL--VKHSKLVAGHRVVVLQTIELVVKSKIDDISYPK--IKSIISLASDEMTRSKEVSAEWQQAASNILVAVGNKYINDIMEEILSKFQPGVLPHFFVVQTLASLSDSNVYGMVPFLSAILGTMLPMLGMAKQDNMKWVFSSALYRFSESILEYLANLDKAPDPTVRKDTFSGEIYAAYDILFNSWLQSREPKLRLTVAEALGSMSHLMAHDKLEEQLPKLVPTVLGLYKKNPEHYIVSKSLCQVLDAS----VNMGSR-------------------------------VLETQMDSLLSALH-QQVCSPMDFNNPPTIKNHNEVLRCFTILANTFPDRLMVFVLQRLENSNERNRMGSLAVLRHLINSTTSIMETKKLLILASIRQPLVDH------------SNKVKKRVVQVISAMAHHGYLELEGGDLLVRFIIQHCALP-DTYYRGQR-------PTDPEEVTNEALRSMCDNTLHLFTTTVGRLTDVLWPMLLCYLTPSQYSNATTPLCKSLI-LLANKKRA--------AQEPNF-------IIDFTAPGSNLPSQYILMMRLLVNSAFPFRCRGHGAPSLSLLLAIVPNIHPKAEALWSTEIPQLLTHLEESTQET--------LDKKSWEESLLQFLSKTLVAIDDGQWSCQLAVEATRYLPTYNNSLEEKSFLYKCIGMTLQQCTNKELVRKQLQEVLVSARHNDATERVGVAMGIGLCASSHLDGTLTKLEEFGKSDAFKKASGIFGLLKDK----NDVEVEKIKSTLILCYGYVALNSPEDQLLNRLDNDILRSISKHFN-TKDLTMKLSLIQSVGLIAKAINTCVRKQGYLFSRKQELMGVMMDFIKAEPADALRTPVRHLVMTTCANLINLDPPLTENENFDMLKTCINGVYGLPTIEAP-EKGKDEEILDPQQKEALYTDTFSALHELLRNVLARDLSPDGLQSVFKHIEGWLSSRQDHERERAVRTTAELLQFYLDSLSV--KNLVTFHNLGALLGRLAPRCTDPNPGVRRAAIDCIYVLLHIQLRYEGFSLDYKDDSVEGLLTVREKLNDPDHSVLYRSCSELTKIISKRLPQQQLNTLIFMLFEGLVDSQSNCSRASSVVLNTLLKNRGAGLQDLVPEMLEVLHNRLQVIGEEQVKVAVAQSILILATQHLQTVITTLISYPLPFDSWSCEMWTALGADSTVARQIMEMIVEKLNVIAPFVDKKEFMLKPGMTKVATSQPLAMTCALREMMMN------------GHTEEAVISLFPQLFSALLVRMGSSVGVQLPKDINSNSIGADRKASG--KTIAVNFDVCGVAVEALRILLARAHLDAVVKVLDQDSAWDKMKDSKQHTAGVTLLSRAMAKHAGPRLPMIVESLCPSLNNIYECQRITVTAFF-SELLNHHVVTELMMMDVLMNNMMERISDPCCTVRMLAIRGLGNVAIGSPEKVNKYAKELLAAMSSGMEEKDDPGKFITLEAMSGLSKVLLYLDQKNVHLLVVYIFMKIKPFLENENDEIRCASIMLLGNLSKFGSGEPV--FKDQIHNVLVSLLLHLSDPNAQVVKACKYTMRVCAPVVGSEQIT------AMFQNHLH--------EEKGLHYGEFINDLIKYIIQDFPGMLNFYHVTVVQFFKSNWAEIRASAAMFIGFLLGNLPEEYFSHMNMGTVTKGLVMLLQDPDPIVRAKAAEAMGQFH 1642          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003856.1 (pep scaffold:Pmarinus_7.0:GL480076:13891:22992:-1 gene:ENSPMAG00000003523.1 transcript:ENSPMAT00000003856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.565 bits (584), Expect = 2.075e-67
Identity = 113/285 (39.65%), Postives = 179/285 (62.81%), Query Frame = 2
Query:  152 YDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWV---IATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSAT 997
            +D++E  RE + +SL  LG + P+ +L   LS+L  +K  K+  GHRV +LLSM  I+K  ++ +     L   I+    +E+T SKE+LPEWQ  A++VLV + + +  ++M  L+ K QP ++PH+F +  L  +A  N Y MV +L+  +  ML +L + K DN RWV   +  S S F E+ILEYVAN D+APDP V   +F   I+SA++V F  WL +KE+KLR  +++A+G+M  ++     +  LP+L+TG ++ YKKH+E +++T+ L QVL ++ 
Sbjct:   18 FDKDEAVRERIARSLNELGCRHPEPVLECCLSYL--TKHSKLPQGHRVVILLSMELIIKDTLHQLSE--PLARSIVALASEEMTRSKEVLPEWQQAASNVLVAIGSGFVRVVMEELLQKFQPGMIPHFFTMKTLANLATANVYGMVPFLTATMGIMLPMLGVTKQDNMRWVFTSVCGSLSHFSESILEYVANLDKAPDPTVRKEAFQNEIYSAYDVLFNVWLQSKEAKLRLMIVEALGHMAHLLTWEKLDEQLPRLLTGFMMLYKKHSEPFYITQGLCQVLDASA 298          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010663.1 (pep scaffold:Pmarinus_7.0:GL479584:32745:44495:-1 gene:ENSPMAG00000009654.1 transcript:ENSPMAT00000010663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 1.670e-56
Identity = 143/507 (28.21%), Postives = 262/507 (51.68%), Query Frame = 2
Query: 3704 RALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNK-----LSCGHICLTKMYSKLFTXXXXXXXXXXNC-LPFTGKSNEKKSGLEANLAIGIRPITIC---CETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIG 5197
            +A ++L+  +L   +   +   LP DE   E+   +  D A + K   + +E  SR +P++E+ D   KK              +  A +  L I C+ K       C  + +  +Y +LF ++++   SS+   LP    +N+K +GL        +P+  C    E L+  L+   + ++++ +  Q  W+ + +E+     +A LAR++       +  I  +L+   +S Y++ RI V  F+ + ++   + +   L+D+++  LL RL D    VR L + G+GN+   +   V R++T++LSAL+ GMDD++D DD +   AM GL+ ++ ++ E ++R IL+ + LR+   +E++   VRA+AF LFG+L++   G S  +FL ++++ +V +L+HL D   +V +ACK AL+ I  L              L +  +    +  L ED  LH+GEF ND +K       D+VN  +M  + +FKS + E+  ++V+L+G
Sbjct:    1 QAAQLLAQHHLQAAIAVLLTYPLPYDEHAQELWRCLGSDAATIAKIFSNFIEALSRQLPYQEKPDPRNKK------------LSLRFATLPSLAITCAIKGVLAIPECAAV-MGGVYPQLFATLLVRLGSSVGLQLPKELTANQKSNGLPRV----AKPMDACQCSIEALELMLSRAGNADVVQAMESQQEWELIIDEERHHQGVAALARAMATYAGPRLTLITESLAPVLSSVYDRQRITVVAFF-AELLNHQAVSDLLLVDVLMNNLLGRLVDNSHVVRMLCIRGLGNIATGAAHKVHRYSTTVLSALIAGMDDKEDPDDLITLEAMSGLSKVLARVDESNVRGILINIALRIRPFFEKEKETVRAAAFVLFGNLSKFGDGESRGQFLEQVHTNLVSILLHLNDEHPDVRKACKFALRTIGSL--------------LGSEAIGTMFQKHLLEDANLHYGEFMNDLAKYIIKDFPDKVNFYLMSCVSFFKSTWAEIRGNAVMLVG 475          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Nematostella
Match: EDO46470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPZ1])

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 461/1696 (27.18%), Postives = 831/1696 (49.00%), Query Frame = 2
