Phosphodiesterase

Overview
NamePhosphodiesterase
Smed IDSMED30005249
Length (bp)2427
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphodiesterase (SMED30005249) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30005249) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphodiesterase (SMED30005249) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30005249) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005249

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005249SMESG000020487.1 Contig4451newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005249SMESG000020487.1 Contig4451uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005249SMESG000069302.1 Contig4451newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005249SMESG000069302.1 Contig4451uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30005249SMESG000020487.1 dd_Smed_v4_13304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the whole animalSMED30005249SMESG000020487.1 dd_Smed_v4_13304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE9A (phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:8795])

HSP 1 Score: 335.109 bits (858), Expect = 2.064e-106
Identity = 154/304 (50.66%), Postives = 213/304 (70.07%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNG 1622
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+F V+ NY   PFHNF+H F V QMMYS++W   L+ K S  D+L+L+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IFS++P +  + IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    D Y +L  I + 
Sbjct:   96 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDA 399          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE9A (phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:8795])

HSP 1 Score: 335.495 bits (859), Expect = 2.754e-106
Identity = 154/304 (50.66%), Postives = 213/304 (70.07%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNG 1622
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+F V+ NY   PFHNF+H F V QMMYS++W   L+ K S  D+L+L+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IFS++P +  + IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    D Y +L  I + 
Sbjct:  122 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDA 425          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE9A (phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:8795])

HSP 1 Score: 335.495 bits (859), Expect = 3.488e-106
Identity = 154/304 (50.66%), Postives = 213/304 (70.07%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNG 1622
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+F V+ NY   PFHNF+H F V QMMYS++W   L+ K S  D+L+L+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IFS++P +  + IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    D Y +L  I + 
Sbjct:  129 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDA 432          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE9A (phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:8795])

HSP 1 Score: 336.265 bits (861), Expect = 3.696e-106
Identity = 154/304 (50.66%), Postives = 213/304 (70.07%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNG 1622
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+F V+ NY   PFHNF+H F V QMMYS++W   L+ K S  D+L+L+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IFS++P +  + IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    D Y +L  I + 
Sbjct:  155 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDA 458          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE9A (phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:8795])

HSP 1 Score: 335.109 bits (858), Expect = 4.902e-106
Identity = 154/304 (50.66%), Postives = 213/304 (70.07%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNG 1622
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+F V+ NY   PFHNF+H F V QMMYS++W   L+ K S  D+L+L+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IFS++P +  + IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    D Y +L  I + 
Sbjct:  128 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDA 431          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 164.466 bits (415), Expect = 7.812e-43
Identity = 89/275 (32.36%), Postives = 151/275 (54.91%), Query Frame = 3
Query:  795 LFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSIL------ANFDWLSQSHRDLLMMI--LIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYY 1595
            LF  F I       ++  +  +Y    +HNF HA  V Q M+ ++    L    + L+VL  + A   HD++HPGF N Y INS +ELAI YND+S LE HHL+ A  +L   +C   ++L  +Q+   R  +I  +LATDMS+H  +L   K+++       N   +   + D + ++  +I  +D+SN  +P+++  +W   + EE++ Q   EK+ GL ++P  D+  VT   SQ GFI ++++PL+E+ A L+    +++L  +    ++Y
Sbjct:  254 LFKTFEIHQSTLVTYLLNLEHHYRNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWY 528          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 164.466 bits (415), Expect = 1.748e-42
Identity = 89/275 (32.36%), Postives = 151/275 (54.91%), Query Frame = 3
Query:  795 LFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSIL------ANFDWLSQSHRDLLMMI--LIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYY 1595
            LF  F I       ++  +  +Y    +HNF HA  V Q M+ ++    L    + L+VL  + A   HD++HPGF N Y INS +ELAI YND+S LE HHL+ A  +L   +C   ++L  +Q+   R  +I  +LATDMS+H  +L   K+++       N   +   + D + ++  +I  +D+SN  +P+++  +W   + EE++ Q   EK+ GL ++P  D+  VT   SQ GFI ++++PL+E+ A L+    +++L  +    ++Y
Sbjct:  304 LFKTFEIHQSTLVTYLLNLEHHYRNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWY 578          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 164.466 bits (415), Expect = 1.975e-42
Identity = 89/275 (32.36%), Postives = 151/275 (54.91%), Query Frame = 3
Query:  795 LFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSIL------ANFDWLSQSHRDLLMMI--LIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYY 1595
            LF  F I       ++  +  +Y    +HNF HA  V Q M+ ++    L    + L+VL  + A   HD++HPGF N Y INS +ELAI YND+S LE HHL+ A  +L   +C   ++L  +Q+   R  +I  +LATDMS+H  +L   K+++       N   +   + D + ++  +I  +D+SN  +P+++  +W   + EE++ Q   EK+ GL ++P  D+  VT   SQ GFI ++++PL+E+ A L+    +++L  +    ++Y
Sbjct:  317 LFKTFEIHQSTLVTYLLNLEHHYRNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWY 591          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 164.081 bits (414), Expect = 2.777e-42
Identity = 89/275 (32.36%), Postives = 151/275 (54.91%), Query Frame = 3
Query:  795 LFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSIL------ANFDWLSQSHRDLLMMI--LIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYY 1595
            LF  F I       ++  +  +Y    +HNF HA  V Q M+ ++    L    + L+VL  + A   HD++HPGF N Y INS +ELAI YND+S LE HHL+ A  +L   +C   ++L  +Q+   R  +I  +LATDMS+H  +L   K+++       N   +   + D + ++  +I  +D+SN  +P+++  +W   + EE++ Q   EK+ GL ++P  D+  VT   SQ GFI ++++PL+E+ A L+    +++L  +    ++Y
Sbjct:  331 LFKTFEIHQSTLVTYLLNLEHHYRNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWY 605          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 164.081 bits (414), Expect = 3.007e-42
Identity = 89/275 (32.36%), Postives = 151/275 (54.91%), Query Frame = 3
Query:  795 LFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSIL------ANFDWLSQSHRDLLMMI--LIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYY 1595
            LF  F I       ++  +  +Y    +HNF HA  V Q M+ ++    L    + L+VL  + A   HD++HPGF N Y INS +ELAI YND+S LE HHL+ A  +L   +C   ++L  +Q+   R  +I  +LATDMS+H  +L   K+++       N   +   + D + ++  +I  +D+SN  +P+++  +W   + EE++ Q   EK+ GL ++P  D+  VT   SQ GFI ++++PL+E+ A L+    +++L  +    ++Y
Sbjct:  329 LFKTFEIHQSTLVTYLLNLEHHYRNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENREWY 603          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde9 (gene:FBgn0259171 transcript:FBtr0333524)

HSP 1 Score: 342.813 bits (878), Expect = 6.107e-101
Identity = 158/320 (49.38%), Postives = 224/320 (70.00%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIE 1652
            E +   LR  +F+++ +SDA++++ ++ MF+EL    +F+I +     W++EVY +YN VPFHNF+H F V QMMY+I  +  L S++  L+ L+LL + + HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH S A  +L  P+C+IF +   +    IR G+I+CILATDM+RHNEIL  F  I   FD+ +++H +LL MILIK +DISNEARP+DVA  W+D L +EFF QSA EK  GLPV PFMD +KV+K  SQ  FI  V+ PLFE+L +L+ E  E ++IPV   L+YY +L+   + + K+RKS+ +
Sbjct:  678 EEVRAALRLPAFDSYEWSDADVIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPLFEALGELVPELTELIIIPVRIALEYYRRLN---DAQTKTRKSVAD 994          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde9 (gene:FBgn0259171 transcript:FBtr0299635)

HSP 1 Score: 342.813 bits (878), Expect = 6.107e-101
Identity = 158/320 (49.38%), Postives = 224/320 (70.00%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIE 1652
            E +   LR  +F+++ +SDA++++ ++ MF+EL    +F+I +     W++EVY +YN VPFHNF+H F V QMMY+I  +  L S++  L+ L+LL + + HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH S A  +L  P+C+IF +   +    IR G+I+CILATDM+RHNEIL  F  I   FD+ +++H +LL MILIK +DISNEARP+DVA  W+D L +EFF QSA EK  GLPV PFMD +KV+K  SQ  FI  V+ PLFE+L +L+ E  E ++IPV   L+YY +L+   + + K+RKS+ +
Sbjct:  678 EEVRAALRLPAFDSYEWSDADVIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPLFEALGELVPELTELIIIPVRIALEYYRRLN---DAQTKTRKSVAD 994          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde9 (gene:FBgn0259171 transcript:FBtr0333525)

HSP 1 Score: 342.813 bits (878), Expect = 6.107e-101
Identity = 158/320 (49.38%), Postives = 224/320 (70.00%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIE 1652
            E +   LR  +F+++ +SDA++++ ++ MF+EL    +F+I +     W++EVY +YN VPFHNF+H F V QMMY+I  +  L S++  L+ L+LL + + HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH S A  +L  P+C+IF +   +    IR G+I+CILATDM+RHNEIL  F  I   FD+ +++H +LL MILIK +DISNEARP+DVA  W+D L +EFF QSA EK  GLPV PFMD +KV+K  SQ  FI  V+ PLFE+L +L+ E  E ++IPV   L+YY +L+   + + K+RKS+ +
Sbjct:  678 EEVRAALRLPAFDSYEWSDADVIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPLFEALGELVPELTELIIIPVRIALEYYRRLN---DAQTKTRKSVAD 994          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde9 (gene:FBgn0259171 transcript:FBtr0330395)

HSP 1 Score: 342.813 bits (878), Expect = 1.236e-100
Identity = 158/320 (49.38%), Postives = 224/320 (70.00%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIE 1652
            E +   LR  +F+++ +SDA++++ ++ MF+EL    +F+I +     W++EVY +YN VPFHNF+H F V QMMY+I  +  L S++  L+ L+LL + + HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH S A  +L  P+C+IF +   +    IR G+I+CILATDM+RHNEIL  F  I   FD+ +++H +LL MILIK +DISNEARP+DVA  W+D L +EFF QSA EK  GLPV PFMD +KV+K  SQ  FI  V+ PLFE+L +L+ E  E ++IPV   L+YY +L+   + + K+RKS+ +
Sbjct:  678 EEVRAALRLPAFDSYEWSDADVIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPLFEALGELVPELTELIIIPVRIALEYYRRLN---DAQTKTRKSVAD 994          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0070521)

HSP 1 Score: 177.563 bits (449), Expect = 1.700e-46
Identity = 141/493 (28.60%), Postives = 226/493 (45.84%), Query Frame = 3
Query:  297 NSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKC---------------------EEMLKTALSNFEKRFISLSSKVENIC--FLKWMQSI---------SPRL--SQSRFGPVTYSIKAESQPPCPNPESIV-----PLSQSLTIVLSEYKILKFDEKEEENLSKQLREISFNNWS---YSDAE------LLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNY-NMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSIL------ANFDWLSQSHRDLLMMI--LIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            N  R PN  S  S+S N     LS  E+A  RL  +   +L+ C                     + ML   LS+F +   S +   E IC  FL   Q           +P L  + +  G  +    A S+ P   P S +     PLS + +           +   E  L   L E+  + W    +S  E      L      +F   EL +   I  K F  ++  +  +Y    PFHN  HA  VTQ    ++    L+   + L+V   L A+  HD++HPG  N + +NS SELA+ YND+S LENHHL+ A  +L    C IF ++  +Q++ +R  +I  +L+TDMS+H  +L   K+++       +   L  ++ D + ++  L+  +D+SN  +PL +  +W+  L EEFF Q   E++SG+ ++P  D+   T   SQ GFI ++++PL+E+ A L+    + +L  +    DYY  +
Sbjct:   83 NKSRRPNQSSSASRSGNPPGAPLSQGEEAYTRLATDTIEELDWCLDQLETIQTHRSVSDMASLKFKRMLNKELSHFSESSRSGNQISEYICSTFLDKQQEFDLPSLRVEDNPELVAANAAAGQQSAGQYARSRSPRGPPMSQISGVKRPLSHTNSFTGERLPTFGVETPRENELGTLLGEL--DTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEENRDYYQSM 573          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: si:dkey-219c10.4 (si:dkey-219c10.4 [Source:ZFIN;Acc:ZDB-GENE-081105-151])

HSP 1 Score: 381.333 bits (978), Expect = 2.659e-123
Identity = 214/526 (40.68%), Postives = 318/526 (60.46%), Query Frame = 3
Query:   66 DNMKKTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHL-INPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFE---QETKLEKCEEMLKTALSN-------FEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKE-EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLD 1607
            D   K I+F +NG  ++         +++ DL R+  +    +   K+ +  G  + I+P    L+ NS  S Y +E+ +    +C+S           EL  +E A+A L F+    E +L+  E+ + T  +         +++  S   K+E++  L W+  +   +S+    P  +  K   +      E +              K L+    E  E + + L+  +F+NW + DAE++  ++ M+ +L+  S FNI      ++++EVY  YN +PFHNFKH F VTQMMY +IW   L+SK+ S+D+L++LT++V HDL+H G+NNAYQIN+ +ELA+RYND SPLENHH + A  IL   + +IF +LPTEQ + IR G+IKCILATDMSRH +ILN FK+IL  FD+ ++ HRD+LMMI+IK SDISNEARP+DVA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV++PLF  LA L    ++H++ PV + LDYY++++
Sbjct:    2 DMATKIIYFTVNGRPEQAEFPIDCPAQDVKDLFRAAAEAGPHDI-LKLYNTKGNIINISP---QLASNSPHSYYKLEVVAA---DCNS-----------ELLGSELAVA-LGFDLTSMEKRLQSLEKRILTEAAETPAIVYEMKRQVESFREKLESVEHLSWL-GLFKDMSEGTHKPSPFYHKRTLRKTREECEHV------------REKFLQMSSLEVSEEVRQYLKTPTFDNWQWEDAEIMVLLQVMYTDLDFISTFNIEPDVLQQFLYEVYRRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRSKIDSIDLLIMLTSAVCHDLDHTGYNNAYQINARTELALRYNDISPLENHHCAVAFEILEKTESNIFRNLPTEQYKRIREGIIKCILATDMSRHTDILNKFKAILPVFDFGNKDHRDVLMMIMIKVSDISNEARPMDVAEPWLDCLLQEFFNQSDMEKLEGLPVTPFMDRDKVTKPSSQTGFIRFVLFPLFIELANLFPCLEQHIIDPVRKALDYYTEME 495          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde9a (phosphodiesterase 9A [Source:ZFIN;Acc:ZDB-GENE-130920-1])

HSP 1 Score: 325.094 bits (832), Expect = 7.124e-102
Identity = 150/317 (47.32%), Postives = 215/317 (67.82%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLS 1661
            L++  F+ W +   E+L  +  M+ +L L  +FNI+     RW+  ++ NY   PFHNF+H F VTQMMYS+I+   L+ K + +D+L+L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  I + PDC+IF+    E  + IR G I  ILATDM+RH EI++SFK  + +FD+ ++ H   L M+LIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD+EKVTK  +Q GFI+FV+ P+FE++ +L  + +E ++ P+    D Y +L  I +   + +K   EN++
Sbjct:  187 LKQPLFDVWQWESNEMLSCLEHMYHDLGLVKDFNINPITLKRWLLCIHDNYRNNPFHNFRHCFCVTQMMYSMIYLCGLQEKFTQVDILILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQIFSQPDCNIFASFDPEAFKQIRQGTITLILATDMARHGEIMDSFKQKVDSFDYNNEEHVTCLKMVLIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKAEGLPVAPFMDREKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEEVMVQPLRESRDKYEELKQIDDAMNEMQKKKTENVT 503          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: FQ378016.1 (high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A-like [Source:NCBI gene;Acc:571737])

HSP 1 Score: 313.923 bits (803), Expect = 5.634e-99
Identity = 144/316 (45.57%), Postives = 215/316 (68.04%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENL 1658
            L++ +F+ W +   E+L  +  M+ +L L  EFN++     RW+  +  NY   PFHNF+H F V+QMMY +I    L+ +++  D+ +L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL++P+C+IF+++  E  + IR  +I  ILATDM++H EIL+SFK  + NFD  ++ H   L M+LIK  DISNE RP +VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTK  +Q GFI+FV+ P+FE++ +L  + +E ++ P+    D+Y +L  I +   +++K   E++
Sbjct:   74 LKKPTFDVWHWEHNEMLSCLEYMYHDLGLVKEFNMNPITLKRWLLAIQENYRDNPFHNFRHCFCVSQMMYGMIHLCGLQDRLTMTDMCILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILSMPECNIFANIEPESFKQIRQAIITLILATDMAKHGEILDSFKQKVDNFDCTNEEHVKSLKMVLIKCCDISNEVRPTEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEEIMVQPLRDSRDHYEELKQIEDAMSEAQKKKTESM 389          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde9al (phosphodiesterase 9A like [Source:ZFIN;Acc:ZDB-GENE-130530-807])

HSP 1 Score: 317.005 bits (811), Expect = 1.388e-98
Identity = 149/317 (47.00%), Postives = 216/317 (68.14%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLS 1661
            L++ +F+ W +   E+L  +  M+ +L L  EFNI+     RW+  +  NY   PFHNF+H F V+QMMY +I    L+ K++  D+ +L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL+LP+C+IF+++  E  + IR  +I  ILATDM+RH EIL+SFK  + +FD+ ++ H   L M+LIK  DISNE RP +VA  W+DCL EE+F QS  EK  GLPVA FMD+EKVTK  +Q GFI+FV+ P+FE++ +L  + +E ++ P+    D+Y +L  I +   +++K   E+LS
Sbjct:  197 LKKPTFDVWHWEHNEMLSCLEYMYHDLGLVKEFNINPITLKRWLLGIQENYRSNPFHNFRHCFCVSQMMYGMIHLCNLQEKLTLTDLGILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILSLPECNIFANVEPEAFKQIRQAIITLILATDMARHGEILDSFKHKVDHFDFTNEEHVACLKMVLIKCCDISNEVRPTEVAEPWVDCLLEEYFMQSDREKSEGLPVAAFMDREKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEEIMVQPLRDSRDHYEELKQIDDAMTEAQKKKTESLS 513          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: FQ378016.1 (high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A-like [Source:NCBI gene;Acc:571737])

HSP 1 Score: 314.694 bits (805), Expect = 8.425e-98
Identity = 144/316 (45.57%), Postives = 215/316 (68.04%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENL 1658
            L++ +F+ W +   E+L  +  M+ +L L  EFN++     RW+  +  NY   PFHNF+H F V+QMMY +I    L+ +++  D+ +L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL++P+C+IF+++  E  + IR  +I  ILATDM++H EIL+SFK  + NFD  ++ H   L M+LIK  DISNE RP +VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTK  +Q GFI+FV+ P+FE++ +L  + +E ++ P+    D+Y +L  I +   +++K   E++
Sbjct:  196 LKKPTFDVWHWEHNEMLSCLEYMYHDLGLVKEFNMNPITLKRWLLAIQENYRDNPFHNFRHCFCVSQMMYGMIHLCGLQDRLTMTDMCILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILSMPECNIFANIEPESFKQIRQAIITLILATDMAKHGEILDSFKQKVDNFDCTNEEHVKSLKMVLIKCCDISNEVRPTEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEEIMVQPLRDSRDHYEELKQIEDAMSEAQKKKTESM 511          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000043255.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:65150883:65160642:1 gene:ENSXETG00000020480.1 transcript:ENSXETT00000043255.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 253.447 bits (646), Expect = 4.315e-78
Identity = 120/234 (51.28%), Postives = 163/234 (69.66%), Query Frame = 3
Query:  945 KSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSI 1646
            K KMS +++ VL+T++V HDL+HPG+NN YQIN+ +ELAIRYND SPLENHH + A  IL  P+ +IF+++  E  + IR  +I+ ILATDM+RH EIL SFK +L NFD+ ++ H   L M+LIK  DISNE RP  VA  W+DCL EE+F QS  EK  GLPV PFMD++KVTK  +Q GFI+FV+ P+FES+ +L    +E +++P+    D+Y +L  I     +  K I
Sbjct:   14 KEKMSLIELGVLMTSAVCHDLDHPGYNNTYQINAHTELAIRYNDMSPLENHHCAVAFQILAQPENNIFANITPELFKQIRQSIIRLILATDMARHGEILESFKKVLPNFDFSNEDHVKTLQMVLIKCCDISNEVRPTKVAEPWVDCLLEEYFMQSDREKSEGLPVTPFMDRDKVTKPKAQIGFIKFVLIPMFESVMKLFPHIEEVMVLPLREARDHYEELMEIEEALAEVSKDI 247          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: c16orf72 (chromosome 16 open reading frame 72 [Source:Xenbase;Acc:XB-GENE-957508])

HSP 1 Score: 226.098 bits (575), Expect = 1.992e-66
Identity = 118/306 (38.56%), Postives = 181/306 (59.15%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPV-LRQLDYYSQLD 1607
            E   + L+  +FN       ++L  +  MF +L+L + F +  +    ++  V  +Y   PFHNF H F V QM+Y +I + +L+ ++   D L ++ A++ HDL+HPG +N+YQ+N+ ++LA RYN  SPLENHH +  L IL+    ++  ++  EQ  +I+  +++ ILATDM  H +IL S + I     + ++ H   L   LIK  DISNEARP D A  W D L EE+F QS  EK  GLPV P+MD+++V KA +Q  FI F++ PL E+L Q + +  + LL P+   +L Y  Q+D
Sbjct:   29 EGTREALKRPTFNVLGMERPQMLSLLEHMFYQLDLVATFKMEPETLRCFLSSVQEHYQENPFHNFHHGFSVAQMLYCVISQCQLQERLLPSDTLAMMVAALCHDLDHPGLSNSYQVNAQTDLAKRYNYNSPLENHHWAVTLRILSQEKSNLLVNVAPEQLPHIQQEIMELILATDMVHHGKILQSLQHI-ETLSFSNREHVTALKKTLIKLCDISNEARPADQAEVWADSLMEEYFLQSDREKAEGLPVTPYMDRDRVRKADAQSSFITFLLLPLCEALCQHLPQLSDSLLQPLRAAKLRYQQQMD 333          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: c16orf72 (chromosome 16 open reading frame 72 [Source:Xenbase;Acc:XB-GENE-957508])

HSP 1 Score: 184.496 bits (467), Expect = 2.090e-51
Identity = 107/312 (34.29%), Postives = 175/312 (56.09%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILI-----KASDISNEARPLDVASKWIDC-LFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPV-LRQLDYYSQLD 1607
            E   + L+  +FN       ++L  +  MF +L+L + F +  +    ++  V  +Y   PFHNF H F V QM+Y +I + +L+ ++   D L ++ A++ HDL+HPG +N+YQ+N+ ++LA RYN  SPLENHH +  L IL+    ++  ++  EQ  +I+  +++ ILATDM  H +IL S + I    + LS S+R+ +  +       K   +S    P+     W+   +F   F QS  EK  GLPV P+MD+++V KA +Q  FI F++ PL E+L Q + +  + LL P+   +L Y  Q+D
Sbjct:   26 EGTREALKRPTFNVLGMERPQMLSLLEHMFYQLDLVATFKMEPETLRCFLSSVQEHYQENPFHNFHHGFSVAQMLYCVISQCQLQERLLPSDTLAMMVAALCHDLDHPGLSNSYQVNAQTDLAKRYNYNSPLENHHWAVTLRILSQEKSNLLVNVAPEQLPHIQQEIMELILATDMVHHGKILQSLQHI----ETLSFSNREHVTAVRTAPRYPKCPSVSYTHLPIS-PKPWVPVNVF--LFIQSDREKAEGLPVTPYMDRDRVRKADAQSSFITFLLLPLCEALCQHLPQLSDSLLQPLRAAKLRYQQQMD 330          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE4D (phosphodiesterase 4D [Source:NCBI gene;Acc:100496479])