Query:  416 ILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLE-GPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTI---TSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANE-AKRTTGLFGLFKDKVHPS--------DSSNI--ELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKH-NYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRF-VSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPET-DSSLNMIPTIKERLKKFDSNILFAAVNDITK-----------------------------------MICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHL-EDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 5341
            I PEWQ+ A++VLV +   + H +M  L+DKL P  LPHYF++  L + A  N + +V +L  I+ +ML ++ +AK DN +WV A    +F E+I+EYVAN + AP P++++  F   I SA+++ F  WL + E+K+R AV+DA+G+M  I+ ++  E  LPKL+ GI   YKKHT+ Y +T+ L  VL +A     +  +  + H D       PL+                  L    C+    I         +S++N NE+ RCF+ +   + D++++  L +LE   E+ +I +L IL+H                   L N +G  L N                    +I  G +  L+E   LK+  F+     L+ +   +N       +  +   V T  Q    C     ++ S++   + +  VLWPYL+E +VP   T A+  +C S+ +L +                   E  D    I+++   NIP P+ ++SRLIV++G P     RG ++LK +QIL    + +L  IWD +IPKL+ YLE+ + +  +      ++   WE+L+LKL++KS++  + EDW    G+ +  Q+ LY +LP ++ FLFKC+G +L   T+K F+  QL+ +F+S +HS   ER G A+G G CA  +LD  L KLE     +  K+++G+ G  K  V  S        D +++  E ++++++L  G A+ Y  P L+ SRLE++V +++  +    KD  + + ++   +L+A+A+  ++L+  ++    R++L++ +L+YI AE ST++  + R +A+    +L+  +P + +L        C+ +                  F    TF  L+   + ++++L+K ++       T   I+K I   + +S  +  R+RA+     LLN + D +  V+ +G     IG +   ++PR  DP I  RQ  ID +    ++  + + G  P++ D  ++ + T+++R ++ D+ I+F+  +D++K                                   +I K+I    +   + +L EGL D+    +S   V+FN + + R  ++ +EV S+ T+ H    LL+D            L  + LI   +T            T++      DE      L++    H     +E R D  + +  C   +  +        A +   ++  N              +LF++++    + +  LP     + KK          I P++   + + + L   Q  ++ + I  ++ W     E+ F   + LLAR +C+     +  ++        S Y+  RI+V+ F+   I    S    +L+++++  L+ RL D    VR+  + G+GN+   SD  V++++T++LSA++ GMDD+ D +D++   AM GL+ ++ +L E ++R IL+ +CLR+  C+E++  +VRA+AF LFG+L+R   GPS   ++ ++++ ++ +L+H+ E+P  +V +ACK  L+ + PL              + ++ +N   +  L E+  LH+GEF ND S++      ++++   M  + +FKS   ++ A++ L +G ++ NL       + K  IC  LI LLK  + KVR + AEA+SLL+ Y
Sbjct:    2 IEPEWQTAASEVLVALGKRFDHEVMAELLDKLAPGTLPHYFIVQTLASFASANAFGVVPFLKDILGRMLPMMGMAKQDNMKWVFANCLGRFSESIIEYVANAENAPYPDISLDRFHGEIDSAYDILFNIWLKSNEAKIRLAVVDAVGHMTHILSQDKLEEQLPKLLPGITNLYKKHTDHYLITQGLCSVLDAAC---CNGGALLSPHLD-------PLLGG----------------LHNMACVQPDFINP-------SSVKNHNELLRCFSVLARVFSDRVVAFLLAKLEPNTERTRIGSLAILKH-------------------LVNSSGSFLENKEE-----------------LIVAGVQILLNE-SNLKVGSFV---SPLALRAMCENILQLLTTTVPVMEPVCTVTQSPMYCHVTSHVTRSSLYCHSILYVVLWPYLLECVVPEPFTHAMTAVCKSLSHLAAKRK----------------EEEDGGLAINFETQTNIPKPEAIISRLIVMSGHPLEGIGRGSHVLKLLQILSPILNPSLVEIWDSVIPKLLQYLEEHSEDPEK------WNQKAWEDLVLKLLSKSLDEADSEDWVCALGKELSHQLPLYAELPNDKNFLFKCIGIVLRKVTQKDFLQIQLNEMFNSVKHSCQIEREGCAIGLGFCAGTNLDIALIKLEQITKTDMVKKSSGILGFMKVSVAISPIFFCDIQDKTDVSTERVKSTVMLCYGYAVLYGPPSLITSRLEASVFRIISKHFSNVKDVNVKQNIIRMTELIAKALEPSRLQQPDFVLTKRSELINHMLAYIRAEPSTSITTETRALALDACASLV--YPFVLDLP-------CLTS------------------FHFYSTFNELLRLALESVDKLLKELVLRDPVLPTLQNIFKHIENPWLISILDPERDRAMDCALTLLNEFKDNM-LVSADGANFTAIGPILARIVPRCTDPLITVRQNAIDSIQTLLRMSARYQ-GYSPDSRDDLIDALATLQQRAQEEDATIMFSVASDLSKVYTVRYIQFLFHVLRRFDITKCVPLYVLCTIRCTQVIAKKIPCHLLPGFIFTLMEGLTDSHSYSSSGACVVFNSVIKIRGQEMRKEV-SMRTRYH----LLRD------------LCFRRLIPTYHT------------TDLYLKRLPDECCFCVALINNTMAH-----YEFRSDYFRSQITCGLTEMFR--------AEDATDVILEN------------VPRLFSAVLSRLGTCVGLLPPEPPKDAKKGS-----GPHIDPLSCALDCIMSLLDRCQYTKLSDFIAKEDLWKHFRKEETFPEGITLLARGLCLAAPQHVAKVVNCFQALLCSVYDSQRIVVSAFFSELIDQQCS---QDLVEVLMNSLMGRLVDSSRVVRKYCIRGLGNISSASDAQVKKYSTTILSAMMAGMDDKDDPEDEITLEAMSGLSRILARLDENNVRQILINICLRVRPCFEKEKDSVRAAAFTLFGALSRFGDGPSRAPYMEQVHTNLMSVLLHMNEEP--DVAKACKGCLRAVGPL--------------MCSDAINAMFQKHLLEEGHLHYGEFMNDLSRLIIADFPEKISFYSMGCVSFFKSSRDDIKANAALFLGFVLGNLPVANRDDISKDHICSALIMLLKDPSPKVRCKAAEAMSLLYEY 1495          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Medaka
Match: mroh1 (maestro heat like repeat family member 1 [Source:NCBI gene;Acc:101170544])

HSP 1 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 499/1752 (28.48%), Postives = 897/1752 (51.20%), Query Frame = 2
Query:  110 TELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDII-SLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKG--KCNSVKHIQYSCHV--WLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLA--IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLH 5335