HSP 1 Score: 175.252 bits (443), Expect = 2.135e-45
Identity = 97/320 (30.31%), Postives = 169/320 (52.81%), Query Frame = 3
Query:  690 EENLSKQLREISFNNWSY---------SDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNM-VPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQ--------SHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYY 1595
            EE L+K+L ++  N W            +  L   +  +F E E+   F I +     ++  +  +Y+  V +HN  HA  V Q  + ++    L++  + L++L  + AS  HD++HPG +N + IN+ SELA+ YND S LENHHL+    +L   +C IF +L  +Q++ +R  +I  +LATDMS+H  +L   K+++      S         S R  ++  ++  +D+SN  +PL +   W D + EEFF Q   E++ G+ ++P  DK   +   SQ GFI ++++PL+E+ A L+    + +L  +    ++Y
Sbjct:  261 EECLAKELEDV--NKWGLNIFKVAEFSGNRPLTVVMHTIFQEREMLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVAQSTHVLLSSPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQLLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLPLYRHWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWY 578          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE4D (phosphodiesterase 4D [Source:NCBI gene;Acc:100496479])

HSP 1 Score: 174.096 bits (440), Expect = 2.448e-45
Identity = 99/320 (30.94%), Postives = 171/320 (53.44%), Query Frame = 3
Query:  690 EENLSKQLREISFNNWS---YSDAE------LLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNM-VPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQ--------SHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYY 1595
            EE L+K+L ++  N W    +  AE      L   +  +F E E+   F I +     ++  +  +Y+  V +HN  HA  V Q  + ++    L++  + L++L  + AS  HD++HPG +N + IN+ SELA+ YND S LENHHL+    +L   +C IF +L  +Q++ +R  +I  +LATDMS+H  +L   K+++      S         S R  ++  ++  +D+SN  +PL +   W D + EEFF Q   E++ G+ ++P  DK   +   SQ GFI ++++PL+E+ A L+    + +L  +    ++Y
Sbjct:  211 EECLAKELEDV--NKWGLNIFKVAEFSGNRPLTVVMHTIFQEREMLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVAQSTHVLLSSPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQLLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLPLYRHWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWY 528          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde9a (phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:1277179])

HSP 1 Score: 335.109 bits (858), Expect = 1.974e-107
Identity = 154/298 (51.68%), Postives = 212/298 (71.14%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+  V+ NY   PFHNF+H F VTQMMYS++W   L+ K S +D+LVL+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IF+ +P E  R IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    ++Y +L
Sbjct:   38 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRNNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPVVEETMLRPLWESREHYEEL 335          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde9a (phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:1277179])

HSP 1 Score: 335.495 bits (859), Expect = 2.379e-107
Identity = 154/298 (51.68%), Postives = 212/298 (71.14%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+  V+ NY   PFHNF+H F VTQMMYS++W   L+ K S +D+LVL+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IF+ +P E  R IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    ++Y +L
Sbjct:   48 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRNNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPVVEETMLRPLWESREHYEEL 345          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde9a (phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:1277179])

HSP 1 Score: 335.495 bits (859), Expect = 2.379e-107
Identity = 154/298 (51.68%), Postives = 212/298 (71.14%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+  V+ NY   PFHNF+H F VTQMMYS++W   L+ K S +D+LVL+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IF+ +P E  R IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    ++Y +L
Sbjct:   48 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRNNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPVVEETMLRPLWESREHYEEL 345          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde9a (phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:1277179])

HSP 1 Score: 337.035 bits (863), Expect = 1.653e-106
Identity = 154/298 (51.68%), Postives = 212/298 (71.14%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+  V+ NY   PFHNF+H F VTQMMYS++W   L+ K S +D+LVL+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IF+ +P E  R IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    ++Y +L
Sbjct:  154 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRNNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPVVEETMLRPLWESREHYEEL 451          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde9a (phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:1277179])

HSP 1 Score: 337.421 bits (864), Expect = 4.284e-106
Identity = 154/298 (51.68%), Postives = 212/298 (71.14%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+  V+ NY   PFHNF+H F VTQMMYS++W   L+ K S +D+LVL+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IF+ +P E  R IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    ++Y +L
Sbjct:  195 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRNNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPVVEETMLRPLWESREHYEEL 492          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q8QZV1|PDE9A_RAT (High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Rattus norvegicus OX=10116 GN=Pde9a PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.523e-105
Identity = 159/327 (48.62%), Postives = 223/327 (68.20%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQ 1691
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+  V+ NY   PFHNF+H F VTQMMYS++W   L+ K S +D+LVL+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IF+ +P E  R IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    ++Y +L  + +   + +K   ENL+      A  +
Sbjct:  195 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRSNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPIVEETMLRPLWESREHYEELKQLDDAMKELQKK-TENLTSGATENAPEK 520          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|O70628|PDE9A_MOUSE (High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Mus musculus OX=10090 GN=Pde9a PE=1 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 2.997e-105
Identity = 154/298 (51.68%), Postives = 212/298 (71.14%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+  V+ NY   PFHNF+H F VTQMMYS++W   L+ K S +D+LVL+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IF+ +P E  R IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    ++Y +L
Sbjct:  195 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRNNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPVVEETMLRPLWESREHYEEL 492          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|O76083|PDE9A_HUMAN (High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Homo sapiens OX=9606 GN=PDE9A PE=1 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 1.918e-104
Identity = 154/304 (50.66%), Postives = 213/304 (70.07%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNG 1622
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+F V+ NY   PFHNF+H F V QMMYS++W   L+ K S  D+L+L+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IFS++P +  + IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    D Y +L  I + 
Sbjct:  256 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDA 559          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|H2QL32|PDE9A_PANTR (High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Pan troglodytes OX=9598 GN=PDE9A PE=1 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 3.462e-104
Identity = 153/304 (50.33%), Postives = 213/304 (70.07%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNG 1622
            LR+ +F+ W +   E+L  +  M+ +L L  +F+I+     RW+F V+ NY   PFHNF+H F V QMMYS++W   L+   S +D+L+L+TA++ HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL  P+C+IFS++P +  + IR GMI  ILATDM+RH EI++SFK  + NFD+ ++ H  LL MILIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTKA +Q GFI+FV+ P+FE++ +L    +E +L P+    D Y +L  I + 
Sbjct:  256 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQENFSQMDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDA 559          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q9I7S6|PDE9A_DROME (High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Drosophila melanogaster OX=7227 GN=Pde9 PE=2 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 6.121e-100
Identity = 158/320 (49.38%), Postives = 224/320 (70.00%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIE 1652
            E +   LR  +F+++ +SDA++++ ++ MF+EL    +F+I +     W++EVY +YN VPFHNF+H F V QMMY+I  +  L S++  L+ L+LL + + HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH S A  +L  P+C+IF +   +    IR G+I+CILATDM+RHNEIL  F  I   FD+ +++H +LL MILIK +DISNEARP+DVA  W+D L +EFF QSA EK  GLPV PFMD +KV+K  SQ  FI  V+ PLFE+L +L+ E  E ++IPV   L+YY +L+   + + K+RKS+ +
Sbjct:  678 EEVRAALRLPAFDSYEWSDADVIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPLFEALGELVPELTELIIIPVRIALEYYRRLN---DAQTKTRKSVAD 994          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A3P9GYU0 (Phosphodiesterase OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 6.698e-123
Identity = 217/531 (40.87%), Postives = 320/531 (60.26%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKE-EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKN 1667
            K I+F +NG  ++         +++ DL RS  +    +   K+ SP G+ +IN     L  NS SS Y +E+ +    +C  +   +      +LS+ EK +  L    E  +   ++   + +   +K+  S   K+EN+  L W+  +   LS+    P  +  K   Q      E +              K L+    E  E +   L+  +F+NW + DAE++  ++ M+ +L+  + FNI  +   +++FEVY  YN +PFHNFKH F VTQMMY +IW   L+SKM S+++L++LT++V HDL+H G+NNAYQIN+ ++LA+RYND SPLENHH + A  IL   + +IF +L T+Q + IR GMIKCILATDM+RHNEILN FKS L +FD+ ++ H+DLLMMILIK SDISNEARP++VA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV+ PL   L +L    K H++ PV + LDYY++++     + ++R    EN++K+
Sbjct:    4 KVIYFTVNGIPEQAEFPVDCPDQDVKDLFRSAAEAGPHDI-LKLYSPKGS-IINIST-RLEPNSPSSCYRLEVVAT---DCSHEPPGAEFAGGLDLSSIEKRLQCL----ERNILIYDDKTPSVVFEMKKQVDSFREKLENVEHLSWL-GLFKDLSEGTHKPSPFYHKRTLQKTREECERV------------REKFLQMSSLEVSEEVRNYLKTPTFDNWQWEDAEIMVLLQVMYTDLDFVASFNIEPETLQQFLFEVYRRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRSKMDSINLLIMLTSAVCHDLDHTGYNNAYQINARTDLALRYNDISPLENHHCAVAFEILERRESNIFRNLSTDQYKRIREGMIKCILATDMTRHNEILNKFKSTLPSFDFTNKEHKDLLMMILIKVSDISNEARPMEVAEPWLDCLLQEFFNQSDVEKLEGLPVTPFMDRDKVTKPSSQIGFIRFVLLPLLIELTKLFPCLKHHIIEPVRKALDYYTEMEKALEKEQQARAQ-SENVAKS 510          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A2T7PQB2 (Phosphodiesterase OS=Pomacea canaliculata OX=400727 GN=C0Q70_02579 PE=3 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 3.739e-122
Identity = 169/304 (55.59%), Postives = 237/304 (77.96%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            E + ++L++ +F+NW + D+E+L  +R+M+++L L S FNI +    RW+F+VY  YN VPFHNFKH FMV+QMMY ++W   L SK+  L++L+LLT+++ HDL+HPG+NNAYQIN+ +ELA+RYND SPLENHH + A  IL   +C+IF+HLP EQ R+IR GMI+CILATDM++HNEILN+FKS+L +FD+  + HR +LMMILIK +DISNE RP++V+  W++CL +EFFNQS  EK  GLPVAPFMD++KVTK +SQ GFI+FV+ PLFE++ +L  +    ++ PV R L+YY+ +
Sbjct:  268 EEVQQELKKPTFDNWQWDDSEMLILLRQMYVDLGLVSRFNIQMPTLLRWLFKVYTKYNHVPFHNFKHCFMVSQMMYGLVWLMDLPSKLDPLEILILLTSAICHDLDHPGYNNAYQINARTELALRYNDISPLENHHCAVAFEILESKECNIFAHLPREQFRHIREGMIRCILATDMAKHNEILNTFKSLLPHFDFTDKEHRAVLMMILIKVADISNECRPMEVSEPWLECLLQEFFNQSDMEKLEGLPVAPFMDRDKVTKPSSQIGFIKFVLLPLFEAVGELFPQIDGEVIDPVRRALEYYTDM 571          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A3Q3JER6 (Phosphodiesterase OS=Monopterus albus OX=43700 PE=3 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 3.967e-122
Identity = 218/545 (40.00%), Postives = 328/545 (60.18%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHL-INPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKEEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQCSSQTY 1709
            K I+F +NG  ++         +++ DL RS  +    +   K+ +P G  + I+P+   L  NS  S Y +E+ +    +C+S E         +LS+ EK +  L  E++  +E  E      +   +K+  S   K+E++  L W+  +   LS+    P  +  K   +      E +    Q   + +S  ++        E + + L+  +F+NW + DAE++  ++ M+ +L+  + F I      R++FEVY  YN +PFHNFKH F VTQMMY +IW   L+ KM  +D+L++LT++V HDL+H G+NNAYQIN+ +ELA+RYND SPLENHH + A  IL   + +IF +LP +Q + IR G+IKCILATDM+RHNEILN FKSIL  FD+ ++ H+D+LMMILIK SDISNEARP++VA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV+ PLF  LA L    ++H++ PV + LDYY++++     + K  ++  EN +K++      Q S+ ++
Sbjct:    4 KIIYFTMNGRPEQAEFPLDCPAQDVKDLFRSAAEAGPHDI-LKLYNPKGNIINISPN---LEPNSPQSRYKLEVVAA---DCNSAELAGAL--GFDLSSMEKRLQDL--EKKILIEAGE--TPAVVYEMKKQVDSFREKLESVEHLSWL-GLFKDLSEGTHKPSPFYHKRTLRKTREECEHV----QEKFLQMSSLEV-------SEEVRQYLKTPNFDNWQWEDAEIMVLLQVMYTDLDFIATFTIESDILQRFLFEVYRRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRRKMDGIDLLIMLTSAVCHDLDHTGYNNAYQINARTELALRYNDISPLENHHCAVAFEILEKTESNIFRNLPMDQYKRIREGIIKCILATDMTRHNEILNKFKSILPAFDFANKDHKDVLMMILIKVSDISNEARPMEVAEPWLDCLLQEFFNQSDVEKLEGLPVTPFMDRDKVTKPSSQTGFIRFVLLPLFMELANLFPCLEQHIIDPVRKALDYYTEMEKALE-REKQNRAQSENAAKSKETAVGMQSSADSH 522          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A3P9JVV5 (Phosphodiesterase OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.797e-121
Identity = 212/511 (41.49%), Postives = 309/511 (60.47%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKE-EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLD 1607
            K I+F +NG  ++         +++ DL RS  +    +   K+ SP G+ +IN     L  NS SS Y +E+ +    +C  +   +      +LS+ EK +  L    E  +   ++   + +   +K+  S   K+EN+  L W+  +   LS+    P  +  K   Q      E +              K L+    E  E +   L+  +F+NW + DAE++  ++ M+ +L+  + FNI  +   +++FEVY  YN +PFHNFKH F VTQMMY +IW   L+SKM S+++L++LT++V HDL+H G+NNAYQIN+ ++LA+RYND SPLENHH + A  IL   + +IF +L  +Q + IR GMIKCILATDM+RHNEILN FKS L +FD+ ++ H+DLLMMILIK SDISNEARP++VA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV+ PL   L +L    K H++ PV + LDYY++++
Sbjct:    4 KVIYFTVNGTPEQAEFPVDCPDQDVKDLFRSAAEAGPHDI-LKLYSPKGS-IINIST-RLEPNSPSSCYRLEVVAT---DCSHEPPGAEFAGGLDLSSIEKRLQCL----ERNILIYDDKTPSVVFEMKKQVDSFREKLENVEHLSWL-GLFKDLSEGTHKPSPFYHKRTLQKTREECERV------------REKFLQMSSLEVSEEVRNYLKTPTFDNWQWEDAEIMVLLQVMYTDLDFVATFNIEPETLQQFLFEVYRRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRSKMDSINLLIMLTSAVCHDLDHTGYNNAYQINARTDLALRYNDISPLENHHCAVAFEILERRESNIFRNLSPDQYKRIREGMIKCILATDMTRHNEILNKFKSTLPSFDFTNKEHKDLLMMILIKVSDISNEARPMEVAEPWLDCLLQEFFNQSDVEKLEGLPVTPFMDRDKVTKPSSQIGFIRFVLLPLLIELTKLFPCLKHHIIEPVRKALDYYTEME 491          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A3B3HIG3 (Phosphodiesterase OS=Oryzias latipes OX=8090 GN=LOC101166781 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 3.233e-121
Identity = 212/511 (41.49%), Postives = 308/511 (60.27%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKE-EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLD 1607
            K I+F +NG  ++         +++ DL RS  +    +   K+ SP G+ +IN     L  NS SS Y +E+ +    +C      +      +LS+ EK +  L    E  +   ++   + +   +K+  S   K+EN+  L W+  +   LS+    P  +  K   Q      E +              K L+    E  E +   L+  +F+NW + DAE++  ++ M+ +L+  + FNI  +   +++FEVY  YN +PFHNFKH F VTQMMY +IW   L+SKM S+++L++LT++V HDL+H G+NNAYQIN+ ++LA+RYND SPLENHH + A  IL   + +IF +L  +Q + IR GMIKCILATDM+RHNEILN FKS L +FD+ ++ H+DLLMMILIK SDISNEARP++VA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV+ PL   L +L    K H++ PV + LDYY++++
Sbjct:    4 KVIYFTVNGTPEQAEFPVDCPDQDVKDLFRSAAEAGPHDI-LKLYSPKGS-IINIST-RLEPNSPSSCYRLEVVAT---DCSHQPPGAELAGGLDLSSIEKRLQCL----ERNILIYDDKTPSVVFEMKKQVDSFREKLENVEHLSWL-GLFKDLSEGTHKPSPFYHKRTLQKTREECERV------------REKFLQMSSLEVSEEVRNYLKTPTFDNWQWEDAEIMVLLQVMYTDLDFVASFNIEPETLQQFLFEVYRRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRSKMDSINLLIMLTSAVCHDLDHTGYNNAYQINARTDLALRYNDISPLENHHCAVAFEILERRESNIFRNLSPDQYKRIREGMIKCILATDMTRHNEILNKFKSTLPSFDFTNKEHKDLLMMILIKVSDISNEARPMEVAEPWLDCLLQEFFNQSDVEKLEGLPVTPFMDRDKVTKPSSQIGFIRFVLLPLLIELTKLFPCLKHHIIEPVRKALDYYTEME 491          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: si:dkey-219c10.4 (high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A-like [Source:NCBI gene;Acc:103030131])

HSP 1 Score: 384.415 bits (986), Expect = 2.942e-124
Identity = 213/519 (41.04%), Postives = 317/519 (61.08%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHL-INPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSN-------FEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKE-EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLD 1607
            K I+F +NG  ++         +++ DL RS  +    +   K+ +P G  + I+P    L+ NS  S Y +E+ +    +C+S+   +      EL+    A+   L   E +L+  E+ + T  S         +++  S   K+E++  L W+  +   LS+    P  +  K   +      E +              K L+    E  E + + L+  +F+NW + DAE++  ++ M+ +L+  S FNI +    ++++EVY  YN +PFHNFKH F VTQMMY +IW   L+SK+ S+D+L++LT++V HDL+H G+NNAYQIN+ +ELA+RYND SPLENHH + A  IL   + +IF +L TEQ + IR G+IKCILATDMSRH +ILN FK+IL+ FD+ ++ HRD+LMMI+IK SDISNEARP+DVA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV++PLF  LA L    ++H++ PV + LDYY++++
Sbjct:    4 KIIYFTVNGRPEQAEFPVDCPAQDVKDLFRSAAEAGPHDI-LKLYNPKGNIINISP---QLTPNSPHSCYKLEVVAA---DCNSEPLGT------ELAV---ALGFDLSSMEKRLQSLEKKILTEASETPAIVYEMKRQVESFREKLESVEHLSWL-GLFKELSERPHKPSPFYHKRTLRKTREECEHV------------REKFLQMSTLEVSEEVRQYLKTPTFDNWQWEDAEIMVLLQVMYTDLDFISTFNIELDVLQQFLYEVYKRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRSKIDSVDLLIMLTSAVCHDLDHTGYNNAYQINARTELALRYNDISPLENHHCAVAFEILEKNESNIFRNLTTEQYKRIREGIIKCILATDMSRHTDILNKFKAILSTFDFDNKDHRDVLMMIMIKVSDISNEARPMDVAEPWLDCLLQEFFNQSDMEKLEGLPVTPFMDRDKVTKPSSQTGFIRFVLFPLFIELANLFPCLEQHIIDPVRKALDYYTEME 493          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: si:dkey-219c10.4 (high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A-like [Source:NCBI gene;Acc:103030131])

HSP 1 Score: 377.481 bits (968), Expect = 9.510e-122
Identity = 169/305 (55.41%), Postives = 233/305 (76.39%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLD 1607
            E + + L+  +F+NW + DAE++  ++ M+ +L+  S FNI +    ++++EVY  YN +PFHNFKH F VTQMMY +IW   L+SK+ S+D+L++LT++V HDL+H G+NNAYQIN+ +ELA+RYND SPLENHH + A  IL   + +IF +L TEQ + IR G+IKCILATDMSRH +ILN FK+IL+ FD+ ++ HRD+LMMI+IK SDISNEARP+DVA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV++PLF  LA L    ++H++ PV + LDYY++++
Sbjct:  161 EEVRQYLKTPTFDNWQWEDAEIMVLLQVMYTDLDFISTFNIELDVLQQFLYEVYKRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRSKIDSVDLLIMLTSAVCHDLDHTGYNNAYQINARTELALRYNDISPLENHHCAVAFEILEKNESNIFRNLTTEQYKRIREGIIKCILATDMSRHTDILNKFKAILSTFDFDNKDHRDVLMMIMIKVSDISNEARPMDVAEPWLDCLLQEFFNQSDMEKLEGLPVTPFMDRDKVTKPSSQTGFIRFVLFPLFIELANLFPCLEQHIIDPVRKALDYYTEME 465          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde9a (phosphodiesterase 9A [Source:NCBI gene;Acc:103028423])

HSP 1 Score: 329.331 bits (843), Expect = 1.884e-103
Identity = 154/317 (48.58%), Postives = 216/317 (68.14%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLS 1661
            LR+ +F+ W +   E+L  +  M+ +L L  +FNI+     RW+  ++ NY   PFHNF+H F VTQMMYS+I+   L+ K S +D+L+L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  I +  DC+IFS+   E  + IR G I  ILATDM+RH EIL+SFK  + NFD+ ++ H   L M+LIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD+EKVTK  +Q GFI+FV+ P+FE++ +L  + ++ ++ P+    D Y +L  I +   + +K   ENL+
Sbjct:  188 LRKPAFDVWLWESNEMLSCLEHMYHDLGLVRDFNINPITLKRWLLCIHDNYRNNPFHNFRHCFCVTQMMYSMIYLCNLQEKFSQVDILILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQIFSQADCNIFSNFDAEAFKQIRQGTITLILATDMARHGEILDSFKQKVDNFDFTNEEHVTCLKMVLIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKAEGLPVAPFMDREKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEDVMVQPLRESRDRYEELKQIDDAMNEVQKKKSENLT 504          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde9a (phosphodiesterase 9A [Source:NCBI gene;Acc:103028423])

HSP 1 Score: 329.331 bits (843), Expect = 1.966e-103
Identity = 154/317 (48.58%), Postives = 215/317 (67.82%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLS 1661
            LR+  F+ W +   E+L  +  M+ +L L  +FNI+     RW+  ++ NY   PFHNF+H F VTQMMYS+I+   L+ K S +D+L+L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  I +  DC+IFS+   E  + IR G I  ILATDM+RH EIL+SFK  + NFD+ ++ H   L M+LIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD+EKVTK  +Q GFI+FV+ P+FE++ +L  + ++ ++ P+    D Y +L  I +   + +K   ENL+
Sbjct:  188 LRQPVFDVWQWEPNEMLSCLEHMYHDLGLVRDFNINPITLKRWLLCIHDNYRNNPFHNFRHCFCVTQMMYSMIYLCNLQEKFSQVDILILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQIFSQADCNIFSNFDAEAFKQIRQGTITLILATDMARHGEILDSFKQKVDNFDFTNEEHVTCLKMVLIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKAEGLPVAPFMDREKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEDVMVQPLRESRDRYEELKQIDDAMNEVQKKKSENLT 504          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde9a (phosphodiesterase 9A [Source:NCBI gene;Acc:103028423])