            T+++ +   L++   D++   +E +++S+++LG ++P  +L++   +L   K  K+ + HRV +L ++  I+  ++ D+      I  II    DE+T SKE+LP+WQ  A+D+LV +   Y + IM  ++ K QP VLPH+FV+  L  ++ +N Y MV +L+ I+  ML +L +AK DN +WV +++   F ++ILEY+AN D+APDP V   +F   I++A+++ F  W+ ++E KLR  V +A+G+M  ++  +  E  +PK+I  I+  YKK+ E Y ++K+L QV        +D+S                  +   S   E +    +  L  Q C             +  +++N NE+ RCF+ +   +PD+L+   L++LE   E+ ++ +L +LRH+I+S    +  K+  I++ ++    ++            SN VK ++   I AM    YL   GG  L+ FIV+ CAL    +   +            + +TN  LR +C+N L L ++T+  +  VLWP L+  L P + ++A   +C S+  L S         + +   E +F        ID+   VN+P PQ LM RL+V A  P +    G   L  +Q+L  N H N  ++W+  IP L+          LE       D  QW+E +LKL+++++  I +E W         + +S Y+   +E+ FL++C+G  L +   K F+ KQL  I  + RH++  ER G A+G GLCA +HL+  LAKLE +  ++A K++  +F L KD+    +   +E +++++IL  G     A PE + +R++ ++++ +  +    KD  +   +++S+ L+A+A+     K  Y F  + +L+S +L +I++E + +L   +R + M T  NL+ L P +T  E   +L +C+++VF+LPP+    +K KE  F D      L   T+  L EL+K++L    +      ++K I T   S  +H RERA+     +L  + D +N    N    + +G L G L PR +DP    R   IDC+     IQL+ E    D + D+   ++P  K+ L+  D ++L+   +D+TK++ KR+   ++  L+  LFEGL D+Q N   A  V+ N L + R   L + V  +L  LH  + S+  +  ++ V + + IL+SQ+L   +NT + Q LP D   +EI  ++  D  +  + +  +ME      P+ +++++  + G  K  +   +  +C +   L   NC +   S            ++ +LF+           CL     ++   S  + N      I    +  + L+  L   Q  E+ + +     WD ++     ++ + LLA+++  +    +  II  +  F N+ YE  RI VT F+ S ++         LID+++  ++ R+ D C  VR L++ G+GN+   S   V ++A  LL+A+  GM+++ D    + + AM GL+ ++  L EK+I  ++V + +++    E ++ ++R ++  L G+L++  +G     F  +I++V+V LL+HL DP+ +V++A K A++   P+  + QI+      +++ N L+D        D +LH+GEF ND +K         +N   +  + +FKS++PE+ A++ + IG L+ NL ++  + L    +   L+ LL+  +  VR + AEA+   H
Sbjct:    4 TDVEQVTLALLDAANDKDPAVQEQVRKSVLTLGKQQPDRVLAMCQDYL--LKHPKLVVIHRVVILQTIELIVSTRIEDVSASR--IKSIISLASDEMTRSKEVLPDWQQAASDILVAVGNKYINDIMEEILSKFQPGVLPHFFVVQTLANLSDSNVYGMVPFLNAILGTMLPMLGIAKQDNMKWVFSSALCHFSDSILEYLANLDKAPDPTVRKDTFCSEIYAAYDILFNTWIQSREPKLRLTVAEAVGSMCHLMPSDKLEEQIPKIIPTIMSLYKKNNEHYVISKSLCQV--------IDAS------------------VNMGSRVLETQLDGLLFVLHQQVCAP-------VDYSDPPTVKNHNEILRCFSLLVNSFPDRLVMFVLQKLENSNERSRMGSLAVLRHLINSSTATMESKKLLILASIRQPMADH------------SNKVKKRVVQVISAMAHHGYLELEGGELLVRFIVQNCALPDTFQRSQRPTD--------PEEVTNEALRTMCDNTLHLLTTTVGRLADVLWPKLLYYLTPSQYSNATSPLCKSLIVLGS---------KKKTGQEPSFN-------IDFKQEVNLPSPQTLMIRLLVNAAFPFNSRGHGAPSLSLLQVLSINIHPNAETLWEKEIPPLL--------AMLEESTAESLDKKQWDEKMLKLLSETLAVIENEKWVCSLAAEATKYLSTYNNAQEEKSFLYRCIGVTLQHCFNKEFVKKQLQEILLAARHNDAVEREGVAMGIGLCANSHLEGTLAKLEEFGKSDAFKKSQSIFNLLKDR----NEVEVEKVKSTLILCYGQVALNAPPETILNRIDQDILRSISKHFN-TKDLTMKLSLIQSVGLIAKAIGVCVKKQGYVFSRKQELISVMLDFIKSEQTDSLRTPVRHLVMSTCANLLTLEPALTENESFDLLKVCVNSVFSLPPETHTPEKIKEEDFLDPKQRQALYKDTLAALQELLKSVLARDPTPDGLQNVFKHIETWLNSGRDHERERAIIVTSHILAYFLDNLNV--KNMVSFHNVGALLGRLSPRCSDPLPAIRAAAIDCIYSLLYIQLRYEGFSLDYKDDAVEGLLP-FKDELENPDHSVLYKTCSDLTKVMSKRLPQQQLTTLVFMLFEGLVDSQTNCCRASSVILNTLLKNRGGGLQDLVPEMLEVLHVCLQSITDEQVKVAVGQTVLILASQHLQTVINTLINQPLPYDSWTSEIWMSLGADPIVATQIIEMVMEKLVVMAPYVDKKEMMTRGGTTKVATSPPLAMTCGLKELLLNGNCQEPTVS------------LFPRLFS-----------CLTVRLGASVGVSAPKDNTTKNPSIHVAGVAADALRILLARVQLDEVSKRLEEDKAWDAIKEPSTHITGVTLLAKAMAKHAGPRLPAIIECMCPFLNNIYECQRITVTAFF-SELLNHHVVTELMLIDVLLNNMMERVSDPCCTVRMLAVRGLGNIATGSPEKVNKYAKELLAAMSSGMEEKDDPGKLIAHEAMSGLSKVLQHLDEKNIHLLVVYIFMKIKPFLESENDDIRYASILLMGNLSKFGSGEPV--FKDQIHNVLVSLLLHLVDPNPQVVKASKFAMRVCAPVVGSEQIT------AMFQNHLHD--------DKSLHYGEFINDLTKYLIQDFPGMLNFYHISVIQFFKSNWPEVRAAAAMFIGFLLGNLHQEHFSQLNMATVTNGLVMLLQDSDPVVRVKAAEAMGQFH 1626          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Medaka
Match: mroh1 (maestro heat like repeat family member 1 [Source:NCBI gene;Acc:101170544])

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 499/1760 (28.35%), Postives = 897/1760 (50.97%), Query Frame = 2
Query:  110 TELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKY--------NKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDII-SLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKG--KCNSVKHIQYSCHV--WLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLA--IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLH 5335