HSP 1 Score: 324.709 bits (831), Expect = 6.194e-102
Identity = 151/309 (48.87%), Postives = 210/309 (67.96%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSR 1637
            LR+  F+ W +   E+L  +  M+ +L L  +FNI+     RW+  ++ NY   PFHNF+H F VTQMMYS+I+   L+ K S +D+L+L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  I +  DC+IFS+   E  + IR G I  ILATDM+RH EIL+SFK  + NFD+ ++ H   L M+LIK  DISNE RP++VA  W+DCL EE+F QS  EK  GLPVAPFMD+EKVTK  +Q GFI+FV+ P+FE++ +L  + ++ ++ P+    D Y +L  I +   + R
Sbjct:  164 LRQPVFDVWQWEPNEMLSCLEHMYHDLGLVRDFNINPITLKRWLLCIHDNYRNNPFHNFRHCFCVTQMMYSMIYLCNLQEKFSQVDILILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQIFSQADCNIFSNFDAEAFKQIRQGTITLILATDMARHGEILDSFKQKVDNFDFTNEEHVTCLKMVLIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKAEGLPVAPFMDREKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEDVMVQPLRESRDRYEELKQIDDAMNEVR 472          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: si:dkey-219c10.4 (si:dkey-219c10.4 [Source:ZFIN;Acc:ZDB-GENE-081105-151])

HSP 1 Score: 214.927 bits (546), Expect = 1.387e-65
Identity = 99/169 (58.58%), Postives = 130/169 (76.92%), Query Frame = 3
Query: 1032 YQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQL 1538
            +QIN+ +ELA+RYND SPLENHH + A  +L   + +IF +L  EQ + +R GMIKCILATDM RHN+IL SF +IL  FD+ ++ H D+LMMI+IK SDISNEARP+ VA  W+DCL +EFF+QS  EK  GLPV+PFMD++KV++++SQ  FIR V+ PLF +LA L
Sbjct:    1 FQINARTELALRYNDISPLENHHCAVAFELLEEHESNIFRNLTKEQYKRVREGMIKCILATDMGRHNDILASFNTILPTFDFRNREHTDVLMMIMIKVSDISNEARPMQVAEPWLDCLLQEFFSQSDVEKLEGLPVSPFMDRDKVSRSSSQVNFIRHVLLPLFVALATL 169          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde9al (phosphodiesterase 9A like [Source:ZFIN;Acc:ZDB-GENE-130530-807])

HSP 1 Score: 220.705 bits (561), Expect = 1.912e-65
Identity = 121/321 (37.69%), Postives = 191/321 (59.50%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKL---KSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFF-NQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDII--TNGKPKSRKSIIEN 1655
            L++ +F+ W +   E+L  +  MF +L L SEFNI+      W+  V  +  +   +    +F  T+  +S    G +   +S   S+  +     ++ H ++   +   YQ+N+ +ELA+RYND SPLENHH + A +IL+ P+ +I S +      +IR G+I+ IL+TDM+RH EIL SF+  L +FD+ +  H  +L M+LIK  DISNE RP++V+  W+DCL EE+F  QS  EKQ GLP A FMD++ VTK ++Q GF+ FV+ PL E+++QL  + +E ++ P+    D+Y +L ++  T  K KS   + E 
Sbjct:   27 LKQPTFDVWQWEHNEMLSCLEHMFHDLGLVSEFNINPITLKPWL-SVVMDRGIKTTNTLLLSFGSTEFRFSRAQCGMMHMFQSINGSVMPIKTEKTNIFHSVDCVAYMPRYQVNARTELAVRYNDVSPLENHHAAVAFHILSTPETNILSGVTHHAFTHIRQGVIELILSTDMARHGEILASFREYLKDFDFGNPEHMKVLKMMLIKCCDISNEVRPMEVSEPWLDCLLEEYFMQQSDREKQEGLPFAAFMDRDTVTKPSAQIGFLSFVLIPLLEAVSQLFPQMEETMVHPLRESRDHYQELSVLQETLSKKKSADKVPEG 346          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 156.377 bits (394), Expect = 8.942e-41
Identity = 88/304 (28.95%), Postives = 161/304 (52.96%), Query Frame = 3
Query:  696 NLSKQLREISFNNWSY---------SDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNY--NMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPV 1574
            N+   L+  + + WS+          +  L + + ++    EL S + I +     ++  +   Y  +  P+HN  HA  VTQ ++ ++ +  L   +S L+ L ++ A+  HDL H G  N + I + S++A+ YND++ LENHH+S A  ++   D +IF +L  +  R +R+ +++ +LATDMS H + + + KS L   + + +S     M +L+ A DIS+  +   +  +W + L EEFF Q   E + GLP +P  D+     A SQ GF+ F++ P F     ++++  E +++P+
Sbjct:  140 NVLVALKNWTCHKWSFDVFVLNEASGEHALKFVMHELLTRYELISRYKIPVAALVSFVEALEAGYSKHKNPYHNLAHAADVTQTVHYLLLQSGLMHWLSELETLAVIFAAAIHDLEHTGTTNNFHIQTRSDVALLYNDRAVLENHHVSAAYRLMQDDDMNIFINLSKDDWRELRALVVEMVLATDMSCHFQQIKTMKSALQQPESIDKSK---AMSLLLHAGDISHPTKEWPLHQRWTEALMEEFFRQGDREAKLGLPFSPLCDRNSTMVAQSQIGFMDFIVEPTF----SVLTDMAEKVVVPL 436          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde7a (phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031222-10])

HSP 1 Score: 151.369 bits (381), Expect = 1.678e-40
Identity = 86/253 (33.99%), Postives = 138/253 (54.55%), Query Frame = 3
Query:  795 LFSEFNISIKKFDRWIFEVYCNY-NMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQS--HRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLIS 1544
            L   F + + K   ++  V  +Y N  P+HN  HA  VTQ M+  + E KL   ++  D+++ L A+ +HD++HPG N  + I +   LA  Y++ S LENHH  + + +L   +  +F+HLP +++  +   +   ILATD+SR NE L+ FKS L   D   +   HR  ++ I +K +DI N  R  D + +W + + EEFF Q   E++  L ++P  D+   T    Q GF+ FV+ PLF   A+ + 
Sbjct:   37 LIQHFQLDMVKLRGFLVMVQEDYHNQNPYHNAVHAADVTQAMHCYLREPKLAVHLTRRDIMLGLLAASAHDVDHPGVNQPFLIKTHHHLASLYHNSSVLENHHWRSTVGMLR--ESGLFAHLPMDERLQMERDLGSLILATDISRQNEFLSQFKSHLDKGDLCLEEAPHRHFILQIALKCADICNPCRVWDTSKRWSEKVCEEFFKQGDMERKWRLEISPLCDRYTQTVPNIQIGFMTFVVEPLFMEWARFMG 287          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007435.1 (pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 gene:ENSPMAG00000006710.1 transcript:ENSPMAT00000007435.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 1.556e-35
Identity = 65/184 (35.33%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  957 SSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQ--------SHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQ 1484
            + L++L  + AS  HD++HPG +N + IN+ SELA+ YND+S LENHHL+    +L   +C IF +L  +Q++ +R  +I  +LATDMS+H  +L   K+++      S         + R  ++  ++  +D+SN  +PLDV  +W + + EEFF Q   E++ G+ ++P  DK   +   SQ
Sbjct:    9 TDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEENCDIFQNLSKKQRQTLRKMVIDMVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLQNMVHCADLSNPTKPLDVYRQWTERIMEEFFRQGDRERERGMEISPMCDKHSASVEKSQ 192          
BLAST of Phosphodiesterase vs. Ensembl Yeast
Match: PDE2 (High-affinity cyclic AMP phosphodiesterase; component of the cAMP-dependent protein kinase signaling system, protects the cell from extracellular cAMP, contains readthrough motif surrounding termination codon [Source:SGD;Acc:S000005887])

HSP 1 Score: 69.3218 bits (168), Expect = 1.076e-12
Identity = 65/237 (27.43%), Postives = 115/237 (48.52%), Query Frame = 3
Query:  738 SYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMV-PFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLP----TEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWI--------DCLFEEFFNQS 1409
            S S  EL++    +  +L   ++  I+  K    +F +  +Y+ V  FHNF+HA  V Q  + +        K + +  L+L  A++ HD+ HPG NN    N  SE+A  + + S LEN H      +L+        H P      ++++    + + ILATDM+ H++    ++  L + + + Q     L+ ++IKA+DISN  R L ++++W         DC   E F+++
Sbjct:  217 SLSTQELIWCGFTLIKKLSKDAKVLIADNKLLLLLFTLESSYHQVNKFHNFRHAIDVMQATWRLC---TYLLKDNPVQTLLLCMAAIGHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFHRELFQQLLS-------EHWPQLLSISKKKF--DFISEAILATDMALHSQ----YEDRLMHENPMKQI---TLISLIIKAADISNVTRTLSISARWAYLITLEFNDCALLETFHKA 434          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS5])

HSP 1 Score: 347.436 bits (890), Expect = 5.285e-111
Identity = 194/508 (38.19%), Postives = 296/508 (58.27%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHL-INPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKEEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSIL-ANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYY 1595
            K I+F + G  ++   ++    +++ +L RS  +    +   K+ +  G+ + I+P    LSENS    Y +E+ +     C   E      N C L   E+ +  L  E++  +E  E      + + + +  S   K+E++  L W+       S +               P P P  +   S+    V   Y+          NLS+           + +AE+LY +++M+I+L L  EF I   K   ++FEVY +YN  PFHNF+HAF VTQMMY +IW  ++ +K++  D+L++LT+++ HDL+HPG+NNAYQIN+ +ELA+RYND SPLENHH + A  I+     +I  ++  E  + IR GMIKCIL+TDM+RH++ILN FK +L + F +  ++H+ +LM I+IK SD+SNEARP+DVA  W+DCL +EFF QS  EK  GLPVAPFMD++KVTK ++Q GFI+FV+ PLFE+L +L    ++H++ PV + LDYY
Sbjct:    4 KVIYFTVGGKEEQAEFSSDIPADDVKELFRSAAEAGAYDI-LKLYNTKGSIVNISP---KLSENSPECRYKLEVVAASCSACGLCEP----GNGCSLEKLEQRIESL--EKQIIVENGEP--PPVVKDIKLKVDSFRDKLESVECLSWLGLFKEMTSGTT--------------PRPKPSLMRKSSEEFESVFIRYR----------NLSQ-----------WEEAEMLYLLQQMYIDLGLLDEFKIERSKLQHFLFEVYRHYNPTPFHNFRHAFCVTQMMYGLIWLTEIFNKITKQDLLIMLTSALCHDLDHPGYNNAYQINARTELALRYNDISPLENHHCAVAFDIMKQDKSNILQNVSAETFKKIREGMIKCILSTDMARHSDILNKFKELLKSGFKFDDEAHKSMLMQIMIKVSDVSNEARPMDVAEPWLDCLLQEFFIQSDVEKLEGLPVAPFMDRDKVTKPSAQIGFIKFVLVPLFEALGELFPILEDHIVSPVRKALDYY 464          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO46133 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM4])

HSP 1 Score: 162.155 bits (409), Expect = 1.923e-42
Identity = 85/254 (33.46%), Postives = 143/254 (56.30%), Query Frame = 3
Query:  870 VPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLS--------QSHRDLLMMI--LIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQ-SGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYS 1598
            VPFHN  HA  VTQ  + ++      +  + L++L  + AS  HD++HPG NN + + + SE+A+ YND+S LENHHL+ A  +L   DC IF +L  ++++  R  +I+ +LATD ++H  +L S K+++               +++ D + ++  L+  +D+SN  +PL +  KW+D L EEFF Q   E+   G+ ++P MD+   +   SQ  FI FV  PL+E+  +L+    + LL  +     +Y+
Sbjct:  267 VPFHNCIHAADVTQTAHVLLSAQAFDNVFTDLEILSAIIASAVHDVDHPGVNNHFLVATNSEMALMYNDESVLENHHLAVAFQLLQHEDCDIFENLSKQERQTARRMIIEMVLATDNAKHMSLLASLKTMVETKKVAGTGSGVLCLENYTDRMQVLKSLVHCADLSNPTKPLPIYRKWVDRLMEEFFRQGDKERDIDGMEISPMMDRHNASIEKSQVVFIDFVAQPLWETWGELVQPDAQDLLDTIEDNRQWYN 520          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO40948 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Q9])

HSP 1 Score: 149.828 bits (377), Expect = 1.210e-41
Identity = 77/164 (46.95%), Postives = 106/164 (64.63%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQM------MYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIR 1184
            L++ SFN W +   E++  +  M+ +L+L SEF I++    R++  +  NY   PFHNF H F VTQM      MY II    LK  +SS D+L+L+TA V H L+HPG+NN  QIN+ +E+AIRYND SPLENHH +TA  IL+ P+ +IF++LP E    IR
Sbjct:   13 LKKPSFNIWHWGPNEMVRLLEYMYHDLDLVSEFKINVNVLRRFLMCIQANYRNNPFHNFSHCFCVTQMAKSSLQMYGIIHLCNLKQLISSFDILILMTACVCHALDHPGYNNTNQINAQTEIAIRYNDTSPLENHHAATAFDILSQPEYNIFANLPEEMFTKIR 176          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO37301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA1])

HSP 1 Score: 149.828 bits (377), Expect = 1.487e-39
Identity = 97/289 (33.56%), Postives = 152/289 (52.60%), Query Frame = 3
Query:  693 ENLSKQLREISFNNWSYSDAELLYAVRKMFIEL----ELFSEFNISIKKFDRWIFEVYCNY--NMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLI 1541
            EN+ K   E +F+ ++ S++   + +R +  E+    ++   F I     DR++ +V   Y  +  P+HN  HA  VT  ++  +    +   +S L+V  LL +++ HDL H G  NA+ INS S+LA+ YND+S LENHH+S A  IL   + +I S L  EQ   +RS MI  +LATDMS H E L   K  L     +       ++ +L+  +DISN  +   +  +W   + EEFF Q   E + GL V+P  D+       SQ GFI F++ P  E  ++++
Sbjct:   73 ENVQKAF-EWTFDVFALSESCEGHPLRYIGYEVLHRRDMLRNFKIHAMTLDRFLQDVETGYKRHSNPYHNDCHAADVTHTVHYFLECMGVSKYLSDLEVFGLLLSAIIHDLEHTGTTNAFHINSRSDLALLYNDRSVLENHHVSCAFRILQDDEKNILSGLNLEQYADVRSLMIDTVLATDMSSHFEQLRLMKVALVAGSPIENRE---VVQLLLHVADISNPTKDWTIHRQWTTKIMEEFFTQGDMEIELGLDVSPLCDRSTTLIPESQIGFIDFIVSPALEVCSEVL 357          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO42681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0H3])

HSP 1 Score: 144.436 bits (363), Expect = 1.071e-38
Identity = 84/240 (35.00%), Postives = 136/240 (56.67%), Query Frame = 3
Query:  834 RWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILA--NFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQ--SGLPVAPFMDKEKVTKAAS-QCGFIRFVIYPLFESLAQL 1538
            RW+  V  NY  V +HN++HAF V Q M++I+  G L    S L+V  L+ A + HDL+H G NNA+Q  + S LA  Y+  S +E+HH    + ILN    +IFS +  E+ R     +   IL+TD++ + +   +F+ ILA  N DW + ++R+LL  +++ A D++   +P ++     + +  EFF+Q   EK+  +  P+ P MD+ K  +  S Q GFI F+  P++E   +L
Sbjct:    3 RWLLSVKKNYRPVKYHNWRHAFNVAQSMFTIMKTGSLCKYFSDLEVFALIVACLCHDLDHRGTNNAFQTKTDSPLAALYS-TSTMEHHHFDHCIMILNGEGNNIFSEMSPEEYRDTIKILEHAILSTDLALYFKKRGTFQEILAEPNVDWSADNNRELLRAMMMTACDVAAITKPWEIQRVVAEMVASEFFDQGDLEKEKLNAEPI-PMMDRRKKNELPSMQVGFIDFICLPIYELFYKL 240          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: si:dkey-219c10.4 (high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A [Source:NCBI gene;Acc:101166781])

HSP 1 Score: 384.8 bits (987), Expect = 1.217e-124
Identity = 212/511 (41.49%), Postives = 308/511 (60.27%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKE-EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLD 1607
            K I+F +NG  ++         +++ DL RS  +    +   K+ SP G+ +IN     L  NS SS Y +E+ +    +C      +      +LS+ EK +  L    E  +   ++   + +   +K+  S   K+EN+  L W+  +   LS+    P  +  K   Q      E +              K L+    E  E +   L+  +F+NW + DAE++  ++ M+ +L+  + FNI  +   +++FEVY  YN +PFHNFKH F VTQMMY +IW   L+SKM S+++L++LT++V HDL+H G+NNAYQIN+ ++LA+RYND SPLENHH + A  IL   + +IF +L  +Q + IR GMIKCILATDM+RHNEILN FKS L +FD+ ++ H+DLLMMILIK SDISNEARP++VA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV+ PL   L +L    K H++ PV + LDYY++++
Sbjct:    4 KVIYFTVNGTPEQAEFPVDCPDQDVKDLFRSAAEAGPHDI-LKLYSPKGS-IINIST-RLEPNSPSSCYRLEVVAT---DCSHQPPGAELAGGLDLSSIEKRLQCL----ERNILIYDDKTPSVVFEMKKQVDSFREKLENVEHLSWL-GLFKDLSEGTHKPSPFYHKRTLQKTREECERV------------REKFLQMSSLEVSEEVRNYLKTPTFDNWQWEDAEIMVLLQVMYTDLDFVASFNIEPETLQQFLFEVYRRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRSKMDSINLLIMLTSAVCHDLDHTGYNNAYQINARTDLALRYNDISPLENHHCAVAFEILERRESNIFRNLSPDQYKRIREGMIKCILATDMTRHNEILNKFKSTLPSFDFTNKEHKDLLMMILIKVSDISNEARPMEVAEPWLDCLLQEFFNQSDVEKLEGLPVTPFMDRDKVTKPSSQIGFIRFVLLPLLIELTKLFPCLKHHIIEPVRKALDYYTEME 491          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: si:dkey-219c10.4 (high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A [Source:NCBI gene;Acc:101166781])

HSP 1 Score: 370.548 bits (950), Expect = 1.002e-118
Identity = 207/487 (42.51%), Postives = 296/487 (60.78%), Query Frame = 3
Query:  150 IIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKE-EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLD 1607
            + DL RS  +    +   K+ SP G+ +IN     L  NS SS Y +E+ +    +C      +      +LS+ EK   + L   E  +   ++   + +   +K+  S   K+EN+  L W+  +   LS+    P  +  K   Q      E +              K L+    E  E +   L+  +F+NW + DAE++  ++ M+ +L+  + FNI  +   +++FEVY  YN +PFHNFKH F VTQMMY +IW   L+SKM S+++L++LT++V HDL+H G+NNAYQIN+ ++LA+RYND SPLENHH + A  IL   +  IF +L  +Q + IR GMIKCILATDM+RHNEILN FKS L +FD+ ++ H+DLLMMILIK SDISNEARP++VA  W+DCL +EFFNQS  EK  GLPV PFMD++KVTK +SQ GFIRFV+ PL   L +L    K H++ PV + LDYY++++
Sbjct:   14 LADLFRSAAEAGPHDI-LKLYSPKGS-IINIST-RLEPNSPSSCYRLEVVAT---DCSHQPPGAELAGGLDLSSIEKRSLQCL---ERNILIYDDKTPSVVFEMKKQVDSFREKLENVEHLSWL-GLFKDLSEGTHKPSPFYHKRTLQKTREECERV------------REKFLQMSSLEVSEEVRNYLKTPTFDNWQWEDAEIMVLLQVMYTDLDFVASFNIEPETLQQFLFEVYRRYNNIPFHNFKHCFCVTQMMYGLIWLTDLRSKMDSINLLIMLTSAVCHDLDHTGYNNAYQINARTDLALRYNDISPLENHHCAVAFEILERSN--IFRNLSPDQYKRIREGMIKCILATDMTRHNEILNKFKSTLPSFDFTNKEHKDLLMMILIKVSDISNEARPMEVAEPWLDCLLQEFFNQSDVEKLEGLPVTPFMDRDKVTKPSSQIGFIRFVLLPLLIELTKLFPCLKHHIIEPVRKALDYYTEME 476          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde9al (phosphodiesterase 9A [Source:NCBI gene;Acc:101169304])

HSP 1 Score: 307.76 bits (787), Expect = 4.079e-95
Identity = 184/511 (36.01%), Postives = 284/511 (55.58%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHL-INPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLK-WMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKEEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            +TI+  +NG   KV+ +      +I +L+ S   I  + +   +  P G  + I+P   ++  NS +S Y V   S   P    D  ++       LS   +  +R    +E K E     +   L+  EKR      KV  I   K  ++ +   +S    G V           CP   +++   + +T         K+   +E      L++ +F+ W +   E+L  +  M+ +L L  EFN++     RW+  +  NY   PFHNF+H F V+QMMY +I    L+ K++  ++ +L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL+LP+C+IF+++  E  + IR G+I  ILATDM+RH EIL +FK  + +FD+ ++ H   L  ++IK  DISNE RP +VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTK  +Q GFI+FV+ P+FE++ +L  + +E ++ P+    D+Y +L
Sbjct:   11 RTIYLDVNGRMQKVLFSRHCNSCDIKELLCSSSNI-PRNTAITLVGPEGAMVSIDP---TMPANSPNSLYKVVPLSTAQPGDKEDLVEN------VLSQVAEQFSRAFQIKELKTE-----VINRLAVLEKRVELEGLKVVEIEKCKNDLRKLQDEMSTKHGGRVN----------CPCKSTLLDDGRKVTPRRDVPSYPKYTLSQET--IDALKKPTFDVWHWEHNEMLSCLEYMYHDLGLVKEFNMNPITLKRWLLAIQENYRNNPFHNFRHCFCVSQMMYGMIHLCNLQEKLTLTNLGILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILSLPECNIFANVDPEAFKKIRQGIITLILATDMARHGEILETFKLNVDHFDFTNEEHVASLKTVMIKCCDISNEVRPAEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEEIMVQPLRDSRDHYEEL 494          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde9al (phosphodiesterase 9A [Source:NCBI gene;Acc:101169304])