            T+++ +   L++   D++   +E +++S+++LG ++P  +L++   +L   K  K+ + HRV +L ++  I+  ++ D+      I  II    DE+T SKE+LP+WQ  A+D+LV +   Y + IM  ++ K QP VLPH+FV+  L  ++ +N Y MV +L+ I+  ML +L +AK DN +WV +++   F ++ILEY+AN D+APDP V   +F   I++A+++ F  W+ ++E KLR  V +A+G+M  ++  +  E  +PK+I  I+  YKK+ E Y ++K+L QV        +D+S                  +   S   E +    +  L  Q C             +  +++N NE+ RCF+ +   +PD+L+   L++LE   E+ ++ +L +LRH+I+S    +  K+  I++ ++    ++            SN VK ++   I AM    YL   GG  L+ FIV+ CAL    +   +            + +TN  LR +C+N L L ++T+  +  VLWP L+  L P + ++A   +C S+  L S         + +   E +F        ID+   VN+P PQ LM RL+V A  P +    G   L  +Q+L  N H N  ++W+  IP L+          LE       D  QW+E +LKL+++++  I +E W         + +S Y+   +E+ FL++C+G  L +   K F+ KQL  I  + RH++  ER G A+G GLCA +HL+  LAKLE +  ++A K++  +F L KD+    +   +E +++++IL  G     A PE + +R++ ++++ +  +            KD  +   +++S+ L+A+A+     K  Y F  + +L+S +L +I++E + +L   +R + M T  NL+ L P +T  E   +L +C+++VF+LPP+    +K KE  F D      L   T+  L EL+K++L    +      ++K I T   S  +H RERA+     +L  + D +N    N    + +G L G L PR +DP    R   IDC+     IQL+ E    D + D+   ++P  K+ L+  D ++L+   +D+TK++ KR+   ++  L+  LFEGL D+Q N   A  V+ N L + R   L + V  +L  LH  + S+  +  ++ V + + IL+SQ+L   +NT + Q LP D   +EI  ++  D  +  + +  +ME      P+ +++++  + G  K  +   +  +C +   L   NC +   S            ++ +LF+           CL     ++   S  + N      I    +  + L+  L   Q  E+ + +     WD ++     ++ + LLA+++  +    +  II  +  F N+ YE  RI VT F+ S ++         LID+++  ++ R+ D C  VR L++ G+GN+   S   V ++A  LL+A+  GM+++ D    + + AM GL+ ++  L EK+I  ++V + +++    E ++ ++R ++  L G+L++  +G     F  +I++V+V LL+HL DP+ +V++A K A++   P+  + QI+      +++ N L+D        D +LH+GEF ND +K         +N   +  + +FKS++PE+ A++ + IG L+ NL ++  + L    +   L+ LL+  +  VR + AEA+   H
Sbjct:    4 TDVEQVTLALLDAANDKDPAVQEQVRKSVLTLGKQQPDRVLAMCQDYL--LKHPKLVVIHRVVILQTIELIVSTRIEDVSASR--IKSIISLASDEMTRSKEVLPDWQQAASDILVAVGNKYINDIMEEILSKFQPGVLPHFFVVQTLANLSDSNVYGMVPFLNAILGTMLPMLGIAKQDNMKWVFSSALCHFSDSILEYLANLDKAPDPTVRKDTFCSEIYAAYDILFNTWIQSREPKLRLTVAEAVGSMCHLMPSDKLEEQIPKIIPTIMSLYKKNNEHYVISKSLCQV--------IDAS------------------VNMGSRVLETQLDGLLFVLHQQVCAP-------VDYSDPPTVKNHNEILRCFSLLVNSFPDRLVMFVLQKLENSNERSRMGSLAVLRHLINSSTATMESKKLLILASIRQPMADH------------SNKVKKRVVQVISAMAHHGYLELEGGELLVRFIVQNCALPDTFQRSQRPTD--------PEEVTNEALRTMCDNTLHLLTTTVGRLADVLWPKLLYYLTPSQYSNATSPLCKSLIVLGS---------KKKTGQEPSFN-------IDFKQEVNLPSPQTLMIRLLVNAAFPFNSRGHGAPSLSLLQVLSINIHPNAETLWEKEIPPLL--------AMLEESTAESLDKKQWDEKMLKLLSETLAVIENEKWVCSLAAEATKYLSTYNNAQEEKSFLYRCIGVTLQHCFNKEFVKKQLQEILLAARHNDAVEREGVAMGIGLCANSHLEGTLAKLEEFGKSDAFKKSQSIFNLLKDR----NEVEVEKVKSTLILCYGQVALNAPPETILNRIDQDILRSISKHFNTKVLGIKVETKDLTMKLSLIQSVGLIAKAIGVCVKKQGYVFSRKQELISVMLDFIKSEQTDSLRTPVRHLVMSTCANLLTLEPALTENESFDLLKVCVNSVFSLPPETHTPEKIKEEDFLDPKQRQALYKDTLAALQELLKSVLARDPTPDGLQNVFKHIETWLNSGRDHERERAIIVTSHILAYFLDNLNV--KNMVSFHNVGALLGRLSPRCSDPLPAIRAAAIDCIYSLLYIQLRYEGFSLDYKDDAVEGLLP-FKDELENPDHSVLYKTCSDLTKVMSKRLPQQQLTTLVFMLFEGLVDSQTNCCRASSVILNTLLKNRGGGLQDLVPEMLEVLHVCLQSITDEQVKVAVGQTVLILASQHLQTVINTLINQPLPYDSWTSEIWMSLGADPIVATQIIEMVMEKLVVMAPYVDKKEMMTRGGTTKVATSPPLAMTCGLKELLLNGNCQEPTVS------------LFPRLFS-----------CLTVRLGASVGVSAPKDNTTKNPSIHVAGVAADALRILLARVQLDEVSKRLEEDKAWDAIKEPSTHITGVTLLAKAMAKHAGPRLPAIIECMCPFLNNIYECQRITVTAFF-SELLNHHVVTELMLIDVLLNNMMERVSDPCCTVRMLAVRGLGNIATGSPEKVNKYAKELLAAMSSGMEEKDDPGKLIAHEAMSGLSKVLQHLDEKNIHLLVVYIFMKIKPFLESENDDIRYASILLMGNLSKFGSGEPV--FKDQIHNVLVSLLLHLVDPNPQVVKASKFAMRVCAPVVGSEQIT------AMFQNHLHD--------DKSLHYGEFINDLTKYLIQDFPGMLNFYHISVIQFFKSNWPEVRAAAAMFIGFLLGNLHQEHFSQLNMATVTNGLVMLLQDSDPVVRVKAAEAMGQFH 1635          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Medaka
Match: mroh1 (maestro heat like repeat family member 1 [Source:NCBI gene;Acc:101170544])

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 499/1760 (28.35%), Postives = 897/1760 (50.97%), Query Frame = 2
Query:  110 TELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGP-EKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEA-KRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKY--------NKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE-MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDII-SLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKG--KCNSVKHIQYSCHV--WLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLA--IGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLH 5335
            T+++ +   L++   D++   +E +++S+++LG ++P  +L++   +L   K  K+ + HRV +L ++  I+  ++ D+      I  II    DE+T SKE+LP+WQ  A+D+LV +   Y + IM  ++ K QP VLPH+FV+  L  ++ +N Y MV +L+ I+  ML +L +AK DN +WV +++   F ++ILEY+AN D+APDP V   +F   I++A+++ F  W+ ++E KLR  V +A+G+M  ++  +  E  +PK+I  I+  YKK+ E Y ++K+L QV        +D+S                  +   S   E +    +  L  Q C             +  +++N NE+ RCF+ +   +PD+L+   L++LE   E+ ++ +L +LRH+I+S    +  K+  I++ ++    ++            SN VK ++   I AM    YL   GG  L+ FIV+ CAL    +   +            + +TN  LR +C+N L L ++T+  +  VLWP L+  L P + ++A   +C S+  L S         + +   E +F        ID+   VN+P PQ LM RL+V A  P +    G   L  +Q+L  N H N  ++W+  IP L+          LE       D  QW+E +LKL+++++  I +E W         + +S Y+   +E+ FL++C+G  L +   K F+ KQL  I  + RH++  ER G A+G GLCA +HL+  