HSP 1 Score: 305.834 bits (782), Expect = 1.200e-94
Identity = 140/298 (46.98%), Postives = 206/298 (69.13%), Query Frame = 3
Query:  711 LREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            L++ +F+ W +   E+L  +  M+ +L L  EFN++     RW+  +  NY   PFHNF+H F V+QMMY +I    L+ K++  ++ +L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL+LP+C+IF+++  E  + IR G+I  ILATDM+RH EIL +FK  + +FD+ ++ H   L  ++IK  DISNE RP +VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTK  +Q GFI+FV+ P+FE++ +L  + +E ++ P+    D+Y +L
Sbjct:  171 LKKPTFDVWHWEHNEMLSCLEYMYHDLGLVKEFNMNPITLKRWLLAIQENYRNNPFHNFRHCFCVSQMMYGMIHLCNLQEKLTLTNLGILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILSLPECNIFANVDPEAFKKIRQGIITLILATDMARHGEILETFKLNVDHFDFTNEEHVASLKTVMIKCCDISNEVRPAEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEEIMVQPLRDSRDHYEEL 468          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde9al (phosphodiesterase 9A [Source:NCBI gene;Acc:101169304])

HSP 1 Score: 297.36 bits (760), Expect = 1.441e-91
Identity = 136/284 (47.89%), Postives = 198/284 (69.72%), Query Frame = 3
Query:  753 ELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            ++L  +  M+ +L L  EFN++     RW+  +  NY   PFHNF+H F V+QMMY +I    L+ K++  ++ +L+TA+V HDL+HPG+NN YQIN+ +ELA+RYND SPLENHH + A  IL+LP+C+IF+++  E  + IR G+I  ILATDM+RH EIL +FK  + +FD+ ++ H   L  ++IK  DISNE RP +VA  W+DCL EE+F QS  EK  GLPVAPFMD++KVTK  +Q GFI+FV+ P+FE++ +L  + +E ++ P+    D+Y +L
Sbjct:  186 KMLSCLEYMYHDLGLVKEFNMNPITLKRWLLAIQENYRNNPFHNFRHCFCVSQMMYGMIHLCNLQEKLTLTNLGILMTAAVCHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILSLPECNIFANVDPEAFKKIRQGIITLILATDMARHGEILETFKLNVDHFDFTNEEHVASLKTVMIKCCDISNEVRPAEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKPTAQIGFIKFVLIPMFETVMKLFPQIEEIMVQPLRDSRDHYEEL 469          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000020487.1 (SMESG000020487.1)

HSP 1 Score: 1171.76 bits (3030), Expect = 0.000e+0
Identity = 571/573 (99.65%), Postives = 573/573 (100.00%), Query Frame = 3
Query:   72 MKKTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKEEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQCSSQTYIINSNIMDSSLILKPNQPTESIRKLSS 1790
            MKKTIFFKINGYSDK+MITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEK+EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQCSSQTYIINSNIMDSSLILKPNQPTESIRKLSS
Sbjct:    1 MKKTIFFKINGYSDKIMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKKEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQCSSQTYIINSNIMDSSLILKPNQPTESIRKLSS 573          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000020487.1 (SMESG000020487.1)

HSP 1 Score: 1140.56 bits (2949), Expect = 0.000e+0
Identity = 556/557 (99.82%), Postives = 557/557 (100.00%), Query Frame = 3
Query:  120 MITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKEEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQCSSQTYIINSNIMDSSLILKPNQPTESIRKLSS 1790
            MITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEK+EENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQCSSQTYIINSNIMDSSLILKPNQPTESIRKLSS
Sbjct:    1 MITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWMQSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKKEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQCSSQTYIINSNIMDSSLILKPNQPTESIRKLSS 557          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000023094.1 (SMESG000023094.1)

HSP 1 Score: 335.495 bits (859), Expect = 1.237e-104
Identity = 207/528 (39.20%), Postives = 307/528 (58.14%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHL-INPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARL--LFEQ-----ETKLEKCEEMLKTALSNFEKRFIS--LSSKVENICFLKWMQSISPRLS--------QSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKEEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQ-SHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            + I+ K     +++ +  + T ++I D++RSI   N+++   K+T+     L +NP   SL  N  S PY VE+ S     C      S        S  E  M ++  LF+       T + + E  +      F+K  +S  LS +  N    +    IS R S        Q+    +  +  ++S P C +  SI    + +  V  +Y+ L+  E    ++ + L+ +SFN WS+SDAEL+  V+ MFI L+L + FNI +   D+W+F VY NYN VPFHNF HAF V QM+Y++I    L+    SL++L L+ +++SHDL+HPG NNA+QIN+ + LA RYNDQSPLENHH + A  IL     +I  HL  +Q + +R   IKCIL+TDM++H +I+  F+++L   D ++  SHR +LM+++IK  DISNEARP  ++  W++CL EEFF QS  EK  GLP APFMD+EKVTK+ SQCGFI+FVI PLFE   ++    ++ +L PV  QL+YY++L
Sbjct:   17 RIIYVKTATKLEQIELPPQCTFDDIEDVLRSISGANRRDI-IKLTNHQNVVLSLNPS--SLEPNLPSQPYHVEVIS-----CCPQLFTSLISQGARRSLQELDMRKIQGLFDSFHDSYPTHIVELESRIIKLQDRFQKMHLSRQLSRENPNTIRPRNTSEISARCSICPYFSNIQTMQQCIHLNDLSQSSPMC-DWSSIGKTHKQIHTVWIQYQSLQKSEIRR-SVRENLKTLSFNMWSFSDAELINLVKLMFINLQLTTAFNIPLTTLDQWLFSVYQNYNTVPFHNFTHAFCVVQMLYAMINLANLREIFDSLEILTLMFSALSHDLDHPGLNNAFQINARTCLAQRYNDQSPLENHHCAMAFQILEEKKRNILKHLTDKQFKKLREISIKCILSTDMTKHADIVTEFRNLLPKLDLVNDSSHRIMLMVVVIKLCDISNEARPPHISEPWLECLLEEFFQQSDLEKLKGLPWAPFMDREKVTKSNSQCGFIKFVIMPLFELFGEVFPSVEDLILKPVKNQLEYYTKL 534          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000023094.1 (SMESG000023094.1)

HSP 1 Score: 334.724 bits (857), Expect = 2.216e-104
Identity = 203/543 (37.38%), Postives = 309/543 (56.91%), Query Frame = 3
Query:   78 KTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPSGTHL-INPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELSTTEKAMARLLFEQETKLEKCEEMLKTALSNF-----------EKRFISLSSKVENICFLKWM-----QSISPR-----LSQSRFGPVTYSIK-----------AESQPPCPNPESIVPLSQSLTIVLSEYKILKFDEKEEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISIKKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANFDWLSQ-SHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLDYYSQL 1604
            + I+ K     +++ +  + T ++I D++RSI   N+++   K+T+     L +NP   SL  N  S PY VE+ S   P   +             S   +   R L E + +++  E  ++    +F           E R I L  + + +   + +      +I PR      ++    P   +I+           ++S P C +  SI    + +  V  +Y+ L+  E    ++ + L+ +SFN WS+SDAEL+  V+ MFI L+L + FNI +   D+W+F VY NYN VPFHNF HAF V QM+Y++I    L+    SL++L L+ +++SHDL+HPG NNA+QIN+ + LA RYNDQSPLENHH + A  IL     +I  HL  +Q + +R   IKCIL+TDM++H +I+  F+++L   D ++  SHR +LM+++IK  DISNEARP  ++  W++CL EEFF QS  EK  GLP APFMD+EKVTK+ SQCGFI+FVI PLFE   ++    ++ +L PV  QL+YY++L
Sbjct:   17 RIIYVKTATKLEQIELPPQCTFDDIEDVLRSISGANRRDI-IKLTNHQNVVLSLNPS--SLEPNLPSQPYHVEVISC-CPQLFT-------------SLISQGARRSLQELDMRIDNVERKIQGLFDSFHDSYPTHIVELESRIIKLQDRFQKMHLSRQLSRENPNTIRPRNTSEISARCSICPYFSNIQTMQQCIHLNDLSQSSPMC-DWSSIGKTHKQIHTVWIQYQSLQKSEIRR-SVRENLKTLSFNMWSFSDAELINLVKLMFINLQLTTAFNIPLTTLDQWLFSVYQNYNTVPFHNFTHAFCVVQMLYAMINLANLREIFDSLEILTLMFSALSHDLDHPGLNNAFQINARTCLAQRYNDQSPLENHHCAMAFQILEEKKRNILKHLTDKQFKKLREISIKCILSTDMTKHADIVTEFRNLLPKLDLVNDSSHRIMLMVVVIKLCDISNEARPPHISEPWLECLLEEFFQQSDLEKLKGLPWAPFMDREKVTKSNSQCGFIKFVIMPLFELFGEVFPSVEDLILKPVKNQLEYYTKL 540          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000032148.1 (SMESG000032148.1)