LAKLE +  ++A K++  +F L KD+    +   +E +++++IL  G     A PE + +R++ ++++ +  +            KD  +   +++S+ L+A+A+     K  Y F  + +L+S +L +I++E + +L   +R + M T  NL+ L P +T  E   +L +C+++VF+LPP+    +K KE  F D      L   T+  L EL+K++L    +      ++K I T   S  +H RERA+     +L  + D +N    N    + +G L G L PR +DP    R   IDC+     IQL+ E    D + D+   ++P  K+ L+  D ++L+   +D+TK++ KR+   ++  L+  LFEGL D+Q N   A  V+ N L + R   L + V  +L  LH  + S+  +  ++ V + + IL+SQ+L   +NT + Q LP D   +EI  ++  D  +  + +  +ME      P+ +++++  + G  K  +   +  +C +   L   NC +   S            ++ +LF+           CL     ++   S  + N      I    +  + L+  L   Q  E+ + +     WD ++     ++ + LLA+++  +    +  II  +  F N+ YE  RI VT F+ S ++         LID+++  ++ R+ D C  VR L++ G+GN+   S   V ++A  LL+A+  GM+++ D    + + AM GL+ ++  L EK+I  ++V + +++    E ++ ++R ++  L G+L++  +G     F  +I++V+V LL+HL DP+ +V++A K A++   P+  + QI+      +++ N L+D        D +LH+GEF ND +K         +N   +  + +FKS++PE+ A++ + IG L+ NL ++  + L    +   L+ LL+  +  VR + AEA+   H
Sbjct:    4 TDVEQVTLALLDAANDKDPAVQEQVRKSVLTLGKQQPDRVLAMCQDYL--LKHPKLVVIHRVVILQTIELIVSTRIEDVSASR--IKSIISLASDEMTRSKEVLPDWQQAASDILVAVGNKYINDIMEEILSKFQPGVLPHFFVVQTLANLSDSNVYGMVPFLNAILGTMLPMLGIAKQDNMKWVFSSALCHFSDSILEYLANLDKAPDPTVRKDTFCSEIYAAYDILFNTWIQSREPKLRLTVAEAVGSMCHLMPSDKLEEQIPKIIPTIMSLYKKNNEHYVISKSLCQV--------IDAS------------------VNMGSRVLETQLDGLLFVLHQQVCAP-------VDYSDPPTVKNHNEILRCFSLLVNSFPDRLVMFVLQKLENSNERSRMGSLAVLRHLINSSTATMESKKLLILASIRQPMADH------------SNKVKKRVVQVISAMAHHGYLELEGGELLVRFIVQNCALPDTFQRSQRPTD--------PEEVTNEALRTMCDNTLHLLTTTVGRLADVLWPKLLYYLTPSQYSNATSPLCKSLIVLGS---------KKKTGQEPSFN-------IDFKQEVNLPSPQTLMIRLLVNAAFPFNSRGHGAPSLSLLQVLSINIHPNAETLWEKEIPPLL--------AMLEESTAESLDKKQWDEKMLKLLSETLAVIENEKWVCSLAAEATKYLSTYNNAQEEKSFLYRCIGVTLQHCFNKEFVKKQLQEILLAARHNDAVEREGVAMGIGLCANSHLEGTLAKLEEFGKSDAFKKSQSIFNLLKDR----NEVEVEKVKSTLILCYGQVALNAPPETILNRIDQDILRSISKHFNTKVLGIKVETKDLTMKLSLIQSVGLIAKAIGVCVKKQGYVFSRKQELISVMLDFIKSEQTDSLRTPVRHLVMSTCANLLTLEPALTENESFDLLKVCVNSVFSLPPETHTPEKIKEEDFLDPKQRQALYKDTLAALQELLKSVLARDPTPDGLQNVFKHIETWLNSGRDHERERAIIVTSHILAYFLDNLNV--KNMVSFHNVGALLGRLSPRCSDPLPAIRAAAIDCIYSLLYIQLRYEGFSLDYKDDAVEGLLP-FKDELENPDHSVLYKTCSDLTKVMSKRLPQQQLTTLVFMLFEGLVDSQTNCCRASSVILNTLLKNRGGGLQDLVPEMLEVLHVCLQSITDEQVKVAVGQTVLILASQHLQTVINTLINQPLPYDSWTSEIWMSLGADPIVATQIIEMVMEKLVVMAPYVDKKEMMTRGGTTKVATSPPLAMTCGLKELLLNGNCQEPTVS------------LFPRLFS-----------CLTVRLGASVGVSAPKDNTTKNPSIHVAGVAADALRILLARVQLDEVSKRLEEDKAWDAIKEPSTHITGVTLLAKAMAKHAGPRLPAIIECMCPFLNNIYECQRITVTAFF-SELLNHHVVTELMLIDVLLNNMMERVSDPCCTVRMLAVRGLGNIATGSPEKVNKYAKELLAAMSSGMEEKDDPGKLIAHEAMSGLSKVLQHLDEKNIHLLVVYIFMKIKPFLESENDDIRYASILLMGNLSKFGSGEPV--FKDQIHNVLVSLLLHLVDPNPQVVKASKFAMRVCAPVVGSEQIT------AMFQNHLHD--------DKSLHYGEFINDLTKYLIQDFPGMLNFYHISVIQFFKSNWPEVRAAAAMFIGFLLGNLHQEHFSQLNMATVTNGLVMLLQDSDPVVRVKAAEAMGQFH 1635          
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Planmine SMEST
Match: SMESG000073404.1 (SMESG000073404.1)

HSP 1 Score: 3481.42 bits (9026), Expect = 0.000e+0
Identity = 1754/1759 (99.72%), Postives = 1756/1759 (99.83%), Query Frame = 2
Query:   65 MQNDKTEEDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLXXXXXXXXXVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLISNCLRRLEGPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYXXXXXXXXXXXXXXXXFDIIQWEELLLKLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTXXXXXXXXXXNCLPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASAXXXXXXXXXXXXXXSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 5341
            MQNDKTEEDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKIS GHRVSLLLSMNNILKQK+YDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLNNEIENIINVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLI NCLRRLEGPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIEC IDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYLEKSNNNELESDNDNEFDIIQWEELLLKLVAKSIEHINDEDW+VEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTSIIIGCSSSINCLPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASANLDNLIDIIIGLLLSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY
Sbjct:    1 MQNDKTEEDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIKEPKLILSLILSFLNKSKTKKISQGHRVSLLLSMNNILKQKIYDIHNFNDLISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQPSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWVIATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNTKESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVTKALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLNNEIENIINVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLIGNCLRRLEGPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGENLTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCALSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRSVLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNFESSDIECTIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQILVHNFHENLPSIWDIIIPKLILYLEKSNNNELESDNDNEFDIIQWEELLLKLVAKSIEHINDEDWSVEFGEAMGQQISLYDKLPKERGFLFKCLGTILANSTKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLELYCANEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPELVPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYKFELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLELQRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELIKTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEINEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLEMGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIHDLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDIISLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIADDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWLAAMNCLQILCSNKLSCGHICLTKMYSKLFTSIIIGCSSSINCLPFTGKSNEKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLENEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFYGSTIIGIASANLDNLIDIIIGLLLSRLGDKCLEVRRLSLIGIGNVGQCSDVLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRDILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSVIVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLNDFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYPELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTAEAISLLHMY 1759          
The following BLAST results are available for this feature:
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MROH10.000e+027.32maestro heat like repeat family member 1 [Source:H... [more]
MROH10.000e+027.35maestro heat like repeat family member 1 [Source:H... [more]
MROH10.000e+027.35maestro heat like repeat family member 1 [Source:H... [more]
MROH2A1.868e-7421.29maestro heat like repeat family member 2A [Source:... [more]
MROH2A2.916e-7021.08maestro heat like repeat family member 2A [Source:... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hpo-271.766e-11722.47pep chromosome:WBcel235:I:5906662:5918229:1 gene:W... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
c11.11.933e-5420.73gene:FBgn0040236 transcript:FBtr0343368[more]
c11.11.933e-5420.73gene:FBgn0040236 transcript:FBtr0071326[more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX088600.10.000e+028.38maestro heat-like repeat family member 1 [Source:N... [more]
mroh10.000e+028.45maestro heat-like repeat family member 1 [Source:Z... [more]
mroh10.000e+028.32maestro heat-like repeat family member 1 [Source:Z... [more]
mroh16.678e-9330.06maestro heat-like repeat family member 1 [Source:Z... [more]
mroh13.894e-7126.20maestro heat-like repeat family member 1 [Source:Z... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rusc21.128e-4925.50RUN and SH3 domain containing 2 [Source:Xenbase;Ac... [more]
rusc21.157e-4425.70RUN and SH3 domain containing 2 [Source:Xenbase;Ac... [more]
rusc21.349e-4425.70RUN and SH3 domain containing 2 [Source:Xenbase;Ac... [more]
rusc22.321e-4325.68RUN and SH3 domain containing 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mroh10.000e+027.12maestro heat-like repeat family member 1 [Source:M... [more]
Mroh11.417e-14928.22maestro heat-like repeat family member 1 [Source:M... [more]
Mroh11.417e-14928.22maestro heat-like repeat family member 1 [Source:M... [more]
Mroh2a5.877e-7421.02maestro heat-like repeat family member 2A [Source:... [more]
Mroh2a4.305e-7121.10maestro heat-like repeat family member 2A [Source:... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NDA8|MROH1_HUMAN0.000e+027.35Maestro heat-like repeat-containing protein family... [more]
sp|Q54F23|MROH1_DICDI1.140e-17527.39Maestro heat-like repeat-containing protein family... [more]
sp|A7E2Y6|MROH1_BOVIN3.700e-16925.94Maestro heat-like repeat-containing protein family... [more]
sp|A6NES4|MRO2A_HUMAN8.969e-7421.29Maestro heat-like repeat-containing protein family... [more]
sp|D3Z750|MRO2A_MOUSE3.011e-7021.10Maestro heat-like repeat-containing protein family... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I4S60.000e+033.99maestro heat-like repeat-containing protein family... [more]
A0A1S3HHU50.000e+034.11maestro heat-like repeat-containing protein family... [more]
A0A1S3I3J30.000e+033.80maestro heat-like repeat-containing protein family... [more]
A0A1S3HJ860.000e+033.91maestro heat-like repeat-containing protein family... [more]
A0A210QHK20.000e+033.41Maestro heat-like repeat-containing protein family... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mroh10.000e+029.11maestro heat like repeat family member 1 [Source:N... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003856.12.075e-6739.65pep scaffold:Pmarinus_7.0:GL480076:13891:22992:-1 ... [more]
ENSPMAT00000010663.11.670e-5628.21pep scaffold:Pmarinus_7.0:GL479584:32745:44495:-1 ... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464700.000e+027.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mroh10.000e+028.48maestro heat like repeat family member 1 [Source:N... [more]
mroh10.000e+028.35maestro heat like repeat family member 1 [Source:N... [more]
mroh10.000e+028.35maestro heat like repeat family member 1 [Source:N... [more]
back to top
BLAST of Maestro heat-like repeat-containing protein family member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000073404.10.000e+099.72SMESG000073404.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005250 ID=SMED30005250|Name=Maestro heat-like repeat-containing protein family member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5396bp
CCTTTGTTCAAATTTCAAATTTTGTAATATTATTCCTTTTATGAAAATAA
AGATTTAAAGAGAAATGCAAAACGATAAAACCGAAGAAGATGTTATATAT
GTTAAAGGAACTGAATTAGATATTTTAGCAAAAAATCTTGTTGAGTGTGT
TTATGATGAAAATGAAGAAACTCGTGAAATAATGCAACAATCCCTTATAT
CTCTTGGCATTAAAGAACCAAAATTAATACTTAGTTTAATCTTATCGTTT
TTAAATAAATCCAAAACTAAGAAAATTTCACTGGGTCATAGAGTGTCTTT
GCTCTTGTCAATGAATAATATTTTAAAGCAAAAAGTTTATGATATACATA
ATTTTAATGACTTGATATCAAAAATAATCAAACAAGTTATTGATGAATTG
ACTTCATCTAAAGAAATACTCCCTGAATGGCAATCAAAAGCTAATGATGT
TTTGGTAACAATGAGTACTCATTATTGTCACTTAATCATGCCTCCACTTG
TTGATAAATTACAACCAAGTGTATTACCTCATTATTTCGTCATTCACGTT
CTCGGAGCAATGGCGGTCAATAATCCCTATGACATGGTGTCTTATCTTTC
ATGCATTATTACCCAAATGCTAACACTACTTTCATTAGCGAAGACTGATA
ATTTTCGGTGGGTTATTGCAACAAGTTTTAGTCAATTTTGTGAAGCTATT
TTGGAGTATGTTGCTAATCCTGATAGAGCTCCAGATCCTAATGTTACCAT
CGTTTCATTTTCACAATATATATTCTCAGCCTTCGAGGTTTTCTTTACGA
ATTGGTTAAATACAAAAGAGTCAAAACTACGAAAAGCTGTATTGGATGCA
ATCGGGAACATGGTGTTTATTATAGAAAGAAACAATTTTGAACCAATCTT
ACCAAAATTAATAACTGGCATAATCTTACAATATAAAAAACACACTGAAT
CATATCATGTTACTAAAGCTTTATCGCAAGTTTTACAATCTGCTACAGGC
CAATATGTTGATTCTAGTAGCCACCCAACCTTCCATCCAGATTCACCAAC
AACAGCTGAATCTCCACTCATAATAGAATGCGCTTCATTAAACAATGAAA
TTGAAAATATTATCAACGTGTTATTCCTTCAATTACAACAATGCCTGGAT
GCGAGTGCTATAGGAAATTTGACATCTCAACAAGAATTAAATTCTATTAG
AAATCAAAATGAAGTTAAAAGATGTTTCACTACTATTTGCATGCCATATC
CCGATCAACTCATCAGTAATTGTCTACGTAGACTAGAGGGCCCAGAAAAA
CAAAAAATTTCTGCACTGTTAATTTTGCGACACATTATTAGTTCATGTGA
CAAGCAACTTATTCATAAACGATCACAAATAATTTCTTGCCTTCAAAATT
ATACTGGGGAAAATTTAACCAATTCAAGTAACAGTTCAACCTTTCAAGTG
AGCAATAATGTGAAGATGCAGTTGTCTCACACGATTATTGCTATGGGAGG
TAAAAATTATCTTTCTGAAGTTGGAGGATTAAAGCTTATTGAATTTATCG
TCCGTCAATGTGCTCTTTCAACTAAAACAGAATTTAAAAACAAAAAATTG
AAATTCAATCTATCAGACAATTTACATAATCAGGTCATTACAAATGCACA
GTTACGAAATCTATGCGAAAATGTTTTAAAATTAAGTAGCAGCACAATTA
CATCCATGCGATCAGTTCTGTGGCCCTACCTCATGGAATTACTTGTTCCT
GTTGAATTAACAGATGCAGTTGGAACAATATGCTGTTCTATTTATAATCT
TTTCTCCAATGATACTCAGCCATTACCCGAAATTGAAACGGAAAATCAAG
ATGAATCAAATTTTGAGTCTTCAGACATTGAATGCATAATAGACTATGAT
TTGCATGTTAACATTCCTGGACCCCAGTTTTTAATGTCAAGATTGATAGT
TCTTGCTGGAGTGCCAACTCACTGTAATTATCGTGGTATATATATTTTGA
AAGCAATGCAAATTTTGGTGCACAATTTTCACGAGAATTTACCATCAATA
TGGGATATTATCATACCAAAACTAATATTGTATTTGGAAAAATCAAATAA
TAATGAATTGGAGAGTGACAATGATAATGAATTTGATATCATTCAATGGG
AAGAATTATTATTAAAGCTTGTTGCTAAATCAATCGAGCATATTAACGAC
GAAGATTGGACTGTTGAATTTGGAGAGGCTATGGGACAACAAATCTCGTT
ATATGATAAATTACCAAAAGAAAGAGGATTCTTATTCAAATGTCTGGGTA
CCATATTGGCTAATTCAACCAAAAAGACTTTTATTGACAAGCAATTGGAC
CTTATATTTCATTCAACCAGGCATTCTGAAAATGATGAACGAATGGGATT
TGCAGTTGGATTTGGACTGTGTGCTGCAGCTCATTTGGATACAGTTCTAG
CAAAACTTGAATTGTATTGTGCAAATGAGGCAAAGCGAACTACTGGACTC
TTTGGTTTATTTAAAGATAAAGTTCATCCATCTGATTCATCAAACATTGA
ATTATTACGTGCTAGCATAATTTTAGCAAGTGGAAATGCTATATTCTACG
CAAAACCGGAACTTGTACCATCAAGATTAGAGTCAAACGTAATTAAAGTC
CTTCAGAATAATATCAAATATAATAAAGATAAAGTTATAAATCGAATAAT
GGTGGAAAGTATAGATTTAGTTGCTCGTGCAGTTAATTATAATAAATTAA
AGCATAATTACAAATTTGAATTAAGAAATGATTTAGTGTCTTCCTTGTTG
AGTTACATTGAAGCGGAAAGTTCAACTACTTTGTATAATGATTTACGGGG
AATAGCAATGAGGACTATAGGAAACTTAATAGTTTTGCATCCTCCTATTA
CGAATTTGGAATTACAACGAGTTCTGAATATATGTATTGACAATGTGTTC
AATTTGCCTCCGGATGGAATTCCCCTAAAAAAATCGAAAGAAATTCCATT
TGATGATGCTCATACATTTACTGTTCTTATGGACAAGACTATGAATAATT
TGAATGAATTAATTAAAACAATATTAAAAACTTATTTTTCGGATCTAACA
TTTACAGAAATTTATAAGGTTATTCGTACTAGATTTGTATCGGAGCACGA
GCATATTAGAGAAAGAGCTTTATCGACTGTTTATATTTTATTAAATTCAT
ATTATGATGAAATAAATGAAGTCAATAATAATGGAAAACCTCTTAATTGC
ATTGGCACATTATTCGGTGATCTCATTCCACGATTGGCAGATCCAAACAT
TAATAATCGTCAATTGACAATTGATTGCGTGGCAGTCGCCTTTAAAATTC
AGCTGAAATTAGAAATGGGACGTGATCCTGAAACAGATTCTTCATTGAAT
ATGATTCCTACAATAAAAGAACGATTGAAAAAATTTGATAGTAATATTCT
ATTTGCGGCTGTGAATGACATCACCAAAATGATTTGCAAGCGTATCAATC
CTGGGAAGATTCATGATTTGTTACAGAGTCTTTTTGAAGGTTTAAAAGAT
ACCCAAAAAAACGGTGCGTCAGCAGTTGGTGTGATGTTTAACGTTCTTTT