HSP 1 Score: 179.104 bits (453), Expect = 1.803e-47
Identity = 97/296 (32.77%), Postives = 170/296 (57.43%), Query Frame = 3
Query:  777 MFIELELFSEFNISIKKFDRWIFEVYCNYNM-VPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDVLVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYILNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILA----------NFDWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEKQSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIPVLRQLD-YYSQLDIITNGKP 1628
            +F + +LF +F+I    F  +I E+   Y+  VP+HN  HA  VTQ    ++    L++  S L+++ ++ A + HD++HPG  N Y IN+  +LA+ YND S LENHHLS A  +L+LP+C I ++L  +Q++  R  +I  +LATDMS+H  +L   K+++           N D  + + R  ++  ++  +D+SN  +PL++   W + + +EFF Q   E++  L ++P  D+E  T   SQ  FI F+++PL+E+ + L+    + +L  + +  + Y+SQ+  I +  P
Sbjct:  316 LFRKYKLFEKFSIQSSIFLSFITEIENKYHKDVPYHNSTHAADVTQSTNVLLGALSLENVFSDLEIMAVIFACIIHDVDHPGVTNQYLINTNDQLALMYNDASVLENHHLSVAFTVLSLPNCDIITNLTKKQRQSFRKMVIDMVLATDMSKHMSLLADLKTMVETKKVAGSGILNLD--NYNDRIQILQNMVHCADLSNPTKPLNLYRSWTEKIMQEFFRQGDKEREKNLEISPMCDRETATVEKSQVSFIDFIVHPLWETWSDLVYPEAQDILDTLEKNREWYFSQISKIEDKDP 609          
The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE9A2.064e-10650.66phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE9A2.754e-10650.66phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE9A3.488e-10650.66phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE9A3.696e-10650.66phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE9A4.902e-10650.66phosphodiesterase 9A [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde-47.812e-4332.36Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-41.748e-4232.36Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-41.975e-4232.36Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-42.777e-4232.36Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-43.007e-4232.36Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde96.107e-10149.38gene:FBgn0259171 transcript:FBtr0333524[more]
Pde96.107e-10149.38gene:FBgn0259171 transcript:FBtr0299635[more]
Pde96.107e-10149.38gene:FBgn0259171 transcript:FBtr0333525[more]
Pde91.236e-10049.38gene:FBgn0259171 transcript:FBtr0330395[more]
dnc1.700e-4628.60gene:FBgn0000479 transcript:FBtr0070521[more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-219c10.42.659e-12340.68si:dkey-219c10.4 [Source:ZFIN;Acc:ZDB-GENE-081105-... [more]
pde9a7.124e-10247.32phosphodiesterase 9A [Source:ZFIN;Acc:ZDB-GENE-130... [more]
FQ378016.15.634e-9945.57high affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
pde9al1.388e-9847.00phosphodiesterase 9A like [Source:ZFIN;Acc:ZDB-GEN... [more]
FQ378016.18.425e-9845.57high affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000043255.14.315e-7851.28pep primary_assembly:Xenopus_tropicalis_v9.1:7:651... [more]
c16orf721.992e-6638.56chromosome 16 open reading frame 72 [Source:Xenbas... [more]
c16orf722.090e-5134.29chromosome 16 open reading frame 72 [Source:Xenbas... [more]
PDE4D2.135e-4530.31phosphodiesterase 4D [Source:NCBI gene;Acc:1004964... [more]
PDE4D2.448e-4530.94phosphodiesterase 4D [Source:NCBI gene;Acc:1004964... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde9a1.974e-10751.68phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:12... [more]
Pde9a2.379e-10751.68phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:12... [more]
Pde9a2.379e-10751.68phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:12... [more]
Pde9a1.653e-10651.68phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:12... [more]
Pde9a4.284e-10651.68phosphodiesterase 9A [Source:MGI Symbol;Acc:MGI:12... [more]
back to top
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8QZV1|PDE9A_RAT1.523e-10548.62High affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
sp|O70628|PDE9A_MOUSE2.997e-10551.68High affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
sp|O76083|PDE9A_HUMAN1.918e-10450.66High affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
sp|H2QL32|PDE9A_PANTR3.462e-10450.33High affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
sp|Q9I7S6|PDE9A_DROME6.121e-10049.38High affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
back to top
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P9GYU06.698e-12340.87Phosphodiesterase OS=Oryzias latipes OX=8090 PE=3 ... [more]
A0A2T7PQB23.739e-12255.59Phosphodiesterase OS=Pomacea canaliculata OX=40072... [more]
A0A3Q3JER63.967e-12240.00Phosphodiesterase OS=Monopterus albus OX=43700 PE=... [more]
A0A3P9JVV51.797e-12141.49Phosphodiesterase OS=Oryzias latipes OX=8090 PE=3 ... [more]
A0A3B3HIG33.233e-12141.49Phosphodiesterase OS=Oryzias latipes OX=8090 GN=LO... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-219c10.42.942e-12441.04high affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
si:dkey-219c10.49.510e-12255.41high affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
pde9a1.884e-10348.58phosphodiesterase 9A [Source:NCBI gene;Acc:1030284... [more]
pde9a1.966e-10348.58phosphodiesterase 9A [Source:NCBI gene;Acc:1030284... [more]
pde9a6.194e-10248.87phosphodiesterase 9A [Source:NCBI gene;Acc:1030284... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-219c10.41.387e-6558.58si:dkey-219c10.4 [Source:ZFIN;Acc:ZDB-GENE-081105-... [more]
pde9al1.912e-6537.69phosphodiesterase 9A like [Source:ZFIN;Acc:ZDB-GEN... [more]
pde1a8.942e-4128.95phosphodiesterase 1A, calmodulin-dependent [Source... [more]
pde7a1.678e-4033.99phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031... [more]
ENSPMAT00000007435.11.556e-3535.33pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 ge... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDE21.076e-1227.43High-affinity cyclic AMP phosphodiesterase; compon... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO321795.285e-11138.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461331.923e-4233.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409481.210e-4146.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373011.487e-3933.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426811.071e-3835.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-219c10.41.217e-12441.49high affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
si:dkey-219c10.41.002e-11842.51high affinity cGMP-specific 3',5'-cyclic phosphodi... [more]
pde9al4.079e-9536.01phosphodiesterase 9A [Source:NCBI gene;Acc:1011693... [more]
pde9al1.200e-9446.98phosphodiesterase 9A [Source:NCBI gene;Acc:1011693... [more]
pde9al1.441e-9147.89phosphodiesterase 9A [Source:NCBI gene;Acc:1011693... [more]
back to top
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020487.10.000e+099.65SMESG000020487.1[more]
SMESG000020487.10.000e+099.82SMESG000020487.1[more]
SMESG000023094.11.237e-10439.20SMESG000023094.1[more]
SMESG000023094.12.216e-10437.38SMESG000023094.1[more]
SMESG000032148.11.803e-4732.77SMESG000032148.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005249 ID=SMED30005249|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=2427bp
GGTGACTTTCTTTTAATAATCCAAATATTTTAAAGAATTTGTTATCTTAA
ATCAAAATTACATGTGATAATATGAAGAAAACTATTTTCTTTAAAATTAA
CGGATATAGCGACAAAGTTATGATTACGAATAAAACAACACCTGAAGAAA
TCATAGATTTAATTCGCTCTATCGGCAAAATTAATAAGAAAGAATCAGAC
TACAAAATAACGTCCCCAAGTGGAACTCATCTAATTAATCCAGATTATTA
TTCATTGTCCGAAAACTCCCAATCTTCTCCCTATATTGTCGAAATCAATT
CACCCAGAATTCCAAATTGTCATTCCGATGAATCACAGTCACATAATCAC
AATTCTTGTGAATTATCCACTACAGAAAAAGCAATGGCAAGATTGTTATT
TGAGCAGGAAACGAAATTGGAAAAATGTGAAGAAATGTTGAAAACTGCTT
TGAGTAATTTCGAGAAAAGATTCATATCATTATCATCAAAAGTTGAGAAC
ATTTGTTTTTTGAAATGGATGCAGTCGATATCTCCCCGTTTATCTCAGTC
TAGATTTGGACCTGTGACTTATAGTATTAAAGCAGAATCCCAGCCCCCTT
GTCCTAACCCAGAATCTATAGTTCCTCTCAGTCAATCACTCACTATTGTA
TTGAGTGAATACAAAATACTCAAATTCGACGAAAAAGAAGAGGAAAATCT
ATCAAAACAGCTTAGGGAAATATCGTTTAATAATTGGTCTTACTCTGATG
CGGAACTATTATATGCCGTCAGGAAAATGTTTATTGAACTAGAATTGTTT
TCTGAATTCAACATTTCCATCAAGAAATTTGATAGATGGATTTTTGAAGT
CTATTGTAACTACAATATGGTGCCTTTCCACAACTTCAAACATGCATTTA
TGGTGACACAAATGATGTATTCTATTATTTGGGAAGGAAAACTGAAATCG
AAAATGTCTTCACTCGATGTATTAGTTTTGTTGACTGCTTCAGTTTCACA
CGACCTAAATCATCCAGGTTTCAATAATGCTTACCAGATAAACAGTGGAT
CCGAACTGGCAATTCGATACAACGATCAAAGCCCATTGGAAAATCATCAT
TTATCCACAGCATTGTATATCTTAAATCTCCCAGACTGTTCAATATTTTC
CCATTTGCCAACAGAACAACAAAGATATATAAGAAGTGGAATGATCAAGT
GCATTTTAGCCACTGACATGTCTCGGCACAATGAAATTTTGAATAGTTTC
AAATCTATTTTAGCGAATTTTGATTGGTTATCTCAGTCTCACAGAGATCT
TCTAATGATGATTCTAATCAAAGCATCAGACATCTCAAATGAAGCAAGAC
CGTTGGATGTTGCTTCGAAATGGATTGACTGTCTATTTGAAGAGTTCTTT
AATCAAAGTGCTTTTGAGAAACAATCTGGTCTTCCAGTCGCTCCTTTTAT
GGATAAAGAAAAGGTCACAAAAGCTGCAAGTCAATGTGGTTTTATAAGAT
TTGTTATTTATCCGTTGTTTGAAAGCTTAGCACAATTAATTTCAGAATAT
AAAGAACATCTGCTGATACCCGTTCTTCGACAATTGGACTATTATTCCCA
GCTCGATATTATTACAAATGGAAAACCGAAATCTCGGAAAAGTATTATCG
AAAATCTCTCAAAAAACCAATTTAGAAGAGCTAGTCACCAGTGTTCTTCA
CAGACCTATATAATAAATTCCAATATCATGGATTCATCTTTAATTTTGAA
ACCCAATCAACCGACTGAATCCATTCGCAAACTCTCCTCCTAAATTATAT
ATAAATTATATATATTTTTTATATATATATATAAATATGAAATTATTTAT
GGGGGTTTATTATAATTCTTTGAAAAATTATTATCATTTCATTTCCTCAT
TGCTGGCAGGAAATTGATGACCTAAATCTGTCGCTGCCTTGATCTAATTA
CTGTCTTGTTTAACATGGCAGTCCATTCAGCTAATTTCCTTCATCTATGA
ATCAAATAAACGGGTTTTAATTCGATCTAATAATAAATGAATTGATTGAT
TAATTTATTAATTAATTAATTGATTGTTCAAATTCAAACAGTTTATCGTG
TCGCTTCATTCGCATTATTTCATATTTGTCTTATTTATGCAAATTATCCG
AGCTCTATCAATGCCATTTATTGTTGATTTTTTCTGTTATGATGAAATTT
ATTTTTGATACGAAATTACCGAATGAAGCATTGAAAATTGTTTTTCCACA
TCATTCTTTCTTTTTTTGTTAATTGTAAGTTATATTTTTCTATAACCCGT
CCTTTTTCAATGTTTTTTATTCGTTCCGAATTGTAACTCGTGATAGAATT
GTAAATTGTCAACCGTTTCAACCTGCTGGCTATCTCTAATTTGACATTTT
AATACATTTGTTGTAATTGAAAAAAAA
back to top

protein sequence of SMED30005249-orf-1

>SMED30005249-orf-1 ID=SMED30005249-orf-1|Name=SMED30005249-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=574bp
MKKTIFFKINGYSDKVMITNKTTPEEIIDLIRSIGKINKKESDYKITSPS
GTHLINPDYYSLSENSQSSPYIVEINSPRIPNCHSDESQSHNHNSCELST
TEKAMARLLFEQETKLEKCEEMLKTALSNFEKRFISLSSKVENICFLKWM
QSISPRLSQSRFGPVTYSIKAESQPPCPNPESIVPLSQSLTIVLSEYKIL
KFDEKEEENLSKQLREISFNNWSYSDAELLYAVRKMFIELELFSEFNISI
KKFDRWIFEVYCNYNMVPFHNFKHAFMVTQMMYSIIWEGKLKSKMSSLDV
LVLLTASVSHDLNHPGFNNAYQINSGSELAIRYNDQSPLENHHLSTALYI
LNLPDCSIFSHLPTEQQRYIRSGMIKCILATDMSRHNEILNSFKSILANF
DWLSQSHRDLLMMILIKASDISNEARPLDVASKWIDCLFEEFFNQSAFEK
QSGLPVAPFMDKEKVTKAASQCGFIRFVIYPLFESLAQLISEYKEHLLIP
VLRQLDYYSQLDIITNGKPKSRKSIIENLSKNQFRRASHQCSSQTYIINS
NIMDSSLILKPNQPTESIRKLSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000141dorsal region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036971PDEase_catalytic_dom_sf
IPR003607HD/PDEase_dom
IPR023088PDEase
IPR002073PDEase_catalytic_dom
IPR023174PDEase_CS
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR0230883'5'-cyclic nucleotide phosphodiesterasePRINTSPR00387PDIESTERASE1coord: 416..429
score: 30.57
coord: 265..278
score: 42.0
coord: 296..309
score: 25.43
coord: 310..325
score: 50.25
coord: 337..353
score: 45.18
coord: 433..449
score: 37.53
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPFAMPF00233PDEase_Icoord: 269..496
e-value: 9.5E-81
score: 271.0
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPROSITEPS51845PDEASE_I_2coord: 180..515
score: 108.5
IPR0369713'5'-cyclic nucleotide phosphodiesterase, catalytic domain superfamilyGENE3DG3DSA:1.10.1300.10coord: 204..524
e-value: 9.8E-114
score: 381.5
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 51..516
NoneNo IPR availablePANTHERPTHR11347:SF200HIGH AFFINITY CGMP-SPECIFIC 3',5'-CYCLIC PHOSPHODIESTERASE 9Acoord: 51..516
NoneNo IPR availableSUPERFAMILYSSF109604HD-domain/PDEase-likecoord: 207..512
IPR0231743'5'-cyclic nucleotide phosphodiesterase, conserved sitePROSITEPS00126PDEASE_I_1coord: 310..321
IPR003607HD/PDEase domainCDDcd00077HDccoord: 270..443
e-value: 3.14658E-9
score: 53.8825