TAGAACTCGATATTCTGACCTCAATGAAGAAGTAGCATCTATCCTAACAA
AGCTACATGATATAATATCTTTGCTAAAAGATAATCCAAGAATGGGAGTA
CTGCGAGCTTTGAAAATATTATCTTCGCAATATTTGATTGAGTGTCTTAA
TACAGCGATGGCACAAACTTTGCCATTAGACGAAGTATGGACGGAAATTT
TATGTAATATTGCAGACGATGAAGCAATTTTAGAAAAATGCTTGGTGCAT
TTAATGGAAGTTCATTCCAGAACGATACCATTTGAAGAACGAGAAGATCT
AAGCCAGAAAAAAGGAAAATGTAATTCAGTAAAACATATTCAATATTCAT
GTCACGTTTGGCTGGCTGCGATGAATTGTCTTCAGATCTTATGCTCAAAT
AAACTTAGCTGTGGTCATATTTGTTTAACGAAAATGTATAGTAAATTGTT
CACTAGTATTATTATTGGCTGTAGCTCATCAATTAACTGTTTACCATTTA
CTGGAAAAAGTAATGAGAAAAAAAGCGGTTTGGAAGCCAATTTAGCTATC
GGAATTCGCCCCATTACTATCTGTTGTGAAACACTGAAAAACTTTTTAAC
AACCACTCAATCTCATGAAATAATTGAAGAAATCAATGTTCAAAATGGTT
GGGATAAATTAGAAAATGAGGATGAATTTATGAGTTTTATGGCTTTGCTC
GCTAGGAGTATTTGTATTAATAAACTATCAGAAATCGGCAATATTATTAC
AAATCTTAGTCTTTTTTCAAATTCAAATTATGAACAGCACAGAATCCTGG
TTACTGGGTTTTATGGATCGACGATTATCGGGATTGCTTCAGCTAATTTA
GACAATTTGATTGATATAATTATTGGTCTTTTATTGTCAAGATTGGGTGA
TAAATGTCTTGAAGTAAGGCGATTATCGTTGATTGGTATAGGCAATGTCG
GACAGTGTAGTGATGTACTTGTTCAGAGGCACGCTACGTCTTTATTGTCA
GCTCTTCTTATGGGAATGGATGATCGTAAAGATGCTGATGATAAGCTGAT
TAACGCAGCAATGGATGGATTAGCCATTTTGATTACTAAATTAACAGAAA
AGGATATTCGCGATATTCTTGTTACTGTGTGTCTTAGAATGCTATCGTGT
TATGAACGAGATTCTGCTAATGTTCGTGCTTCAGCGTTTCGTTTATTTGG
CTCCTTAGCACGTTTAGCTACTGGACCTTCATATAACCGTTTTTTATCAG
AGATTAATTCAGTTATTGTACCACTACTTGTACATTTAGAGGATCCTAGT
ACAGAGGTTATACGAGCTTGTAAAGTAGCTTTAAAACAAATTATGCCTTT
ATATTCTACAATTCAAATATCTGATTCTTCGAATTCAAATTCATTGTATA
CTAATAAGCTTAATGATTTCATAGAAACTTGTTTACGAGAAGATATTACC
TTGCATTTTGGTGAATTTGCCAATGATTTTTCAAAGATATTCGCTGTTCA
AATGTCAGATCAAGTCAATGATGTTATCATGAGGTCCTTGGTTTATTTTA
AATCTGACTATCCAGAATTAGCCGCTAGTTCAGTGTTATTAATAGGATGC
CTAATGGAAAATTTGCAAGAAAAAGAAATGACTAGCTTGCAAAAAGGTCA
AATTTGTCTGGAATTAATTCAGCTTCTCAAATATAAAAATGAGAAAGTCA
GAGCTCGTACTGCTGAAGCCATTAGTCTTTTACATATGTACTAACATTTT
ATTAAATACCAAGTGTGATTCGAAAAAAAAGATTTTTATAATTGAT
back to top

protein sequence of SMED30005250-orf-1

>SMED30005250-orf-1 ID=SMED30005250-orf-1|Name=SMED30005250-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1760bp
MQNDKTEEDVIYVKGTELDILAKNLVECVYDENEETREIMQQSLISLGIK
EPKLILSLILSFLNKSKTKKISLGHRVSLLLSMNNILKQKVYDIHNFNDL
ISKIIKQVIDELTSSKEILPEWQSKANDVLVTMSTHYCHLIMPPLVDKLQ
PSVLPHYFVIHVLGAMAVNNPYDMVSYLSCIITQMLTLLSLAKTDNFRWV
IATSFSQFCEAILEYVANPDRAPDPNVTIVSFSQYIFSAFEVFFTNWLNT
KESKLRKAVLDAIGNMVFIIERNNFEPILPKLITGIILQYKKHTESYHVT
KALSQVLQSATGQYVDSSSHPTFHPDSPTTAESPLIIECASLNNEIENII
NVLFLQLQQCLDASAIGNLTSQQELNSIRNQNEVKRCFTTICMPYPDQLI
SNCLRRLEGPEKQKISALLILRHIISSCDKQLIHKRSQIISCLQNYTGEN
LTNSSNSSTFQVSNNVKMQLSHTIIAMGGKNYLSEVGGLKLIEFIVRQCA
LSTKTEFKNKKLKFNLSDNLHNQVITNAQLRNLCENVLKLSSSTITSMRS
VLWPYLMELLVPVELTDAVGTICCSIYNLFSNDTQPLPEIETENQDESNF
ESSDIECIIDYDLHVNIPGPQFLMSRLIVLAGVPTHCNYRGIYILKAMQI
LVHNFHENLPSIWDIIIPKLILYLEKSNNNELESDNDNEFDIIQWEELLL
KLVAKSIEHINDEDWTVEFGEAMGQQISLYDKLPKERGFLFKCLGTILAN
STKKTFIDKQLDLIFHSTRHSENDERMGFAVGFGLCAAAHLDTVLAKLEL
YCANEAKRTTGLFGLFKDKVHPSDSSNIELLRASIILASGNAIFYAKPEL
VPSRLESNVIKVLQNNIKYNKDKVINRIMVESIDLVARAVNYNKLKHNYK
FELRNDLVSSLLSYIEAESSTTLYNDLRGIAMRTIGNLIVLHPPITNLEL
QRVLNICIDNVFNLPPDGIPLKKSKEIPFDDAHTFTVLMDKTMNNLNELI
KTILKTYFSDLTFTEIYKVIRTRFVSEHEHIRERALSTVYILLNSYYDEI
NEVNNNGKPLNCIGTLFGDLIPRLADPNINNRQLTIDCVAVAFKIQLKLE
MGRDPETDSSLNMIPTIKERLKKFDSNILFAAVNDITKMICKRINPGKIH
DLLQSLFEGLKDTQKNGASAVGVMFNVLFRTRYSDLNEEVASILTKLHDI
ISLLKDNPRMGVLRALKILSSQYLIECLNTAMAQTLPLDEVWTEILCNIA
DDEAILEKCLVHLMEVHSRTIPFEEREDLSQKKGKCNSVKHIQYSCHVWL
AAMNCLQILCSNKLSCGHICLTKMYSKLFTSIIIGCSSSINCLPFTGKSN
EKKSGLEANLAIGIRPITICCETLKNFLTTTQSHEIIEEINVQNGWDKLE
NEDEFMSFMALLARSICINKLSEIGNIITNLSLFSNSNYEQHRILVTGFY
GSTIIGIASANLDNLIDIIIGLLLSRLGDKCLEVRRLSLIGIGNVGQCSD
VLVQRHATSLLSALLMGMDDRKDADDKLINAAMDGLAILITKLTEKDIRD
ILVTVCLRMLSCYERDSANVRASAFRLFGSLARLATGPSYNRFLSEINSV
IVPLLVHLEDPSTEVIRACKVALKQIMPLYSTIQISDSSNSNSLYTNKLN
DFIETCLREDITLHFGEFANDFSKIFAVQMSDQVNDVIMRSLVYFKSDYP
ELAASSVLLIGCLMENLQEKEMTSLQKGQICLELIQLLKYKNEKVRARTA
EAISLLHMY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0001669acrosomal vesicle
GO:0005737cytoplasm
GO:0031410cytoplasmic vesicle
GO:0036126sperm flagellum
GO:0042995cell projection
GO:0097225sperm midpiece
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
GO:0010737protein kinase A signaling
GO:0030154cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 1408..1654
e-value: 5.1E-7
score: 30.7
NoneNo IPR availablePANTHERPTHR23120MAESTRO-RELATED HEAT DOMAIN-CONTAININGcoord: 50..310
NoneNo IPR availablePANTHERPTHR23120:SF0MAESTRO HEAT-LIKE REPEAT FAMILY MEMBER 1coord: 339..1758
coord: 50..310
NoneNo IPR availablePANTHERPTHR23120MAESTRO-RELATED HEAT DOMAIN-CONTAININGcoord: 339..1758
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 21..1246
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 854..1757